3EWPA

Complex of substrate adp-ribose with ibv nsp3 adrp domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
LGSVKPATCEKPKFLEYKTCVGDLAVVIAKALDEFKEFCIVNAANEHMSHGGGVAKAIADFCGPDFVEYCADYVKKHGPQQKLVTPSFVKGIQCVNNVVGPRHGDSNLREKLVAAYKSVLVGGVVNYVVPVLSSGIFGVDFKISIDAMREAFKGCAIRVLLFSLSQEHIDYFDATCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Non-structural protein 3
publication title Crystal structures of two coronavirus ADP-ribose-1''-monophosphatases and their complexes with ADP-Ribose: a systematic structural analysis of the viral ADRP domain.
pubmed doi rcsb
source organism Avian infectious bronchitis virus
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3ewpA00
2J9AA 5HIHA 3KQZA 3EJFA 4GVVA 4ETKA 3ETIA 4K3NA 4J5QA 5FSUA 3SIJA 3H8EA 5CB5A 1GYTA 3JRUA 1YD9A 4K0CA 2FXKA 1BPMA 4ABLA 3SIHA 4X2TA 5FSVA 5D8NA 3EW5A 3GPGA 3EJGA 2AFCA 4IQYA 2BFRA 4D86A 3KR5A 4KSIA 2X47A 2EEEA 2FAVA 4JGKA 1HJZA 5CB3A 3GPQA 1BPNA 2LGRA 5E3BA 3IIDA 5CBMA 3GQOA 4KYBA 4ESSA 2VRIA 4R76A 3EWPA 3IIFA 5FSZA 3IJ3A 3SIGA 4ZY0A 4UMLA 1LAPA 1NJRA 1ZR5A 4R6TA 2BFQA 1LAMA 3Q6ZA 1VHUA 4J4ZA 4GUAA 3JZTA 3EWQA 4J5RA 1BLLE 2DX6A 2XD7A 3V45A 3Q71A 1SPVA 3SIIA 5HOLA 3T8WA 3EWOA 4ETJA 3GPOA 1ZR3A 1TXZA 4ZY1A 5FSYA 5DUSA 4JVVA 2EWBA 3KZWA 4TU0A 2L8RA 2FG1A 4J5SA 3V2BA 4ZI6A 3PEIA 1LCPA 4JLLA 3EWRA 5FSXA 3KQXA 3H8FA 4ZX9A 1TY8A 3EKEA 3GQEA 5AILA 4R7MA 2ACFA 4GVWA 3KR4A 4ZY2A 3H8GA 4ZX8A 4ZYQA 5CMSA 4ABKA 1LANA 4JCAA 3VFQA
chains in the Genus database with same CATH superfamily
2J9AA 5HIHA 3KQZA 3EJFA 4GVVA 4ETKA 3ETIA 4K3NA 4J5QA 5FSUA 3SIJA 3H8EA 5CB5A 1GYTA 3JRUA 1YD9A 4K0CA 2FXKA 1BPMA 4ABLA 3SIHA 4X2TA 5FSVA 5D8NA 2KQVA 3EW5A 3GPGA 3EJGA 2AFCA 4IQYA 2BFRA 4D86A 3KR5A 2JZFA 4KSIA 2X47A 2EEEA 2FAVA 4JGKA 1HJZA 5CB3A 3GPQA 1BPNA 2W2GA 2LGRA 5E3BA 3IIDA 5CBMA 3GQOA 4KYBA 4ESSA 2VRIA 4R76A 3EWPA 3IIFA 5FSZA 3IJ3A 2RNKA 3SIGA 4ZY0A 4UMLA 1LAPA 1NJRA 1ZR5A 4R6TA 2BFQA 1LAMA 2WCTA 3Q6ZA 1VHUA 4J4ZA 4GUAA 3JZTA 3EWQA 4J5RA 1BLLE 2DX6A 2XD7A 3V45A 3Q71A 1SPVA 3SIIA 5HOLA 3T8WA 3EWOA 4ETJA 3GPOA 1ZR3A 1TXZA 4ZY1A 5FSYA 5DUSA 4JVVA 2EWBA 3KZWA 4TU0A 2L8RA 2FG1A 4J5SA 3V2BA 4ZI6A 2JZEA 1LCPA 3PEIA 3EWRA 4JLLA 5FSXA 3KQXA 3H8FA 4ZX9A 1TY8A 3EKEA 3GQEA 5AILA 4R7MA 2ACFA 4GVWA 3KR4A 4ZY2A 3H8GA 4ZX8A 4ZYQA 5CMSA 4ABKA 1LANA 2JZDA 4JCAA 3VFQA
