3EWPA

Complex of substrate adp-ribose with ibv nsp3 adrp domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
LGSVKPATCEKPKFLEYKTCVGDLAVVIAKALDEFKEFCIVNAANEHMSHGGGVAKAIADFCGPDFVEYCADYVKKHGPQQKLVTPSFVKGIQCVNNVVGPRHGDSNLREKLVAAYKSVLVGGVVNYVVPVLSSGIFGVDFKISIDAMREAFKGCAIRVLLFSLSQEHIDYFDATCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two coronavirus ADP-ribose-1''-monophosphatases and their complexes with ADP-Ribose: a systematic structural analysis of the viral ADRP domain.
pubmed doi rcsb
source organism Avian infectious bronchitis virus
molecule tags Hydrolase
molecule keywords Non-structural protein 3
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3ewpA00
5DUSA 3PEIA 4ABLA 4K0CA 3GPOA 1ZR5A 3KR4A 3EWPA 2BFRA 2XD7A 2J9AA 4R76A 4J5QA 3VFQA 3SIIA 1NJRA 5HIHA 3JRUA 1LCPA 5FSXA 3GQEA 4IQYA 5D8NA 5AILA 1BPMA 3SIGA 4ZYQA 2X47A 2BFQA 5E3BA 4D86A 5FSYA 3V2BA 5HOLA 5FSUA 4ETKA 3V45A 3ETIA 4ZY1A 4GUAA 3H8GA 2FG1A 4KSIA 4J5RA 4ESSA 2EWBA 4GVWA 4KYBA 2LGRA 3Q6ZA 4R6TA 3EWOA 2L8RA 4GVVA 4J5SA 4X2TA 3SIHA 1TXZA 4ZY0A 5CMSA 4ZX9A 3SIJA 1HJZA 3KZWA 4R7MA 2AFCA 3GPQA 1YD9A 2DX6A 3EWQA 1SPVA 3KQXA 3T8WA 3IIDA 4JVVA 3GQOA 3H8EA 3KR5A 4K3NA 5CB5A 3EKEA 3GPGA 3IIFA 4UMLA 1TY8A 1BPNA 4ABKA 2FAVA 3EW5A 4JCAA 2VRIA 3H8FA 1VHUA 4JGKA 4ZI6A 2FXKA 1BLLE 1LAPA 4TU0A 4ETJA 4J4ZA 5CBMA 1LAMA 3Q71A 3JZTA 3EWRA 1ZR3A 3EJGA 1GYTA 5FSVA 4ZY2A 4ZX8A 5FSZA 2ACFA 3EJFA 2EEEA 4JLLA 3KQZA 5CB3A 1LANA 3IJ3A
chains in the Genus database with same CATH superfamily
5DUSA 3PEIA 4ABLA 4K0CA 3GPOA 1ZR5A 3KR4A 3EWPA 2JZEA 2BFRA 2XD7A 2J9AA 4R76A 4J5QA 3VFQA 3SIIA 1NJRA 5HIHA 3JRUA 1LCPA 5FSXA 3GQEA 4IQYA 5D8NA 5AILA 1BPMA 3SIGA 4ZYQA 2X47A 2BFQA 5E3BA 4D86A 5FSYA 2JZFA 3V2BA 5HOLA 5FSUA 4ETKA 2KQVA 3V45A 3ETIA 4ZY1A 4GUAA 3H8GA 2FG1A 4KSIA 4J5RA 4ESSA 2EWBA 4GVWA 4KYBA 2LGRA 3Q6ZA 4R6TA 3EWOA 2L8RA 4GVVA 4J5SA 4X2TA 3SIHA 1TXZA 4ZY0A 5CMSA 4ZX9A 3SIJA 1HJZA 3KZWA 4R7MA 2AFCA 3GPQA 1YD9A 2DX6A 3EWQA 1SPVA 3KQXA 3T8WA 3IIDA 4JVVA 3GQOA 3H8EA 3KR5A 4K3NA 2WCTA 5CB5A 3EKEA 3GPGA 3IIFA 4UMLA 2RNKA 1TY8A 1BPNA 4ABKA 2FAVA 3EW5A 4JCAA 2VRIA 3H8FA 1VHUA 4JGKA 4ZI6A 2FXKA 1BLLE 1LAPA 4TU0A 4ETJA 4J4ZA 2JZDA 5CBMA 1LAMA 3Q71A 3JZTA 3EWRA 1ZR3A 3EJGA 1GYTA 5FSVA 2W2GA 4ZY2A 4ZX8A 5FSZA 2ACFA 3EJFA 2EEEA 4JLLA 3KQZA 5CB3A 1LANA 3IJ3A
