4R7MA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
518
structure length
516
Chain Sequence
SEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
total genus 175
structure length 516
sequence length 518
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r7mA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r7mA02
4P4FA 2JBJA 3SJXA 4F9VA 4TWEA 2C1CA 2PJBA 4MHPA 2JBKA 1ELMP 1AMPA 4P4EA 3EJGA 4PPZA 3LMSA 4F9UA 3GPGA 2L8RA 4MCSA 2QJ8A 4OC2A 3FMCA 1YSJA 3K2KA 3NA6A 3CDXA 3VH9A 1PYTB 3GQEA 2HC9A 5JM6A 2IMOA 4EWTA 1ARLA 3WABA 3EJFA 1ZLIA 3D7HA 2CTBA 3GUXA 1SPVA 2POKA 3B3CA 1XBUA 3BI0A 1ZG7A 2AFZA 2Q4ZA 3EKEA 4ONWA 4ESSA 2PJ9A 4B6ZA 1FNOA 4OIDA 4DJLA 4P6YA 3SJEA 4NFRA 3CPAA 1BLLE 3GPOA 3MRUA 2PCUA 3RAMA 2PJ7A 1RTQA 3PBEA 5JH9A 2GLFA 1JQGA 3D68A 3JRUA 4FUUA 1VHEA 3MN8A 3FF3A 5ELYA 1GYTA 4DYOA 2PJ8A 2F8HA 3BHXA 4MXUA 4J4ZA 1HDUA 4OC1A 3KQZA 5HOLA 2RB7A 1TY8A 3D4UA 3VFQA 4EFDA 1Y0YA 3KASA 3K9TA 4P44A 4KYBA 1TF8A 5LYIA 3V7ZA 3NH5A 2XD7A 3V45A 3KHXA 3GB0A 2ZEHA 3ISXA 4PXCA 2FVGA 2QVPA 1HDQA 2XEJA 3D7FA 3SIHA 4W9YA 3H8FA 1NJRA 4UEZA 3EWQA 2EK8A 4R76A 4TNUA 1HJZA 4P4IA 2ZENA 2PJ2A 3N5FA 2ZOGA 2AFMA 2V8HA 3B2YA 3FH4A 3EW5A 4NJRA 1DTDA 4JZ0A 2PVVA 5THWA 1Y0RA 3SI2A 2EEEA 5CBMA 5DS0A 4KSIA 2V8DA 2X47A 5LRKA 5FSUA 3CT9A 4P4JA 1H8LA 1IGBA 5CB5A 3WC6A 1CG2A 1Y7EA 2EK9A 2QYVA 4FWUA 2AFWA 5HVGA 2RFHA 1ZR5A 4PXEA 3TX8A 4JCAA 2AFOA 1IY7A 2PJ6A 3Q71A 2BOAA 3D7DA 4H2KA 3PB9X 5HVHA 3KHZA 1Q7LA 4YU9A 3B3WA 4NJQA 4JGKA 2LGRA 1M4LA 3KL9A 1UWYA 4MHNA 4WWVA 4ABKA 5K8OA 2C6PA 4ZX9A 4UEFA 3PEIA 3B3VA 1CP7A 5LYLA 4X3RA 5J1QA 4Z65A 3KGQA 4TU0A 3NH8A 4OMEA 4R7MA 3SJFA 5LYDA 1XRYA 3CPXA 2V77A 2XEFA 1NSAA 3FX6A 4GM5A 3S9LA 3L2NA 4NGRA 1ZG8A 4GVVA 3B3TA 3WC5A 5HIHA 3D66A 1LCPA 1CP6A 3I1UA 3IC1A 7CPAA 1TXZA 4UMLA 3IEHA 2DX6A 2Q43A 4IAVA 2ZEOA 3RBUA 1FT7A 2PJAA 3IJ3A 2PIYA 3JZTA 2C6CA 3FEDA 4NGTA 4GVWA 4J5QA 2ZEMA 3PRTA 3Q6ZA 3B35A 5HVFA 2FG1A 3SIIA 4IK2A 4P4BA 2XEGA 2BCOA 3PB8X 4OC0A 4NGMA 5CB3A 4LQGA 4A38A 4FAIA 4ZYQA 2CIJA 4Q7AA 5AILA 3VARA 3PB6X 1YW4A 5FSXA 4NGQA 2FAVA 2PE3A 2PJ5A 1ELLP 3NH4A 4UF4A 1R43A 2J9AA 3ETIA 2PVWA 4K0CA 1VHOA 2GREA 1TF9A 3PB7X 4OC5A 4AXVA 1LFWA 4ZY1A 2PJ4A 4PXDA 4IHMA 5DUSA 4OP4A 3IIFA 4J5RA 1BAVA 4JVVA 2HB6A 2PIZA 3HLPA 4NGSA 4YWYA 5K8MA 4J5SA 1F2OA 5CMSA 4A37A 4P45A 4R8FA 1CBXA 3S9NA 4P10A 3KQXA 1YMEA 