2ACFA

Nmr structure of sars-cov non-structural protein nsp3a (sars1) from sars coronavirus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
172
Chain Sequence
HHHMPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of severe acute respiratory syndrome coronavirus ADP-ribose-1''-phosphate dephosphorylation by a conserved domain of nsP3.
pubmed doi rcsb
source organism Sars coronavirus tor2
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 62
structure length 172
sequence length 172
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2acfA00
3H8FA 4K3NA 4J5QA 5FSUA 1LAMA 4ETKA 1BLLE 1LAPA 4IQYA 3EKEA 3KQZA 5FSXA 4UMLA 4ZY2A 2BFRA 4R7MA 1BPMA 2XD7A 5AILA 2ACFA 4ETJA 1NJRA 2VRIA 3IJ3A 2EWBA 3V2BA 1TXZA 5FSVA 1LANA 3EWRA 2AFCA 1LCPA 1BPNA 4J5RA 4ABLA 1TY8A 4J4ZA 4J5SA 1ZR5A 3Q6ZA 4R6TA 3ETIA 4ABKA 2BFQA 2L8RA 4ZX9A 4KSIA 4X2TA 3EJGA 1YD9A 3GPQA 4D86A 3Q71A 4K0CA 1VHUA 3KR4A 2LGRA 2FAVA 2X47A 5FSYA 3EWQA 4JCAA 4R76A 5CMSA 4ZY1A 3GPOA 1ZR3A 3EJFA 1GYTA 3H8EA 3H8GA 4GUAA 2FG1A 2FXKA 4ZYQA 3IIDA 2EEEA 3EW5A 3PEIA 3SIHA 3GQEA 4ZI6A 3KR5A 3EWPA 3VFQA 4GVVA 3IIFA 3SIGA 2DX6A 3SIJA 3KQXA 5HIHA 4KYBA 4ESSA 2J9AA 5CB5A 3SIIA 4JVVA 3T8WA 3V45A 3GPGA 5CBMA 3KZWA 1HJZA 5CB3A 3JRUA 4JGKA 4JLLA 5FSZA 4GVWA 1SPVA 5DUSA 5E3BA 3EWOA 4TU0A 5HOLA 4ZX8A 3GQOA 3JZTA 4ZY0A 5D8NA
chains in the Genus database with same CATH superfamily
3H8FA 4K3NA 4J5QA 5FSUA 1LAMA 4ETKA 2W2GA 1BLLE 1LAPA 4IQYA 3EKEA 3KQZA 5FSXA 4UMLA 4ZY2A 2BFRA 4R7MA 1BPMA 2XD7A 5AILA 2ACFA 4ETJA 1NJRA 2VRIA 3IJ3A 2EWBA 3V2BA 1TXZA 5FSVA 2JZDA 1LANA 3EWRA 2AFCA 1LCPA 1BPNA 4J5RA 4ABLA 1TY8A 4J4ZA 4J5SA 1ZR5A 3Q6ZA 4R6TA 3ETIA 4ABKA 2BFQA 2L8RA 4ZX9A 4KSIA 4X2TA 3EJGA 1YD9A 3GPQA 4D86A 3Q71A 4K0CA 1VHUA 3KR4A 2LGRA 2FAVA 2X47A 5FSYA 3EWQA 4JCAA 4R76A 5CMSA 4ZY1A 3GPOA 1ZR3A 3EJFA 1GYTA 2JZFA 3H8EA 3H8GA 4GUAA 2FG1A 2WCTA 2FXKA 4ZYQA 3IIDA 2EEEA 3EW5A 3PEIA 3SIHA 3GQEA 4ZI6A 3KR5A 3EWPA 3VFQA 4GVVA 3IIFA 3SIGA 2RNKA 2DX6A 3SIJA 3KQXA 5HIHA 4KYBA 4ESSA 2J9AA 5CB5A 3SIIA 4JVVA 3T8WA 3V45A 3GPGA 5CBMA 3KZWA 1HJZA 5CB3A 3JRUA 4JGKA 4JLLA 5FSZA 4GVWA 1SPVA 5DUSA 5E3BA 3EWOA 4TU0A 5HOLA 4ZX8A 2KQVA 3GQOA 2JZEA 3JZTA 4ZY0A 5D8NA
chains in the Genus database with same CATH topology
