2ACFA

Nmr structure of sars-cov non-structural protein nsp3a (sars1) from sars coronavirus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
172
Chain Sequence
HHHMPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of severe acute respiratory syndrome coronavirus ADP-ribose-1''-phosphate dephosphorylation by a conserved domain of nsP3.
pubmed doi rcsb
source organism Sars coronavirus tor2
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 62
structure length 172
sequence length 172
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2acfA00
4X2TA 3SIJA 4KSIA 2FAVA 3EJFA 5CB5A 2BFQA 5D8NA 4KYBA 3V2BA 4ZI6A 4K3NA 3EKEA 2J9AA 4J5QA 3GQEA 3KR5A 4ZY2A 1ZR5A 4R7MA 4K0CA 3EWPA 5CB3A 2AFCA 3PEIA 2L8RA 3H8EA 2LGRA 2XD7A 5FSXA 1TY8A 3JZTA 4JLLA 1LCPA 4J5SA 4J5RA 5FSZA 3KQZA 4ABKA 4ESSA 1BLLE 4GVVA 5FSVA 3SIIA 3T8WA 3EJGA 4R76A 1GYTA 1LAMA 5AILA 2VRIA 1LAPA 3JRUA 2EEEA 1ZR3A 5DUSA 1BPMA 3EWOA 4ZYQA 1BPNA 3GPQA 3Q71A 3IIDA 1HJZA 1YD9A 1TXZA 2FG1A 3V45A 4JCAA 4J4ZA 4JGKA 3KR4A 3Q6ZA 5CMSA 3VFQA 3GQOA 3H8GA 4IQYA 5HOLA 1NJRA 5CBMA 4GVWA 4D86A 3EWRA 4ETJA 5FSYA 4JVVA 4ETKA 4ZY1A 3SIHA 2ACFA 2EWBA 4ZX9A 3EWQA 3KZWA 2X47A 1LANA 3GPOA 3GPGA 4ABLA 4TU0A 5E3BA 4ZY0A 3ETIA 4UMLA 2FXKA 3EW5A 1VHUA 3IJ3A 2BFRA 5FSUA 4GUAA 3H8FA 3KQXA 3IIFA 1SPVA 5HIHA 4ZX8A 3SIGA 2DX6A 4R6TA
chains in the Genus database with same CATH superfamily
4X2TA 3SIJA 2WCTA 4KSIA 2FAVA 2JZEA 3EJFA 5CB5A 2BFQA 5D8NA 4KYBA 3V2BA 4ZI6A 4K3NA 3EKEA 2KQVA 2J9AA 4J5QA 3GQEA 3KR5A 4ZY2A 1ZR5A 4R7MA 4K0CA 3EWPA 5CB3A 2AFCA 3PEIA 2L8RA 3H8EA 2LGRA 2XD7A 2W2GA 5FSXA 1TY8A 3JZTA 4JLLA 1LCPA 4J5SA 4J5RA 5FSZA 3KQZA 4ABKA 4ESSA 1BLLE 4GVVA 5FSVA 3SIIA 3T8WA 3EJGA 4R76A 1GYTA 2RNKA 1LAMA 5AILA 2VRIA 1LAPA 3JRUA 2EEEA 1ZR3A 5DUSA 1BPMA 3EWOA 4ZYQA 1BPNA 2JZDA 3GPQA 3Q71A 3IIDA 1HJZA 1YD9A 1TXZA 2FG1A 3V45A 4JCAA 4J4ZA 4JGKA 3KR4A 3Q6ZA 5CMSA 3VFQA 2JZFA 3GQOA 3H8GA 4IQYA 5HOLA 1NJRA 5CBMA 4GVWA 4D86A 3EWRA 4ETJA 5FSYA 4JVVA 4ETKA 4ZY1A 3SIHA 2ACFA 2EWBA 4ZX9A 3EWQA 3KZWA 2X47A 1LANA 3GPOA 3GPGA 4ABLA 4TU0A 5E3BA 4ZY0A 3ETIA 4UMLA 2FXKA 3EW5A 1VHUA 3IJ3A 2BFRA 5FSUA 4GUAA 3H8FA 3KQXA 3IIFA 1SPVA 5HIHA 4ZX8A 3SIGA 2DX6A 4R6TA
chains in the Genus database with same CATH topology