chains in the Genus database with same CATH topology
2J9AA 5HIHA 3KQZA 3EJFA 4GVVA 4ETKA 3ETIA 4K3NA 4J5QA 5FSUA 3SIJA 3H8EA 5CB5A 1GYTA 3JRUA 1YD9A 4K0CA 2FXKA 1BPMA 4ABLA 3SIHA 4X2TA 5FSVA 5D8NA 3EW5A 3GPGA 3EJGA 2AFCA 4IQYA 2BFRA 4D86A 3KR5A 4KSIA 2X47A 2EEEA 2FAVA 4JGKA 1HJZA 5CB3A 3GPQA 1BPNA 2LGRA 5E3BA 3IIDA 5CBMA 3GQOA 4KYBA 4ESSA 2VRIA 4R76A 3EWPA 3IIFA 5FSZA 3IJ3A 3SIGA 4ZY0A 4UMLA 1LAPA 1NJRA 1ZR5A 4R6TA 2BFQA 1LAMA 3Q6ZA 1VHUA 4J4ZA 4GUAA 3JZTA 3EWQA 4J5RA 1BLLE 2DX6A 2XD7A 3V45A 3Q71A 1SPVA 3SIIA 5HOLA 3T8WA 3EWOA 4ETJA 3GPOA 1ZR3A 1TXZA 4ZY1A 5FSYA 5DUSA 4JVVA 2EWBA 3KZWA 4TU0A 2L8RA 2FG1A 4J5SA 3V2BA 4ZI6A 3PEIA 1LCPA 4JLLA 3EWRA 5FSXA 3KQXA 3H8FA 4ZX9A 1TY8A 3EKEA 3GQEA 5AILA 4R7MA 2ACFA 4GVWA 3KR4A 4ZY2A 3H8GA 4ZX8A 4ZYQA 5CMSA 4ABKA 1LANA 4JCAA 3VFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9A A;  5HIH A;  3KQZ A;  3EJF A;  4GVV A;  4ETK A;  3ETI A;  4K3N A;  4J5Q A;  5FSU A;  3SIJ A;  3H8E A;  5CB5 A;  1GYT A;  3JRU A;  1YD9 A;  4K0C A;  2FXK A;  1BPM A;  4ABL A;  3SIH A;  4X2T A;  5FSV A;  5D8N A;  3EW5 A;  3GPG A;  3EJG A;  2AFC A;  4IQY A;  2BFR A;  4D86 A;  3KR5 A;  4KSI A;  2X47 A;  2EEE A;  2FAV A;  4JGK A;  1HJZ A;  5CB3 A;  3GPQ A;  1BPN A;  2LGR A;  5E3B A;  3IID A;  5CBM A;  3GQO A;  4KYB A;  4ESS A;  2VRI A;  4R76 A;  3EWP A;  3IIF A;  5FSZ A;  3IJ3 A;  3SIG A;  4ZY0 A;  4UML A;  1LAP A;  1NJR A;  1ZR5 A;  4R6T A;  2BFQ A;  1LAM A;  3Q6Z A;  1VHU A;  4J4Z A;  4GUA A;  3JZT A;  3EWQ A;  4J5R A;  1BLL E;  2DX6 A;  2XD7 A;  3V45 A;  3Q71 A;  1SPV A;  3SII A;  5HOL A;  3T8W A;  3EWO A;  4ETJ A;  3GPO A;  1ZR3 A;  1TXZ A;  4ZY1 A;  5FSY A;  5DUS A;  4JVV A;  2EWB A;  3KZW A;  4TU0 A;  2L8R A;  2FG1 A;  4J5S A;  3V2B A;  4ZI6 A;  3PEI A;  1LCP A;  4JLL A;  3EWR A;  5FSX A;  3KQX A;  3H8F A;  4ZX9 A;  1TY8 A;  3EKE A;  3GQE A;  5AIL A;  4R7M A;  2ACF A;  4GVW A;  3KR4 A;  4ZY2 A;  3H8G A;  4ZX8 A;  4ZYQ A;  5CMS A;  4ABK A;  1LAN A;  4JCA A;  3VFQ A; 
#chains in the Genus database with same CATH topology
