3EWPA

Complex of substrate adp-ribose with ibv nsp3 adrp domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
LGSVKPATCEKPKFLEYKTCVGDLAVVIAKALDEFKEFCIVNAANEHMSHGGGVAKAIADFCGPDFVEYCADYVKKHGPQQKLVTPSFVKGIQCVNNVVGPRHGDSNLREKLVAAYKSVLVGGVVNYVVPVLSSGIFGVDFKISIDAMREAFKGCAIRVLLFSLSQEHIDYFDATCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title Crystal structures of two coronavirus ADP-ribose-1''-monophosphatases and their complexes with ADP-Ribose: a systematic structural analysis of the viral ADRP domain.
pubmed doi rcsb
source organism Avian infectious bronchitis virus
molecule tags Hydrolase
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3ewpA00
3KR4A 4ETJA 3ETIA 3GPGA 5FSUA 4R7MA 2VRIA 1LANA 3EKEA 3H8GA 1LCPA 3SIGA 3SIJA 2X47A 3KQXA 3GQEA 2AFCA 2FXKA 1BPMA 2J9AA 5FSYA 4ZY2A 3KZWA 2DX6A 4D86A 4JGKA 2EEEA 4K0CA 4J5QA 4UMLA 1GYTA 3H8FA 3EW5A 4GVVA 1YD9A 1ZR3A 5D8NA 4ZI6A 1TXZA 3IIFA 3IJ3A 1NJRA 3T8WA 2ACFA 2LGRA 4ABLA 3GPQA 3KQZA 4TU0A 4J5SA 4K3NA 4ZY1A 1SPVA 1ZR5A 4ETKA 5CB3A 4ZX8A 4GUAA 2FAVA 4ESSA 2L8RA 3EWRA 4ZY0A 5CBMA 3PEIA 4R76A 3KR5A 3EWPA 5HOLA 4J4ZA 4R6TA 4KSIA 3JZTA 5AILA 1VHUA 5DUSA 2BFRA 3Q6ZA 5E3BA 3Q71A 3GPOA 4X2TA 5FSVA 3SIIA 4ABKA 1BLLE 3EJGA 2XD7A 1TY8A 4JVVA 1HJZA 4JCAA 4JLLA 3EJFA 5FSZA 3EWOA 2FG1A 1BPNA 1LAPA 5CB5A 3V2BA 3H8EA 4KYBA 5CMSA 2BFQA 3SIHA 4ZYQA 5FSXA 4J5RA 3JRUA 3GQOA 3V45A 4ZX9A 2EWBA 3VFQA 3EWQA 4IQYA 3IIDA 4GVWA 1LAMA 5HIHA
chains in the Genus database with same CATH superfamily
3KR4A 4ETJA 3ETIA 3GPGA 5FSUA 2RNKA 4R7MA 2VRIA 1LANA 3EKEA 3H8GA 1LCPA 3SIGA 3SIJA 2JZFA 2X47A 3KQXA 3GQEA 2AFCA 2FXKA 1BPMA 2J9AA 5FSYA 4ZY2A 3KZWA 2DX6A 4D86A 4JGKA 2EEEA 4K0CA 4J5QA 4UMLA 1GYTA 3H8FA 3EW5A 4GVVA 1YD9A 1ZR3A 5D8NA 4ZI6A 1TXZA 3IIFA 3IJ3A 1NJRA 3T8WA 2ACFA 2LGRA 4ABLA 3GPQA 3KQZA 4TU0A 4J5SA 4K3NA 4ZY1A 1SPVA 1ZR5A 4ETKA 5CB3A 4ZX8A 4GUAA 2FAVA 4ESSA 2L8RA 3EWRA 4ZY0A 5CBMA 3PEIA 4R76A 3KR5A 3EWPA 5HOLA 4J4ZA 4R6TA 4KSIA 3JZTA 5AILA 1VHUA 5DUSA 2BFRA 2WCTA 3Q6ZA 5E3BA 3Q71A 2KQVA 3GPOA 4X2TA 5FSVA 3SIIA 4ABKA 2JZDA 1BLLE 3EJGA 2XD7A 2W2GA 1TY8A 4JVVA 1HJZA 2JZEA 4JCAA 4JLLA 3EJFA 5FSZA 3EWOA 2FG1A 1BPNA 1LAPA 5CB5A 3V2BA 3H8EA 4KYBA 5CMSA 2BFQA 3SIHA 4ZYQA 5FSXA 4J5RA 3JRUA 3GQOA 3V45A 4ZX9A 2EWBA 3VFQA 3EWQA 4IQYA 3IIDA 4GVWA 1LAMA 5HIHA