1TKHA 3QNVA 4IQYA 1YD9A 3GPQA 3S9MA 2PJCA 3V38A 6CPAA 3SIGA 1LAMA 2GLJA 4NGNA 1CPXA 3IWWA 2PJ1A 1XMBA 3PFOA 3FJUA 3EWOA 1Z5RA 2PJ0A 5LYFA 2O4HA 4OKOA 2DEAA 4D86A 1BPNA 4MHZA 5IB9A 3FECA 5FSVA 5D29A 3RZAA 4BD9A 1LANA 2NSMA 1TKFA 4PXBA 5LRGA 5FSYA 1F2PA 1YLOA 5LRJA 1CX8A 3IO1A 2PJ3A 4A94A 4UIBA 2AFSA 1XFOA 3IIBA 1DE4C 4MHYA 2ZOFA 3DLJA 4JLLA 3D67A 4MCRA 1QQ9A 2ZEPA 4ZI6A 3IFEA 3SI1A 3D7GA 5D8NA 4MRIA 2GU2A 2O53A 2CF4A 4A39A 4UEEA 1TKJA 2BFQA 4ZX8A 2CTCA 2NYQA 2PRQA 2VRIA 3EWRA 1LOKA 4MCQA 5K8PA 4ZY2A 2EWBA 2FXKA 1F57A 2AFXA 3SJGA 3WC7A 2WYRA 3H8EA 2ZEDA 3ISZA 4NGPA 4OIWA 3BI1A 3FEEA 1ZR3A 3IIDA 4R6TA 1VHUA 3GLJA 5E3BA 4F8ZA 2BFRA 1ARMA 3WT4A 5FSZA 3B3SA 3T8WA 5HXDA 5JGFA 1HEEA 3KR5A 3NFZA 4FBEA 4K3NA 3PBBA 1YW6A 1TXRA 2OOTA 4MCPA 1ZG9A 2ZEFA 4ETKA 1Z8LA 3HUVA 2ZEEA 1XJOA 3VATA 3SI0A 2WZNA 2IQ6A 4P4DA 5CPAA 8CPAA 3SIJA 4G1PA 2ANPA 4O23A 4WJBA 1BPMA 4ETJA 3KI9A 4JYWA 3KR4A 4ZY0A 1KWMA 1LAPA 3BXMA 1PCAA 5F09A 2XEIA 3TC8A 4RUHA 3DGVA 2BO9A 2JEWA 2ZELA 2ACFA 2Q51A 2G9DA 3FVLA 2VL1A 3B7IA 2C6GA 3H8GA 4OC4A 1CPSA 4CPAA 1Z2LA 4X8IA 1AYEA 2V8VA 1EE3P 2ABZA 2F7VA 3EWPA 3PFEA 2AFUA 4X2TA 1OBRA 1ZLHA 5K8NA 2IJZA 2OR4A 4PQAA 1VGYA 3LWUA 1VIXA 4MMOA 2I3CA 1QMUA 4DUKA 3KZWA 4ABLA 2AFCA 2V8GA 4UIAA 2ZEGA 4EMEA 3GQOA 3V2BA 4OC3A 1R3NA 3PB4X 4GUAA 5I4MA
chains in the Genus database with same CATH superfamily
3UY5A 2Z3LA 4P4FA 4F0YA 1XF8A 4F0XA 2JBJA 1QSOA 2P6GA 4OLLA 3SJXA 4CYNA 1R57A 4ORFA 4F9VA 4A32A 4TWEA 2PDOA 4ZBGA 1MK4A 2C1CA 2PJBA 4MHPA 2JBKA 4OAEA 4KLVA 4R57A 1P0HA 1XIXA 2AE6A 1X10A 4K30A 2CXAA 1ELMP 4A31A 3K9UA 3EY5A 1AMPA 4FD5A 3EJGA 2JDDA 4ONUA 4PPZA 4P4EA 4BINA 3LMSA 4F9UA 2CY2A 4MHDA 3GPGA 2L8RA 2B58A 4MY3A 1QSNA 2PSWA 4C2ZA 4MCSA 2YNEA 2QJ8A 4OC2A 3FMCA 1YSJA 3K2KA 3NA6A 3CDXA 2VZZA 4RI1A 3VH9A 1PYTB 3GQEA 3V8IA 2R7HA 3SXOA 4B14A 2HC9A 5AG7A 2JZFA 3EO4A 3TOAA 5JM6A 2I00A 5G1ZA 1I21A 2IMOA 2Q4VA 3E0KA 2DPSA 4EWTA 3EXNA 1ARLA 4KLWA 3WABA 1L0CA 2O28A 1A2ZA 3EJFA 1ZLIA 3D7HA 3GY9A 2CTBA 2DF5A 4KUBA 4MFLA 4KSFA 3T90A 3GUXA 4YGOA 3W91A 1SPVA 2POKA 3B3CA 4R3LA 1XBUA 3BJ8A 4B13A 1IOIA 3BI0A 1ZG7A 5H84A 4CGNA 2EVNA 2AFZA 1CM0A 3EKEA 2Q4ZA 4ONWA 4ESSA 2PJ9A 4MFZA 3S6HA 1FNOA 4B6ZA 4M6GA 4OIDA 4P6YA 2AJ6A 4PK3A 5F49A 3OWCA 3SJEA 4NFRA 4DJLA 3CPAA 4QBJA 4CAXA 1BLLE 3GPOA 2OH1A 3MRUA 4KUAA 4PXCA 4U9ZA 2P6FA 5J8FA 2PCUA 5BWAB 