chains in the Genus database with same CATH topology
5DUSA 3PEIA 4ABLA 4K0CA 3GPOA 1ZR5A 3KR4A 3EWPA 2BFRA 2XD7A 2J9AA 4R76A 4J5QA 3VFQA 3SIIA 1NJRA 5HIHA 3JRUA 1LCPA 5FSXA 3GQEA 4IQYA 5D8NA 5AILA 1BPMA 3SIGA 4ZYQA 2X47A 2BFQA 5E3BA 4D86A 5FSYA 3V2BA 5HOLA 5FSUA 4ETKA 3V45A 3ETIA 4ZY1A 4GUAA 3H8GA 2FG1A 4KSIA 4J5RA 4ESSA 2EWBA 4GVWA 4KYBA 2LGRA 3Q6ZA 4R6TA 3EWOA 2L8RA 4GVVA 4J5SA 4X2TA 3SIHA 1TXZA 4ZY0A 5CMSA 4ZX9A 3SIJA 1HJZA 3KZWA 4R7MA 2AFCA 3GPQA 1YD9A 2DX6A 3EWQA 1SPVA 3KQXA 3T8WA 3IIDA 4JVVA 3GQOA 3H8EA 3KR5A 4K3NA 5CB5A 3EKEA 3GPGA 3IIFA 4UMLA 1TY8A 1BPNA 4ABKA 2FAVA 3EW5A 4JCAA 2VRIA 3H8FA 1VHUA 4JGKA 4ZI6A 2FXKA 1BLLE 1LAPA 4TU0A 4ETJA 4J4ZA 5CBMA 1LAMA 3Q71A 3JZTA 3EWRA 1ZR3A 3EJGA 1GYTA 5FSVA 4ZY2A 4ZX8A 5FSZA 2ACFA 3EJFA 2EEEA 4JLLA 3KQZA 5CB3A 1LANA 3IJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUS A;  3PEI A;  4ABL A;  4K0C A;  3GPO A;  1ZR5 A;  3KR4 A;  3EWP A;  2BFR A;  2XD7 A;  2J9A A;  4R76 A;  4J5Q A;  3VFQ A;  3SII A;  1NJR A;  5HIH A;  3JRU A;  1LCP A;  5FSX A;  3GQE A;  4IQY A;  5D8N A;  5AIL A;  1BPM A;  3SIG A;  4ZYQ A;  2X47 A;  2BFQ A;  5E3B A;  4D86 A;  5FSY A;  3V2B A;  5HOL A;  5FSU A;  4ETK A;  3V45 A;  3ETI A;  4ZY1 A;  4GUA A;  3H8G A;  2FG1 A;  4KSI A;  4J5R A;  4ESS A;  2EWB A;  4GVW A;  4KYB A;  2LGR A;  3Q6Z A;  4R6T A;  3EWO A;  2L8R A;  4GVV A;  4J5S A;  4X2T A;  3SIH A;  1TXZ A;  4ZY0 A;  5CMS A;  4ZX9 A;  3SIJ A;  1HJZ A;  3KZW A;  4R7M A;  2AFC A;  3GPQ A;  1YD9 A;  2DX6 A;  3EWQ A;  1SPV A;  3KQX A;  3T8W A;  3IID A;  4JVV A;  3GQO A;  3H8E A;  3KR5 A;  4K3N A;  5CB5 A;  3EKE A;  3GPG A;  3IIF A;  4UML A;  1TY8 A;  1BPN A;  4ABK A;  2FAV A;  3EW5 A;  4JCA A;  2VRI A;  3H8F A;  1VHU A;  4JGK A;  4ZI6 A;  2FXK A;  1BLL E;  1LAP A;  4TU0 A;  4ETJ A;  4J4Z A;  5CBM A;  1LAM A;  3Q71 A;  3JZT A;  3EWR A;  1ZR3 A;  3EJG A;  1GYT A;  5FSV A;  4ZY2 A;  4ZX8 A;  5FSZ A;  2ACF A;  3EJF A;  2EEE A;  4JLL A;  3KQZ A;  5CB3 A;  1LAN A;  3IJ3 A; 
#chains in the Genus database with same CATH topology