chains in the Genus database with same CATH topology
3KR4A 4ETJA 3ETIA 3GPGA 5FSUA 4R7MA 2VRIA 1LANA 3EKEA 3H8GA 1LCPA 3SIGA 3SIJA 2X47A 3KQXA 3GQEA 2AFCA 2FXKA 1BPMA 2J9AA 5FSYA 4ZY2A 3KZWA 2DX6A 4D86A 4JGKA 2EEEA 4K0CA 4J5QA 4UMLA 1GYTA 3H8FA 3EW5A 4GVVA 1YD9A 1ZR3A 5D8NA 4ZI6A 1TXZA 3IIFA 3IJ3A 1NJRA 3T8WA 2ACFA 2LGRA 4ABLA 3GPQA 3KQZA 4TU0A 4J5SA 4K3NA 4ZY1A 1SPVA 1ZR5A 4ETKA 5CB3A 4ZX8A 4GUAA 2FAVA 4ESSA 2L8RA 3EWRA 4ZY0A 5CBMA 3PEIA 4R76A 3KR5A 3EWPA 5HOLA 4J4ZA 4R6TA 4KSIA 3JZTA 5AILA 1VHUA 5DUSA 2BFRA 3Q6ZA 5E3BA 3Q71A 3GPOA 4X2TA 5FSVA 3SIIA 4ABKA 1BLLE 3EJGA 2XD7A 1TY8A 4JVVA 1HJZA 4JCAA 4JLLA 3EJFA 5FSZA 3EWOA 2FG1A 1BPNA 1LAPA 5CB5A 3V2BA 3H8EA 4KYBA 5CMSA 2BFQA 3SIHA 4ZYQA 5FSXA 4J5RA 3JRUA 3GQOA 3V45A 4ZX9A 2EWBA 3VFQA 3EWQA 4IQYA 3IIDA 4GVWA 1LAMA 5HIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KR4 A;  4ETJ A;  3ETI A;  3GPG A;  5FSU A;  4R7M A;  2VRI A;  1LAN A;  3EKE A;  3H8G A;  1LCP A;  3SIG A;  3SIJ A;  2X47 A;  3KQX A;  3GQE A;  2AFC A;  2FXK A;  1BPM A;  2J9A A;  5FSY A;  4ZY2 A;  3KZW A;  2DX6 A;  4D86 A;  4JGK A;  2EEE A;  4K0C A;  4J5Q A;  4UML A;  1GYT A;  3H8F A;  3EW5 A;  4GVV A;  1YD9 A;  1ZR3 A;  5D8N A;  4ZI6 A;  1TXZ A;  3IIF A;  3IJ3 A;  1NJR A;  3T8W A;  2ACF A;  2LGR A;  4ABL A;  3GPQ A;  3KQZ A;  4TU0 A;  4J5S A;  4K3N A;  4ZY1 A;  1SPV A;  1ZR5 A;  4ETK A;  5CB3 A;  4ZX8 A;  4GUA A;  2FAV A;  4ESS A;  2L8R A;  3EWR A;  4ZY0 A;  5CBM A;  3PEI A;  4R76 A;  3KR5 A;  3EWP A;  5HOL A;  4J4Z A;  4R6T A;  4KSI A;  3JZT A;  5AIL A;  1VHU A;  5DUS A;  2BFR A;  3Q6Z A;  5E3B A;  3Q71 A;  3GPO A;  4X2T A;  5FSV A;  3SII A;  4ABK A;  1BLL E;  3EJG A;  2XD7 A;  1TY8 A;  4JVV A;  1HJZ A;  4JCA A;  4JLL A;  3EJF A;  5FSZ A;  3EWO A;  2FG1 A;  1BPN A;  1LAP A;  5CB5 A;  3V2B A;  3H8E A;  4KYB A;  5CMS A;  2BFQ A;  3SIH A;  4ZYQ A;  5FSX A;  4J5R A;  3JRU A;  3GQO A;  3V45 A;  4ZX9 A;  2EWB A;  3VFQ A;  3EWQ A;  4IQY A;  3IID A;  4GVW A;  1LAM A;  5HIH A; 
#chains in the Genus database with same CATH topology