4PSXA 3RAMA 2PJ7A 1RTQA 3IWGA 3PBEA 4RS2A 5JH9A 5KTAA 2GLFA 1JQGA 1S7KA 3JRUA 3D68A 4XNHB 2R8VA 3F5BA 4FUUA 1VHEA 3MN8A 1KUYA 1OZPA 3FF3A 5ELYA 4CGPA 1GYTA 2DPTA 2PJ8A 4DYOA 2HQYA 3ZJ0A 2F8HA 2Q0YA 1YX0A 3BHXA 3JUWA 4B5PA 4MXUA 4NSQA 1QSTA 4J4ZA 1HDUA 3IWEA 4X5KA 4FD4A 5AGEA 4OC1A 3KQZA 2JZEA 5HOLA 2RB7A 3JVNA 1TY8A 3D4UA 3VFQA 1YR0A 2D4OA 1Y7RA 4UA3A 4EFDA 1Y0YA 3PGPA 4LX9A 2Z3MA 2FIWA 2YGWA 4C68A 2FT0A 3KASA 3K9TA 3DR8A 1IU8A 4P44A 4KYBA 5AG4A 1TF8A 5LYIA 3V7ZA 4B5OA 1P4NA 3SXNA 3NH5A 1YVKA 2XD7A 3V45A 2REEA 2FSRA 5GCNA 3KHXA 1X12A 2R98A 2Z3NA 2CNTA 2ZEHA 3GB0A 3ISXA 2FVGA 2OZGA 2QVPA 1HDQA 2XEJA 3D7FA 4HPSA 5KTDA 3SIHA 4W9YA 1VKCA 3H8FA 2VQYA 3C26A 3I3GA 2Q7BA 5CNPA 1NJRA 4UEZA 3EWQA 2EK8A 4R76A 3BJ7A 3H5ZA 4TNUA 5I4MA 1HJZA 1XMTA 2ZENA 4MFQA 4P4IA 2PJ2A 2YNDA 3N5FA 2ZOGA 4M3SA 1K4JA 1YLEA 1ZO0A 2AFMA 4XNHC 5F47A 3LODA 2V8HA 3B2YA 2PR8A 3IGRA 4UFXA 3FH4A 3EW5A 4NJRA 1DTDA 1Q2DA 4JZ0A 2PVVA 5THWA 1GHEA 3TO7A 1Y0RA 3SI2A 2OZUA 2EEEA 5CBMA 3CZXA 5DS0A 4KSIA 2V8DA 4OADA 3TO9A 2X47A 5LRKA 5FSUA 4CYOA 2ZW4A 3CT9A 4P4JA 2Q44A 2A4NA 1H8LA 1PUAA 2GFQA 4CRYB 1IGBA 3CXPA 2Z10A 4UCPA 3PZJA 5CB5A 3WC6A 2HUZA 2R1IA 3DNSA 1CG2A 1Y7EA 2EK9A 2QYVA 2B3VA 4FWUA 2AFWA 5HVGA 2RFHA 2WPWA 4GS4A 4M6HA 4KSAA 4LUAA 1ZR5A 4PXEA 3R9EA 3TX8A 4PV6A 4JCAA 2AFOA 1XE4A 2HV2A 1IY7A 2PJ6A 4EVYA 3Q71A 2BOAA 3D7DA 4H2KA 3PB9X 4F6AA 4XPDC 1AUGA 5HVHA 4PK2A 3KHZA 1Q7LA 4YU9A 3B3WA 4J3GA 4HNXB 3T9YA 4NJQA 4JGKA 3W6SA 2LGRA 2VI7A 1M4LA 3KL9A 1UWYA 4MHNA 4WWVA 2RC4A 4L8AA 4L89A 4ABKA 5K8OA 1IB1E 2C6PA 4ZX9A 4UEFA 4C7HA 3PEIA 3B3VA 4UCMA 2ZW7A 1CP7A 5LYLA 4X3RA 3CXSA 5J1QA 4Z65A 2FCKA 2B5GA 3KGQA 4TU0A 4RN7A 2PQ8A 4U5YA 1MJ9A 4UFWA 3NH8A 4MFPA 4OMEA 2VBQA 1I12A 4R87A 3VWEA 1S60A 4R7MA 1S5KA 4CAEA 4HNYB 4MI4A 3SJFA 4JJXA 5LYDA 1XRYA 3CPXA 2V77A 2XEFA 3P2FA 1NSAA 3FX6A 4GM5A 4IF5A 2ZW6A 4AVBA 3S9LA 3FB3A 5G21A 5JPHA 3QAYA 2B4DB 1MJAA 3L2NA 4KORA 4NGRA 3W6XA 2QMLA 1ZG8A 4GVVA 3B3TA 3WC5A 2GIVA 5HIHA 4MY0A 3D66A 1LCPA 4IUSA 5A27A 2J8NA 1CP6A 3I1UA 3IC1A 7CPAA 1YGHA 1Z9UA 1TXZA 4UMLA 3IEHA 5J8CA 3QB8A 4QUSA 3WR7A 4KZTA 2DX6A 2Q43A 3NE7A 2Q04A 4H6ZA 4I49A 1YREA 4IAVA 2ZEOA 3EC4A 4UCNA 2JZDA 3R9FA 3GKRA 1FT7A 2PJAA 2Q7SA 3RBUA 3IJ3A 1VHSA 5F48A 4YRHA 2PIYA 3TE4A 3JZTA 2C6CA 3FEDA 4NGTA 4GVWA 1SQHA 4J5QA 1Q2YA 2ZEMA 3GIUA 3PRTA 1J4JA 5AG6A 5EC4A 3Q6ZA 