3H8FA 4K3NA 4J5QA 5FSUA 1LAMA 4ETKA 1BLLE 1LAPA 4IQYA 3EKEA 3KQZA 5FSXA 4UMLA 4ZY2A 2BFRA 4R7MA 1BPMA 2XD7A 5AILA 2ACFA 4ETJA 1NJRA 2VRIA 3IJ3A 2EWBA 3V2BA 1TXZA 5FSVA 1LANA 3EWRA 2AFCA 1LCPA 1BPNA 4J5RA 4ABLA 1TY8A 4J4ZA 4J5SA 1ZR5A 3Q6ZA 4R6TA 3ETIA 4ABKA 2BFQA 2L8RA 4ZX9A 4KSIA 4X2TA 3EJGA 1YD9A 3GPQA 4D86A 3Q71A 4K0CA 1VHUA 3KR4A 2LGRA 2FAVA 2X47A 5FSYA 3EWQA 4JCAA 4R76A 5CMSA 4ZY1A 3GPOA 1ZR3A 3EJFA 1GYTA 3H8EA 3H8GA 4GUAA 2FG1A 2FXKA 4ZYQA 3IIDA 2EEEA 3EW5A 3PEIA 3SIHA 3GQEA 4ZI6A 3KR5A 3EWPA 3VFQA 4GVVA 3IIFA 3SIGA 2DX6A 3SIJA 3KQXA 5HIHA 4KYBA 4ESSA 2J9AA 5CB5A 3SIIA 4JVVA 3T8WA 3V45A 3GPGA 5CBMA 3KZWA 1HJZA 5CB3A 3JRUA 4JGKA 4JLLA 5FSZA 4GVWA 1SPVA 5DUSA 5E3BA 3EWOA 4TU0A 5HOLA 4ZX8A 3GQOA 3JZTA 4ZY0A 5D8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8F A;  4K3N A;  4J5Q A;  5FSU A;  1LAM A;  4ETK A;  1BLL E;  1LAP A;  4IQY A;  3EKE A;  3KQZ A;  5FSX A;  4UML A;  4ZY2 A;  2BFR A;  4R7M A;  1BPM A;  2XD7 A;  5AIL A;  2ACF A;  4ETJ A;  1NJR A;  2VRI A;  3IJ3 A;  2EWB A;  3V2B A;  1TXZ A;  5FSV A;  1LAN A;  3EWR A;  2AFC A;  1LCP A;  1BPN A;  4J5R A;  4ABL A;  1TY8 A;  4J4Z A;  4J5S A;  1ZR5 A;  3Q6Z A;  4R6T A;  3ETI A;  4ABK A;  2BFQ A;  2L8R A;  4ZX9 A;  4KSI A;  4X2T A;  3EJG A;  1YD9 A;  3GPQ A;  4D86 A;  3Q71 A;  4K0C A;  1VHU A;  3KR4 A;  2LGR A;  2FAV A;  2X47 A;  5FSY A;  3EWQ A;  4JCA A;  4R76 A;  5CMS A;  4ZY1 A;  3GPO A;  1ZR3 A;  3EJF A;  1GYT A;  3H8E A;  3H8G A;  4GUA A;  2FG1 A;  2FXK A;  4ZYQ A;  3IID A;  2EEE A;  3EW5 A;  3PEI A;  3SIH A;  3GQE A;  4ZI6 A;  3KR5 A;  3EWP A;  3VFQ A;  4GVV A;  3IIF A;  3SIG A;  2DX6 A;  3SIJ A;  3KQX A;  5HIH A;  4KYB A;  4ESS A;  2J9A A;  5CB5 A;  3SII A;  4JVV A;  3T8W A;  3V45 A;  3GPG A;  5CBM A;  3KZW A;  1HJZ A;  5CB3 A;  3JRU A;  4JGK A;  4JLL A;  5FSZ A;  4GVW A;  1SPV A;  5DUS A;  5E3B A;  3EWO A;  4TU0 A;  5HOL A;  4ZX8 A;  3GQO A;  3JZT A;  4ZY0 A;  5D8N A; 
#chains in the Genus database with same CATH topology