 2J9A A;  5HIH A;  3KQZ A;  3EJF A;  4GVV A;  4ETK A;  3ETI A;  4K3N A;  4J5Q A;  5FSU A;  3SIJ A;  3H8E A;  5CB5 A;  1GYT A;  3JRU A;  1YD9 A;  4K0C A;  2FXK A;  1BPM A;  4ABL A;  3SIH A;  4X2T A;  5FSV A;  5D8N A;  2KQV A;  3EW5 A;  3GPG A;  3EJG A;  2AFC A;  4IQY A;  2BFR A;  4D86 A;  3KR5 A;  2JZF A;  4KSI A;  2X47 A;  2EEE A;  2FAV A;  4JGK A;  1HJZ A;  5CB3 A;  3GPQ A;  1BPN A;  2W2G A;  2LGR A;  5E3B A;  3IID A;  5CBM A;  3GQO A;  4KYB A;  4ESS A;  2VRI A;  4R76 A;  3EWP A;  3IIF A;  5FSZ A;  3IJ3 A;  2RNK A;  3SIG A;  4ZY0 A;  4UML A;  1LAP A;  1NJR A;  1ZR5 A;  4R6T A;  2BFQ A;  1LAM A;  2WCT A;  3Q6Z A;  1VHU A;  4J4Z A;  4GUA A;  3JZT A;  3EWQ A;  4J5R A;  1BLL E;  2DX6 A;  2XD7 A;  3V45 A;  3Q71 A;  1SPV A;  3SII A;  5HOL A;  3T8W A;  3EWO A;  4ETJ A;  3GPO A;  1ZR3 A;  1TXZ A;  4ZY1 A;  5FSY A;  5DUS A;  4JVV A;  2EWB A;  3KZW A;  4TU0 A;  2L8R A;  2FG1 A;  4J5S A;  3V2B A;  4ZI6 A;  2JZE A;  1LCP A;  3PEI A;  3EWR A;  4JLL A;  5FSX A;  3KQX A;  3H8F A;  4ZX9 A;  1TY8 A;  3EKE A;  3GQE A;  5AIL A;  4R7M A;  2ACF A;  4GVW A;  3KR4 A;  4ZY2 A;  3H8G A;  4ZX8 A;  4ZYQ A;  5CMS A;  4ABK A;  1LAN A;  2JZD A;  4JCA A;  3VFQ A; 
#chains in the Genus database with same CATH homology
 2J9A A;  5HIH A;  3KQZ A;  3EJF A;  4GVV A;  4ETK A;  3ETI A;  4K3N A;  4J5Q A;  5FSU A;  3SIJ A;  3H8E A;  5CB5 A;  1GYT A;  3JRU A;  1YD9 A;  4K0C A;  2FXK A;  1BPM A;  4ABL A;  3SIH A;  4X2T A;  5FSV A;  5D8N A;  3EW5 A;  3GPG A;  3EJG A;  2AFC A;  4IQY A;  2BFR A;  4D86 A;  3KR5 A;  4KSI A;  2X47 A;  2EEE A;  2FAV A;  4JGK A;  1HJZ A;  5CB3 A;  3GPQ A;  1BPN A;  2LGR A;  5E3B A;  3IID A;  5CBM A;  3GQO A;  4KYB A;  4ESS A;  2VRI A;  4R76 A;  3EWP A;  3IIF A;  5FSZ A;  3IJ3 A;  3SIG A;  4ZY0 A;  4UML A;  1LAP A;  1NJR A;  1ZR5 A;  4R6T A;  2BFQ A;  1LAM A;  3Q6Z A;  1VHU A;  4J4Z A;  4GUA A;  3JZT A;  3EWQ A;  4J5R A;  1BLL E;  2DX6 A;  2XD7 A;  3V45 A;  3Q71 A;  1SPV A;  3SII A;  5HOL A;  3T8W A;  3EWO A;  4ETJ A;  3GPO A;  1ZR3 A;  1TXZ A;  4ZY1 A;  5FSY A;  5DUS A;  4JVV A;  2EWB A;  3KZW A;  4TU0 A;  2L8R A;  2FG1 A;  4J5S A;  3V2B A;  4ZI6 A;  3PEI A;  1LCP A;  4JLL A;  3EWR A;  5FSX A;  3KQX A;  3H8F A;  4ZX9 A;  1TY8 A;  3EKE A;  3GQE A;  5AIL A;  4R7M A;  2ACF A;  4GVW A;  3KR4 A;  4ZY2 A;  3H8G A;  4ZX8 A;  4ZYQ A;  5CMS A;  4ABK A;  1LAN A;  4JCA A;  3VFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...