 3KR4 A;  4ETJ A;  3ETI A;  3GPG A;  5FSU A;  2RNK A;  4R7M A;  2VRI A;  1LAN A;  3EKE A;  3H8G A;  1LCP A;  3SIG A;  3SIJ A;  2JZF A;  2X47 A;  3KQX A;  3GQE A;  2AFC A;  2FXK A;  1BPM A;  2J9A A;  5FSY A;  4ZY2 A;  3KZW A;  2DX6 A;  4D86 A;  4JGK A;  2EEE A;  4K0C A;  4J5Q A;  4UML A;  1GYT A;  3H8F A;  3EW5 A;  4GVV A;  1YD9 A;  1ZR3 A;  5D8N A;  4ZI6 A;  1TXZ A;  3IIF A;  3IJ3 A;  1NJR A;  3T8W A;  2ACF A;  2LGR A;  4ABL A;  3GPQ A;  3KQZ A;  4TU0 A;  4J5S A;  4K3N A;  4ZY1 A;  1SPV A;  1ZR5 A;  4ETK A;  5CB3 A;  4ZX8 A;  4GUA A;  2FAV A;  4ESS A;  2L8R A;  3EWR A;  4ZY0 A;  5CBM A;  3PEI A;  4R76 A;  3KR5 A;  3EWP A;  5HOL A;  4J4Z A;  4R6T A;  4KSI A;  3JZT A;  5AIL A;  1VHU A;  5DUS A;  2BFR A;  2WCT A;  3Q6Z A;  5E3B A;  3Q71 A;  2KQV A;  3GPO A;  4X2T A;  5FSV A;  3SII A;  4ABK A;  2JZD A;  1BLL E;  3EJG A;  2XD7 A;  2W2G A;  1TY8 A;  4JVV A;  1HJZ A;  2JZE A;  4JCA A;  4JLL A;  3EJF A;  5FSZ A;  3EWO A;  2FG1 A;  1BPN A;  1LAP A;  5CB5 A;  3V2B A;  3H8E A;  4KYB A;  5CMS A;  2BFQ A;  3SIH A;  4ZYQ A;  5FSX A;  4J5R A;  3JRU A;  3GQO A;  3V45 A;  4ZX9 A;  2EWB A;  3VFQ A;  3EWQ A;  4IQY A;  3IID A;  4GVW A;  1LAM A;  5HIH A; 
#chains in the Genus database with same CATH homology
 3KR4 A;  4ETJ A;  3ETI A;  3GPG A;  5FSU A;  4R7M A;  2VRI A;  1LAN A;  3EKE A;  3H8G A;  1LCP A;  3SIG A;  3SIJ A;  2X47 A;  3KQX A;  3GQE A;  2AFC A;  2FXK A;  1BPM A;  2J9A A;  5FSY A;  4ZY2 A;  3KZW A;  2DX6 A;  4D86 A;  4JGK A;  2EEE A;  4K0C A;  4J5Q A;  4UML A;  1GYT A;  3H8F A;  3EW5 A;  4GVV A;  1YD9 A;  1ZR3 A;  5D8N A;  4ZI6 A;  1TXZ A;  3IIF A;  3IJ3 A;  1NJR A;  3T8W A;  2ACF A;  2LGR A;  4ABL A;  3GPQ A;  3KQZ A;  4TU0 A;  4J5S A;  4K3N A;  4ZY1 A;  1SPV A;  1ZR5 A;  4ETK A;  5CB3 A;  4ZX8 A;  4GUA A;  2FAV A;  4ESS A;  2L8R A;  3EWR A;  4ZY0 A;  5CBM A;  3PEI A;  4R76 A;  3KR5 A;  3EWP A;  5HOL A;  4J4Z A;  4R6T A;  4KSI A;  3JZT A;  5AIL A;  1VHU A;  5DUS A;  2BFR A;  3Q6Z A;  5E3B A;  3Q71 A;  3GPO A;  4X2T A;  5FSV A;  3SII A;  4ABK A;  1BLL E;  3EJG A;  2XD7 A;  1TY8 A;  4JVV A;  1HJZ A;  4JCA A;  4JLL A;  3EJF A;  5FSZ A;  3EWO A;  2FG1 A;  1BPN A;  1LAP A;  5CB5 A;  3V2B A;  3H8E A;  4KYB A;  5CMS A;  2BFQ A;  3SIH A;  4ZYQ A;  5FSX A;  4J5R A;  3JRU A;  3GQO A;  3V45 A;  4ZX9 A;  2EWB A;  3VFQ A;  3EWQ A;  4IQY A;  3IID A;  4GVW A;  1LAM A;  5HIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...