3B35A 5HVFA 2FG1A 3SIIA 2C27A 4IK2A 4P4BA 2XEGA 4NCZA 4Y49B 2BCOA 3PB8X 1U6MA 5I0CA 4OC0A 3N7ZA 4NGMA 3F0AA 3LD2A 2JLMA 5CB3A 4LQGA 4KOYA 4KOVA 4A38A 4FAIA 4ZYQA 2CIJA 4Q7AA 5AILA 3VARA 2FXFA 1ON0A 2G3TA 2WCTA 1YK3A 1TIQA 1YW4A 3PB6X 5FSXA 1QSMA 4CAFA 1NE9A 4A33A 4B11A 4KVME 4NGQA 2FAVA 3S6KA 2PE3A 2PJ5A 2X7BA 2WUUA 1ELLP 3NH4A 4UF4A 4UFVA 1NSLA 5A28A 1R43A 2J9AA 3ETIA 2PVWA 4JXRA 3B8GA 4K0CA 1VHOA 2GREA 1TF9A 3PB7X 4CYQA 4OC5A 1M1DA 1LFWA 4AXVA 4ZY1A 4AB7A 3FNCA 1B87A 2PJ4A 2Z0ZA 4UWJA 4PXDA 1NMTA 4IHMA 5DUSA 4R9MA 3RYOA 3FBUA 5IX3A 4OP4A 4CGLA 3TT2A 5IV0A 3IIFA 2ZW5A 5HMNA 4J5RA 1BAVA 4JVVA 2HB6A 2PIZA 3HLPA 4NGSA 4C7IA 5G22A 4YWYA 4CAVA 1B6BA 4Q36A 3JTKA 5K8MA 4J5SA 1FY7A 1IICA 1F2OA 3I9SA 5CMSA 4A37A 4P45A 4H6UA 4KOWA 4R8FA 1CBXA 3S9NA 4HNWB 2J8RA 3R9GA 3DR6A 2K5TA 3IU1A 4P10A 2W2GA 1UFHA 1BOBA 3KQXA 1YMEA 1TKHA 1V0CA 3QNVA 4IQYA 1N71A 4XPKA 1YQEA 1YD9A 3A9LA 3GPQA 4JXQA 3S9MA 5HH1A 2PJCA 3F8KA 2YNCC 3V38A 6CPAA 3SIGA 3GYAA 1LAMA 1MJBA 5C88A 2GLJA 2IL4A 4NGNA 1CPXA 2P0WA 5E96A 2D4PA 2FL4A 3IWWA 2B4BA 4GXHA 2FS5A 2BEIA 4R3KA 1S7LA 4PSWA 1S7NA 2PJ1A 4YFJA 1XMBA 3PFOA 3FJUA 2BL1A 2G0BA 5EMIA 4KOTA 3EWOA 1KUVA 1Z4EA 1Z5RA 2PJ0A 4A95A 5LYFA 2ATRA 4QVTA 2J8MA 4MFJA 2O4HA 4UBRA 2EBJA 4A2ZA 1PU9A 4OKOA 2DEAA 2ODFA 4D86A 1BPNA 2QIRA 1RO5A 2Z3OA 4MHZA 3ZZIA 5IB9A 3FXTA 3FECA 5FSVA 4QB9A 5D29A 1WK4A 4NF1A 3RZAA 4BD9A 1LANA 2NSMA 1TKFA 4KOUA 1M4DA 4PXBA 5LRGA 5FSYA 1F2PA 1YLOA 2FE7A 2WSAA 3QAHA 5LRJA 1BO4A 1M4IA 1CX8A 2F5IA 4MFKA 3DSBA 3IO1A 2PJ3A 4A94A 4UIBA 2AFSA 4CGOA 4KVXA 2PRBA 1XFOA 3D3SA 3IIBA 1DE4C 4MHYA 2ZOFA 3DLJA 4JLLA 3R95A 3D67A 3FRMA 1IOFA 4MCRA 1QQ9A 2ZEPA 4M6IA 4KS9A 4ZI6A 3IFEA 3SI1A 3D7GA 3TOBA 5D8NA 4BBHA 4MRIA 2GU2A 3NE8A 3H4QA 2O53A 2CF4A 1JWQA 4JWPA 5H86A 4A39A 4KVOE 4UEEA 1TKJA 3IU2A 2BFQA 4ZX8A 2CTCA 2NYQA 4B5PB 2PRQA 4AVCA 2VRIA 3EWRA 2GE3A 1LOKA 2WPXA 4MCQA 3S6GA 5K8PA 4ZY2A 2EWBA 2FXKA 2I79A 5KTCA 1F57A 2AFXA 4NEXA 2RNKA 3SJGA 1S7FA 2VZYA 2VEZA 3RNZA 3WC7A 4Q38A 4AG7A 4CS0B 2WYRA 5C82A 2BUEA 3H8EA 2ZEDA 4U9YA 3R1KA 3ISZA 1KUXA 3FIXA 4NGPA 2ZPAA 4OIWA 3BI1A 3FEEA 3TTHA 3D8PA 1ZR3A 3IIDA 1XOVA 4R6TA 3BLNA 1RXTA 1VHUA 1M44A 2P6EA 3GLJA 5E3BA 3MGDA 1CJWA 2Z3KA 4F8ZA 4FD7A 2BFRA 3PP9A 1ARMA 3WT4A 2DXQA 5FSZA 1Z8XA 3B3SA 3TFYA 3T8WA 5HXDA 2OZHA 1XEBA 3VWDA 5JGFA 1HEEA 3KR5A 1Z8WA 3NFZA 2GANA 