4X2TA 3SIJA 4KSIA 2FAVA 3EJFA 5CB5A 2BFQA 5D8NA 4KYBA 3V2BA 4ZI6A 4K3NA 3EKEA 2J9AA 4J5QA 3GQEA 3KR5A 4ZY2A 1ZR5A 4R7MA 4K0CA 3EWPA 5CB3A 2AFCA 3PEIA 2L8RA 3H8EA 2LGRA 2XD7A 5FSXA 1TY8A 3JZTA 4JLLA 1LCPA 4J5SA 4J5RA 5FSZA 3KQZA 4ABKA 4ESSA 1BLLE 4GVVA 5FSVA 3SIIA 3T8WA 3EJGA 4R76A 1GYTA 1LAMA 5AILA 2VRIA 1LAPA 3JRUA 2EEEA 1ZR3A 5DUSA 1BPMA 3EWOA 4ZYQA 1BPNA 3GPQA 3Q71A 3IIDA 1HJZA 1YD9A 1TXZA 2FG1A 3V45A 4JCAA 4J4ZA 4JGKA 3KR4A 3Q6ZA 5CMSA 3VFQA 3GQOA 3H8GA 4IQYA 5HOLA 1NJRA 5CBMA 4GVWA 4D86A 3EWRA 4ETJA 5FSYA 4JVVA 4ETKA 4ZY1A 3SIHA 2ACFA 2EWBA 4ZX9A 3EWQA 3KZWA 2X47A 1LANA 3GPOA 3GPGA 4ABLA 4TU0A 5E3BA 4ZY0A 3ETIA 4UMLA 2FXKA 3EW5A 1VHUA 3IJ3A 2BFRA 5FSUA 4GUAA 3H8FA 3KQXA 3IIFA 1SPVA 5HIHA 4ZX8A 3SIGA 2DX6A 4R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X2T A;  3SIJ A;  4KSI A;  2FAV A;  3EJF A;  5CB5 A;  2BFQ A;  5D8N A;  4KYB A;  3V2B A;  4ZI6 A;  4K3N A;  3EKE A;  2J9A A;  4J5Q A;  3GQE A;  3KR5 A;  4ZY2 A;  1ZR5 A;  4R7M A;  4K0C A;  3EWP A;  5CB3 A;  2AFC A;  3PEI A;  2L8R A;  3H8E A;  2LGR A;  2XD7 A;  5FSX A;  1TY8 A;  3JZT A;  4JLL A;  1LCP A;  4J5S A;  4J5R A;  5FSZ A;  3KQZ A;  4ABK A;  4ESS A;  1BLL E;  4GVV A;  5FSV A;  3SII A;  3T8W A;  3EJG A;  4R76 A;  1GYT A;  1LAM A;  5AIL A;  2VRI A;  1LAP A;  3JRU A;  2EEE A;  1ZR3 A;  5DUS A;  1BPM A;  3EWO A;  4ZYQ A;  1BPN A;  3GPQ A;  3Q71 A;  3IID A;  1HJZ A;  1YD9 A;  1TXZ A;  2FG1 A;  3V45 A;  4JCA A;  4J4Z A;  4JGK A;  3KR4 A;  3Q6Z A;  5CMS A;  3VFQ A;  3GQO A;  3H8G A;  4IQY A;  5HOL A;  1NJR A;  5CBM A;  4GVW A;  4D86 A;  3EWR A;  4ETJ A;  5FSY A;  4JVV A;  4ETK A;  4ZY1 A;  3SIH A;  2ACF A;  2EWB A;  4ZX9 A;  3EWQ A;  3KZW A;  2X47 A;  1LAN A;  3GPO A;  3GPG A;  4ABL A;  4TU0 A;  5E3B A;  4ZY0 A;  3ETI A;  4UML A;  2FXK A;  3EW5 A;  1VHU A;  3IJ3 A;  2BFR A;  5FSU A;  4GUA A;  3H8F A;  3KQX A;  3IIF A;  1SPV A;  5HIH A;  4ZX8 A;  3SIG A;  2DX6 A;  4R6T A; 
#chains in the Genus database with same CATH topology