 5DUS A;  3PEI A;  4ABL A;  4K0C A;  3GPO A;  1ZR5 A;  3KR4 A;  3EWP A;  2JZE A;  2BFR A;  2XD7 A;  2J9A A;  4R76 A;  4J5Q A;  3VFQ A;  3SII A;  1NJR A;  5HIH A;  3JRU A;  1LCP A;  5FSX A;  3GQE A;  4IQY A;  5D8N A;  5AIL A;  1BPM A;  3SIG A;  4ZYQ A;  2X47 A;  2BFQ A;  5E3B A;  4D86 A;  5FSY A;  2JZF A;  3V2B A;  5HOL A;  5FSU A;  4ETK A;  2KQV A;  3V45 A;  3ETI A;  4ZY1 A;  4GUA A;  3H8G A;  2FG1 A;  4KSI A;  4J5R A;  4ESS A;  2EWB A;  4GVW A;  4KYB A;  2LGR A;  3Q6Z A;  4R6T A;  3EWO A;  2L8R A;  4GVV A;  4J5S A;  4X2T A;  3SIH A;  1TXZ A;  4ZY0 A;  5CMS A;  4ZX9 A;  3SIJ A;  1HJZ A;  3KZW A;  4R7M A;  2AFC A;  3GPQ A;  1YD9 A;  2DX6 A;  3EWQ A;  1SPV A;  3KQX A;  3T8W A;  3IID A;  4JVV A;  3GQO A;  3H8E A;  3KR5 A;  4K3N A;  2WCT A;  5CB5 A;  3EKE A;  3GPG A;  3IIF A;  4UML A;  2RNK A;  1TY8 A;  1BPN A;  4ABK A;  2FAV A;  3EW5 A;  4JCA A;  2VRI A;  3H8F A;  1VHU A;  4JGK A;  4ZI6 A;  2FXK A;  1BLL E;  1LAP A;  4TU0 A;  4ETJ A;  4J4Z A;  2JZD A;  5CBM A;  1LAM A;  3Q71 A;  3JZT A;  3EWR A;  1ZR3 A;  3EJG A;  1GYT A;  5FSV A;  2W2G A;  4ZY2 A;  4ZX8 A;  5FSZ A;  2ACF A;  3EJF A;  2EEE A;  4JLL A;  3KQZ A;  5CB3 A;  1LAN A;  3IJ3 A; 
#chains in the Genus database with same CATH homology
 5DUS A;  3PEI A;  4ABL A;  4K0C A;  3GPO A;  1ZR5 A;  3KR4 A;  3EWP A;  2BFR A;  2XD7 A;  2J9A A;  4R76 A;  4J5Q A;  3VFQ A;  3SII A;  1NJR A;  5HIH A;  3JRU A;  1LCP A;  5FSX A;  3GQE A;  4IQY A;  5D8N A;  5AIL A;  1BPM A;  3SIG A;  4ZYQ A;  2X47 A;  2BFQ A;  5E3B A;  4D86 A;  5FSY A;  3V2B A;  5HOL A;  5FSU A;  4ETK A;  3V45 A;  3ETI A;  4ZY1 A;  4GUA A;  3H8G A;  2FG1 A;  4KSI A;  4J5R A;  4ESS A;  2EWB A;  4GVW A;  4KYB A;  2LGR A;  3Q6Z A;  4R6T A;  3EWO A;  2L8R A;  4GVV A;  4J5S A;  4X2T A;  3SIH A;  1TXZ A;  4ZY0 A;  5CMS A;  4ZX9 A;  3SIJ A;  1HJZ A;  3KZW A;  4R7M A;  2AFC A;  3GPQ A;  1YD9 A;  2DX6 A;  3EWQ A;  1SPV A;  3KQX A;  3T8W A;  3IID A;  4JVV A;  3GQO A;  3H8E A;  3KR5 A;  4K3N A;  5CB5 A;  3EKE A;  3GPG A;  3IIF A;  4UML A;  1TY8 A;  1BPN A;  4ABK A;  2FAV A;  3EW5 A;  4JCA A;  2VRI A;  3H8F A;  1VHU A;  4JGK A;  4ZI6 A;  2FXK A;  1BLL E;  1LAP A;  4TU0 A;  4ETJ A;  4J4Z A;  5CBM A;  1LAM A;  3Q71 A;  3JZT A;  3EWR A;  1ZR3 A;  3EJG A;  1GYT A;  5FSV A;  4ZY2 A;  4ZX8 A;  5FSZ A;  2ACF A;  3EJF A;  2EEE A;  4JLL A;  3KQZ A;  5CB3 A;  1LAN A;  3IJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...