2B4DA 4FBEA 4K3NA 1IIDA 3PBBA 1YW6A 1TXRA 4C2XA 1QSRA 4E0AA 5ISVA 4C2YA 2OOTA 4E8OA 4B10A 3P2HA 4MCPA 1ZG9A 2REFA 2ZEFA 4ETKA 1Z8LA 2VXKA 3HUVA 2ZEEA 1XJOA 3TO6A 3VATA 5G20A 3G8WA 3SI0A 1M4GA 2FIAA 1YVOA 3KKWA 2WZNA 3S6FA 1S3ZA 2IQ6A 4P4DA 5CPAA 4HKFA 1IYKA 1I1DA 8CPAA 2KCWA 4KOXA 4B12A 3SIJA 2Z3PA 2ANPA 2JDCA 4G1PA 4H89A 4O23A 2H5MA 1Y9KA 1Z4RA 4WJBA 2CNMA 1BPMA 4ETJA 2G3AA 2QECA 3KI9A 4JYWA 4MBUA 3KR4A 4M85A 2Z11A 5FVJA 2OB0A 4JD6A 4AG9A 4ZY0A 4AVAA 1KWMA 4JLYA 5DWMA 2Y0MA 1LAPA 1Z8TA 1PCAA 2JEVA 1WWZA 3BXMA 5F09A 4DNCA 2CNSA 2XEIA 3TC8A 4Y49C 3D2MA 3DGVA 2Q4YA 2BO9A 4RUHA 3DDDA 2JEWA 2ZELA 4XPDB 3R96A 2ACFA 2OU2A 2Q51A 3LACA 2G9DA 4A30A 3FVLA 5EBVA 4CRZB 2YNCA 2VL1A 3B7IA 2KQVA 3H8GA 2C6GA 1CPSA 4OC4A 4CAWA 5JQ4A 2ARHA 4QC6A 4CPAA 4NXYA 1Z2LA 4X8IA 1AYEA 2V8VA 1EE3P 2ABZA 2ZXVA 4KOSA 2F7VA 4MJ8A 3EWPA 2BSWA 3PFEA 4CYPA 2AFUA 4X2TA 2B3UA 1OBRA 1ZLHA 2EUIA 2PC1A 5DWNA 3EFAA 2IJZA 3TCVA 4E2AA 5K8NA 2OR4A 4PQAA 1VGYA 3SHPA 1Q2CA 2NMTA 3FYNA 3LWUA 4XPLA 3CXQA 3RO0A 5F46A 1VIXA 2EO8A 1KZFA 4MMOA 2I3CA 4ZGYB 1QMUA 1Y9WA 2PR1A 4DUKA 3KZWA 2B5GB 4II9A 4ABLA 4LQ6A 1IYLA 2AFCA 2V8GA 3D2PA 4UIAA 2ZEGA 4CGMA 4EMEA 3GQOA 1LRZA 3V2BA 3G3SA 4OC3A 1R3NA 3PB4X 4FD6A 5AG5A 4UWIA 5IB0A 4GUAA 4BMHA
chains in the Genus database with same CATH topology
4P4FA 2JBJA 3SJXA 4F9VA 4TWEA 2C1CA 2PJBA 4MHPA 2JBKA 1ELMP 1AMPA 4P4EA 3EJGA 4PPZA 3LMSA 4F9UA 3GPGA 2L8RA 4MCSA 2QJ8A 4OC2A 3FMCA 1YSJA 3K2KA 3NA6A 3CDXA 3VH9A 1PYTB 3GQEA 2HC9A 5JM6A 2IMOA 4EWTA 1ARLA 3WABA 3EJFA 1ZLIA 3D7HA 2CTBA 3GUXA 1SPVA 2POKA 3B3CA 1XBUA 3BI0A 1ZG7A 2AFZA 2Q4ZA 3EKEA 4ONWA 4ESSA 2PJ9A 4B6ZA 1FNOA 4OIDA 4DJLA 4P6YA 3SJEA 4NFRA 3CPAA 1BLLE 3GPOA 3MRUA 2PCUA 3RAMA 2PJ7A 1RTQA 3PBEA 5JH9A 2GLFA 1JQGA 3D68A 3JRUA 4FUUA 1VHEA 3MN8A 3FF3A 5ELYA 1GYTA 4DYOA 2PJ8A 2F8HA 3BHXA 4MXUA 4J4ZA 1HDUA 4OC1A 3KQZA 5HOLA 2RB7A 1TY8A 3D4UA 3VFQA 4EFDA 1Y0YA 3KASA 3K9TA 4P44A 4KYBA 1TF8A 5LYIA 3V7ZA 3NH5A 2XD7A 3V45A 3KHXA 3GB0A 2ZEHA 3ISXA 4PXCA 2FVGA 2QVPA 1HDQA 2XEJA 3D7FA 3SIHA 4W9YA 3H8FA 1NJRA 4UEZA 3EWQA 2EK8A 4R76A 4TNUA 1HJZA 4P4IA 2ZENA 2PJ2A 3N5FA 2ZOGA 2AFMA 2V8HA 3B2YA 3FH4A 3EW5A 4NJRA 1DTDA 4JZ0A 2PVVA 5THWA 1Y0RA 3SI2A 2EEEA 5CBMA 5DS0A 4KSIA 2V8DA 2X47A 5LRKA 5FSUA 3CT9A 4P4JA 1H8LA 1IGBA 5CB5A 3WC6A 1CG2A 1Y7EA 2EK9A 2QYVA 4FWUA 2AFWA 5HVGA 2RFHA 1ZR5A 4PXEA 