 3H8F A;  4K3N A;  4J5Q A;  5FSU A;  1LAM A;  4ETK A;  2W2G A;  1BLL E;  1LAP A;  4IQY A;  3EKE A;  3KQZ A;  5FSX A;  4UML A;  4ZY2 A;  2BFR A;  4R7M A;  1BPM A;  2XD7 A;  5AIL A;  2ACF A;  4ETJ A;  1NJR A;  2VRI A;  3IJ3 A;  2EWB A;  3V2B A;  1TXZ A;  5FSV A;  2JZD A;  1LAN A;  3EWR A;  2AFC A;  1LCP A;  1BPN A;  4J5R A;  4ABL A;  1TY8 A;  4J4Z A;  4J5S A;  1ZR5 A;  3Q6Z A;  4R6T A;  3ETI A;  4ABK A;  2BFQ A;  2L8R A;  4ZX9 A;  4KSI A;  4X2T A;  3EJG A;  1YD9 A;  3GPQ A;  4D86 A;  3Q71 A;  4K0C A;  1VHU A;  3KR4 A;  2LGR A;  2FAV A;  2X47 A;  5FSY A;  3EWQ A;  4JCA A;  4R76 A;  5CMS A;  4ZY1 A;  3GPO A;  1ZR3 A;  3EJF A;  1GYT A;  2JZF A;  3H8E A;  3H8G A;  4GUA A;  2FG1 A;  2WCT A;  2FXK A;  4ZYQ A;  3IID A;  2EEE A;  3EW5 A;  3PEI A;  3SIH A;  3GQE A;  4ZI6 A;  3KR5 A;  3EWP A;  3VFQ A;  4GVV A;  3IIF A;  3SIG A;  2RNK A;  2DX6 A;  3SIJ A;  3KQX A;  5HIH A;  4KYB A;  4ESS A;  2J9A A;  5CB5 A;  3SII A;  4JVV A;  3T8W A;  3V45 A;  3GPG A;  5CBM A;  3KZW A;  1HJZ A;  5CB3 A;  3JRU A;  4JGK A;  4JLL A;  5FSZ A;  4GVW A;  1SPV A;  5DUS A;  5E3B A;  3EWO A;  4TU0 A;  5HOL A;  4ZX8 A;  2KQV A;  3GQO A;  2JZE A;  3JZT A;  4ZY0 A;  5D8N A; 
#chains in the Genus database with same CATH homology
 3H8F A;  4K3N A;  4J5Q A;  5FSU A;  1LAM A;  4ETK A;  1BLL E;  1LAP A;  4IQY A;  3EKE A;  3KQZ A;  5FSX A;  4UML A;  4ZY2 A;  2BFR A;  4R7M A;  1BPM A;  2XD7 A;  5AIL A;  2ACF A;  4ETJ A;  1NJR A;  2VRI A;  3IJ3 A;  2EWB A;  3V2B A;  1TXZ A;  5FSV A;  1LAN A;  3EWR A;  2AFC A;  1LCP A;  1BPN A;  4J5R A;  4ABL A;  1TY8 A;  4J4Z A;  4J5S A;  1ZR5 A;  3Q6Z A;  4R6T A;  3ETI A;  4ABK A;  2BFQ A;  2L8R A;  4ZX9 A;  4KSI A;  4X2T A;  3EJG A;  1YD9 A;  3GPQ A;  4D86 A;  3Q71 A;  4K0C A;  1VHU A;  3KR4 A;  2LGR A;  2FAV A;  2X47 A;  5FSY A;  3EWQ A;  4JCA A;  4R76 A;  5CMS A;  4ZY1 A;  3GPO A;  1ZR3 A;  3EJF A;  1GYT A;  3H8E A;  3H8G A;  4GUA A;  2FG1 A;  2FXK A;  4ZYQ A;  3IID A;  2EEE A;  3EW5 A;  3PEI A;  3SIH A;  3GQE A;  4ZI6 A;  3KR5 A;  3EWP A;  3VFQ A;  4GVV A;  3IIF A;  3SIG A;  2DX6 A;  3SIJ A;  3KQX A;  5HIH A;  4KYB A;  4ESS A;  2J9A A;  5CB5 A;  3SII A;  4JVV A;  3T8W A;  3V45 A;  3GPG A;  5CBM A;  3KZW A;  1HJZ A;  5CB3 A;  3JRU A;  4JGK A;  4JLL A;  5FSZ A;  4GVW A;  1SPV A;  5DUS A;  5E3B A;  3EWO A;  4TU0 A;  5HOL A;  4ZX8 A;  3GQO A;  3JZT A;  4ZY0 A;  5D8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...