 4X2T A;  3SIJ A;  2WCT A;  4KSI A;  2FAV A;  2JZE A;  3EJF A;  5CB5 A;  2BFQ A;  5D8N A;  4KYB A;  3V2B A;  4ZI6 A;  4K3N A;  3EKE A;  2KQV A;  2J9A A;  4J5Q A;  3GQE A;  3KR5 A;  4ZY2 A;  1ZR5 A;  4R7M A;  4K0C A;  3EWP A;  5CB3 A;  2AFC A;  3PEI A;  2L8R A;  3H8E A;  2LGR A;  2XD7 A;  2W2G A;  5FSX A;  1TY8 A;  3JZT A;  4JLL A;  1LCP A;  4J5S A;  4J5R A;  5FSZ A;  3KQZ A;  4ABK A;  4ESS A;  1BLL E;  4GVV A;  5FSV A;  3SII A;  3T8W A;  3EJG A;  4R76 A;  1GYT A;  2RNK A;  1LAM A;  5AIL A;  2VRI A;  1LAP A;  3JRU A;  2EEE A;  1ZR3 A;  5DUS A;  1BPM A;  3EWO A;  4ZYQ A;  1BPN A;  2JZD A;  3GPQ A;  3Q71 A;  3IID A;  1HJZ A;  1YD9 A;  1TXZ A;  2FG1 A;  3V45 A;  4JCA A;  4J4Z A;  4JGK A;  3KR4 A;  3Q6Z A;  5CMS A;  3VFQ A;  2JZF A;  3GQO A;  3H8G A;  4IQY A;  5HOL A;  1NJR A;  5CBM A;  4GVW A;  4D86 A;  3EWR A;  4ETJ A;  5FSY A;  4JVV A;  4ETK A;  4ZY1 A;  3SIH A;  2ACF A;  2EWB A;  4ZX9 A;  3EWQ A;  3KZW A;  2X47 A;  1LAN A;  3GPO A;  3GPG A;  4ABL A;  4TU0 A;  5E3B A;  4ZY0 A;  3ETI A;  4UML A;  2FXK A;  3EW5 A;  1VHU A;  3IJ3 A;  2BFR A;  5FSU A;  4GUA A;  3H8F A;  3KQX A;  3IIF A;  1SPV A;  5HIH A;  4ZX8 A;  3SIG A;  2DX6 A;  4R6T A; 
#chains in the Genus database with same CATH homology
 4X2T A;  3SIJ A;  4KSI A;  2FAV A;  3EJF A;  5CB5 A;  2BFQ A;  5D8N A;  4KYB A;  3V2B A;  4ZI6 A;  4K3N A;  3EKE A;  2J9A A;  4J5Q A;  3GQE A;  3KR5 A;  4ZY2 A;  1ZR5 A;  4R7M A;  4K0C A;  3EWP A;  5CB3 A;  2AFC A;  3PEI A;  2L8R A;  3H8E A;  2LGR A;  2XD7 A;  5FSX A;  1TY8 A;  3JZT A;  4JLL A;  1LCP A;  4J5S A;  4J5R A;  5FSZ A;  3KQZ A;  4ABK A;  4ESS A;  1BLL E;  4GVV A;  5FSV A;  3SII A;  3T8W A;  3EJG A;  4R76 A;  1GYT A;  1LAM A;  5AIL A;  2VRI A;  1LAP A;  3JRU A;  2EEE A;  1ZR3 A;  5DUS A;  1BPM A;  3EWO A;  4ZYQ A;  1BPN A;  3GPQ A;  3Q71 A;  3IID A;  1HJZ A;  1YD9 A;  1TXZ A;  2FG1 A;  3V45 A;  4JCA A;  4J4Z A;  4JGK A;  3KR4 A;  3Q6Z A;  5CMS A;  3VFQ A;  3GQO A;  3H8G A;  4IQY A;  5HOL A;  1NJR A;  5CBM A;  4GVW A;  4D86 A;  3EWR A;  4ETJ A;  5FSY A;  4JVV A;  4ETK A;  4ZY1 A;  3SIH A;  2ACF A;  2EWB A;  4ZX9 A;  3EWQ A;  3KZW A;  2X47 A;  1LAN A;  3GPO A;  3GPG A;  4ABL A;  4TU0 A;  5E3B A;  4ZY0 A;  3ETI A;  4UML A;  2FXK A;  3EW5 A;  1VHU A;  3IJ3 A;  2BFR A;  5FSU A;  4GUA A;  3H8F A;  3KQX A;  3IIF A;  1SPV A;  5HIH A;  4ZX8 A;  3SIG A;  2DX6 A;  4R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...