3TX8A 4JCAA 2AFOA 1IY7A 2PJ6A 3Q71A 2BOAA 3D7DA 4H2KA 3PB9X 5HVHA 3KHZA 1Q7LA 4YU9A 3B3WA 4NJQA 4JGKA 2LGRA 1M4LA 3KL9A 1UWYA 4MHNA 4WWVA 4ABKA 5K8OA 2C6PA 4ZX9A 4UEFA 3PEIA 3B3VA 1CP7A 5LYLA 4X3RA 5J1QA 4Z65A 3KGQA 4TU0A 3NH8A 4OMEA 4R7MA 3SJFA 5LYDA 1XRYA 3CPXA 2V77A 2XEFA 1NSAA 3FX6A 4GM5A 3S9LA 3L2NA 4NGRA 1ZG8A 4GVVA 3B3TA 3WC5A 5HIHA 3D66A 1LCPA 1CP6A 3I1UA 3IC1A 7CPAA 1TXZA 4UMLA 3IEHA 2DX6A 2Q43A 4IAVA 2ZEOA 3RBUA 1FT7A 2PJAA 3IJ3A 2PIYA 3JZTA 2C6CA 3FEDA 4NGTA 4GVWA 4J5QA 2ZEMA 3PRTA 3Q6ZA 3B35A 5HVFA 2FG1A 3SIIA 4IK2A 4P4BA 2XEGA 2BCOA 3PB8X 4OC0A 4NGMA 5CB3A 4LQGA 4A38A 4FAIA 4ZYQA 2CIJA 4Q7AA 5AILA 3VARA 3PB6X 1YW4A 5FSXA 4NGQA 2FAVA 2PE3A 2PJ5A 1ELLP 3NH4A 4UF4A 1R43A 2J9AA 3ETIA 2PVWA 4K0CA 1VHOA 2GREA 1TF9A 3PB7X 4OC5A 4AXVA 1LFWA 4ZY1A 2PJ4A 4PXDA 4IHMA 5DUSA 4OP4A 3IIFA 4J5RA 1BAVA 4JVVA 2HB6A 2PIZA 3HLPA 4NGSA 4YWYA 5K8MA 4J5SA 1F2OA 5CMSA 4A37A 4P45A 4R8FA 1CBXA 3S9NA 4P10A 3KQXA 1YMEA 1TKHA 3QNVA 4IQYA 1YD9A 3GPQA 3S9MA 2PJCA 3V38A 6CPAA 3SIGA 1LAMA 2GLJA 4NGNA 1CPXA 3IWWA 2PJ1A 1XMBA 3PFOA 3FJUA 3EWOA 1Z5RA 2PJ0A 5LYFA 2O4HA 4OKOA 2DEAA 4D86A 1BPNA 4MHZA 5IB9A 3FECA 5FSVA 5D29A 3RZAA 4BD9A 1LANA 2NSMA 1TKFA 4PXBA 5LRGA 5FSYA 1F2PA 1YLOA 5LRJA 1CX8A 3IO1A 2PJ3A 4A94A 4UIBA 2AFSA 1XFOA 3IIBA 1DE4C 4MHYA 2ZOFA 3DLJA 4JLLA 3D67A 4MCRA 1QQ9A 2ZEPA 4ZI6A 3IFEA 3SI1A 3D7GA 5D8NA 4MRIA 2GU2A 2O53A 2CF4A 4A39A 4UEEA 1TKJA 2BFQA 4ZX8A 2CTCA 2NYQA 2PRQA 2VRIA 3EWRA 1LOKA 4MCQA 5K8PA 4ZY2A 2EWBA 2FXKA 1F57A 2AFXA 3SJGA 3WC7A 2WYRA 3H8EA 2ZEDA 3ISZA 4NGPA 4OIWA 3BI1A 3FEEA 1ZR3A 3IIDA 4R6TA 1VHUA 3GLJA 5E3BA 4F8ZA 2BFRA 1ARMA 3WT4A 5FSZA 3B3SA 3T8WA 5HXDA 5JGFA 1HEEA 3KR5A 3NFZA 4FBEA 4K3NA 3PBBA 1YW6A 1TXRA 2OOTA 4MCPA 1ZG9A 2ZEFA 4ETKA 1Z8LA 3HUVA 2ZEEA 1XJOA 3VATA 3SI0A 2WZNA 2IQ6A 4P4DA 5CPAA 8CPAA 3SIJA 4G1PA 2ANPA 4O23A 4WJBA 1BPMA 4ETJA 3KI9A 4JYWA 3KR4A 4ZY0A 1KWMA 1LAPA 3BXMA 1PCAA 5F09A 2XEIA 3TC8A 4RUHA 3DGVA 2BO9A 2JEWA 2ZELA 2ACFA 2Q51A 2G9DA 3FVLA 2VL1A 3B7IA 2C6GA 3H8GA 4OC4A 1CPSA 4CPAA 1Z2LA 4X8IA 1AYEA 2V8VA 1EE3P 2ABZA 2F7VA 3EWPA 3PFEA 2AFUA 4X2TA 1OBRA 1ZLHA 5K8NA 2IJZA 2OR4A 4PQAA 1VGYA 3LWUA 1VIXA 4MMOA 2I3CA 1QMUA 4DUKA 3KZWA 4ABLA 2AFCA 2V8GA 4UIAA 2ZEGA 4EMEA 3GQOA 3V2BA 4OC3A 1R3NA 3PB4X 4GUAA 5I4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4F A;  2JBJ A;  3SJX A;  4F9V A;  4TWE A;  2C1C A;  2PJB A;  4MHP A;  2JBK A;  1ELM P;  1AMP A;  4P4E A;  3EJG A;  4PPZ A;  3LMS A;  4F9U A;  3GPG A;  2L8R A;  4MCS A;  2QJ8 A;  4OC2 A;  3FMC A;  1YSJ A;  3K2K A;  3NA6 A;  3CDX A;  3VH9 A;  1PYT B;  3GQE A;  2HC9 A;  5JM6 A;  2IMO A;  4EWT A;  1ARL A;  3WAB A;  3EJF A;  1ZLI A;  3D7H A;  2CTB A;  3GUX A;  1SPV A;  2POK A;  3B3C A;  1XBU A;  3BI0 A;  1ZG7 A;  2AFZ A;  2Q4Z A;  3EKE A;  4ONW A;  4ESS A;  2PJ9 A;  4B6Z A;  1FNO A;  4OID A;  4DJL A;  4P6Y A;  3SJE A;  4NFR A;  3CPA A;  1BLL E;  3GPO A;  3MRU A;  2PCU A;  3RAM A;  2PJ7 A;  1RTQ A;  3PBE A;  5JH9 A;  2GLF A;  1JQG A;  3D68 A;  3JRU A;  4FUU A;  1VHE A;  3MN8 A;  3FF3 A;  5ELY A;  1GYT A;  4DYO A;  2PJ8 A;  2F8H A;  3BHX A;  4MXU A;  4J4Z A;  1HDU A;  4OC1 A;  3KQZ A;  5HOL A;  2RB7 A;  1TY8 A;  3D4U A;  3VFQ A;  4EFD A;  1Y0Y A;  3KAS A;  3K9T A;  4P44 A;  4KYB A;  1TF8 A;  5LYI A;  3V7Z A;  3NH5 A;  2XD7 A;  3V45 A;  3KHX A;  3GB0 A;  2ZEH A;  3ISX A;  4PXC A;  2FVG A;  2QVP A;  1HDQ A;  2XEJ A;  3D7F A;  3SIH A;  4W9Y A;  3H8F A;  1NJR A;  4UEZ A;  3EWQ A;  2EK8 A;  4R76 A;  4TNU A;  1HJZ A;  4P4I A;  2ZEN A;  2PJ2 A;  3N5F A;  2ZOG A;  2AFM A;  2V8H A;  3B2Y A;  3FH4 A;  3EW5 A;  4NJR A;  1DTD A;  4JZ0 A;  2PVV A;  5THW A;  1Y0R A;  3SI2 A;  2EEE A;  5CBM A;  5DS0 A;  4KSI A;  2V8D A;  2X47 A;  5LRK A;  5FSU A;  3CT9 A;  4P4J A;  1H8L A;  1IGB A;  5CB5 A;  3WC6 A;  1CG2 A;  1Y7E A;  2EK9 A;  2QYV A;  4FWU A;  2AFW A;  5HVG A;  2RFH A;  1ZR5 A;  4PXE A;  3TX8 A;  4JCA A;  2AFO A;  1IY7 A;  2PJ6 A;  3Q71 A;  2BOA A;  3D7D A;  4H2K A;  3PB9 X;  5HVH A;  3KHZ A;  1Q7L A;  4YU9 A;  3B3W A;  4NJQ A;  4JGK A;  2LGR A;  1M4L A;  3KL9 A;  1UWY A;  4MHN A;  4WWV A;  4ABK A;  5K8O A;  2C6P A;  4ZX9 A;  4UEF A;  3PEI A;  3B3V A;  1CP7 A;  5LYL A;  4X3R A;  5J1Q A;  4Z65 A;  3KGQ A;  4TU0 A;  3NH8 A;  4OME A;  4R7M A;  3SJF A;  5LYD A;  1XRY A;  3CPX A;  2V77 A;  2XEF A;  1NSA A;  3FX6 A;  4GM5 A;  3S9L A;  3L2N A;  4NGR A;  1ZG8 A;  4GVV A;  3B3T A;  3WC5 A;  5HIH A;  3D66 A;  1LCP A;  1CP6 A;  3I1U A;  3IC1 A;  7CPA A;  1TXZ A;  4UML A;  3IEH A;  2DX6 A;  2Q43 A;  4IAV A;  2ZEO A;  3RBU A;  1FT7 A;  2PJA A;  3IJ3 A;  2PIY A;  3JZT A;  2C6C A;  3FED A;  4NGT A;  4GVW A;  4J5Q A;  2ZEM A;  3PRT A;  3Q6Z A;  3B35 A;  5HVF A;  2FG1 A;  3SII A;  4IK2 A;  4P4B A;  2XEG A;  2BCO A;  3PB8 X;  4OC0 A;  4NGM A;  5CB3 A;  4LQG A;  4A38 A;  4FAI A;  4ZYQ A;  2CIJ A;  4Q7A A;  5AIL A;  3VAR A;  3PB6 X;  1YW4 A;  5FSX A;  4NGQ A;  2FAV A;  2PE3 A;  2PJ5 A;  1ELL P;  3NH4 A;  4UF4 A;  1R43 A;  2J9A A;  3ETI A;  2PVW A;  4K0C A;  1VHO A;  2GRE A;  1TF9 A;  3PB7 X;  4OC5 A;  4AXV A;  1LFW A;  4ZY1 A;  2PJ4 A;  4PXD A;  4IHM A;  5DUS A;  4OP4 A;  3IIF A;  4J5R A;  1BAV A;  4JVV A;  2HB6 A;  2PIZ A;  3HLP A;  4NGS A;  4YWY A;  5K8M A;  4J5S A;  1F2O A;  5CMS A;  4A37 A;  4P45 A;  4R8F A;  1CBX A;  3S9N A;  4P10 A;  3KQX A;  1YME A;  1TKH A;  3QNV A;  4IQY A;  1YD9 A;  3GPQ A;  3S9M A;  2PJC A;  3V38 A;  6CPA A;  3SIG A;  1LAM A;  2GLJ A;  4NGN A;  1CPX A;  3IWW A;  2PJ1 A;  1XMB A;  3PFO A;  3FJU A;  3EWO A;  1Z5R A;  2PJ0 A;  5LYF A;  2O4H A;  4OKO A;  2DEA A;  4D86 A;  1BPN A;  4MHZ A;  5IB9 A;  3FEC A;  5FSV A;  5D29 A;  3RZA A;  4BD9 A;  1LAN A;  2NSM A;  1TKF A;  4PXB A;  5LRG A;  5FSY A;  1F2P A;  1YLO A;  5LRJ A;  1CX8 A;  3IO1 A;  2PJ3 A;  4A94 A;  4UIB A;  2AFS A;  1XFO A;  3IIB A;  1DE4 C;  4MHY A;  2ZOF A;  3DLJ A;  4JLL A;  3D67 A;  4MCR A;  1QQ9 A;  2ZEP A;  4ZI6 A;  3IFE A;  3SI1 A;  3D7G A;  5D8N A;  4MRI A;  2GU2 A;  2O53 A;  2CF4 A;  4A39 A;  4UEE A;  1TKJ A;  2BFQ A;  4ZX8 A;  2CTC A;  2NYQ A;  2PRQ A;  2VRI A;  3EWR A;  1LOK A;  4MCQ A;  5K8P A;  4ZY2 A;  2EWB A;  2FXK A;  1F57 A;  2AFX A;  3SJG A;  3WC7 A;  2WYR A;  3H8E A;  2ZED A;  3ISZ A;  4NGP A;  4OIW A;  3BI1 A;  3FEE A;  1ZR3 A;  3IID A;  4R6T A;  1VHU A;  3GLJ A;  5E3B A;  4F8Z A;  2BFR A;  1ARM A;  3WT4 A;  5FSZ A;  3B3S A;  3T8W A;  5HXD A;  5JGF A;  1HEE A;  3KR5 A;  3NFZ A;  4FBE A;  4K3N A;  3PBB A;  1YW6 A;  1TXR A;  2OOT A;  4MCP A;  1ZG9 A;  2ZEF A;  4ETK A;  1Z8L A;  3HUV A;  2ZEE A;  1XJO A;  3VAT A;  3SI0 A;  2WZN A;  2IQ6 A;  4P4D A;  5CPA A;  8CPA A;  3SIJ A;  4G1P A;  2ANP A;  4O23 A;  4WJB A;  1BPM A;  4ETJ A;  3KI9 A;  4JYW A;  3KR4 A;  4ZY0 A;  1KWM A;  1LAP A;  3BXM A;  1PCA A;  5F09 A;  2XEI A;  3TC8 A;  4RUH A;  3DGV A;  2BO9 A;  2JEW A;  2ZEL A;  2ACF A;  2Q51 A;  2G9D A;  3FVL A;  2VL1 A;  3B7I A;  2C6G A;  3H8G A;  4OC4 A;  1CPS A;  4CPA A;  1Z2L A;  4X8I A;  1AYE A;  2V8V A;  1EE3 P;  2ABZ A;  2F7V A;  3EWP A;  3PFE A;  2AFU A;  4X2T A;  1OBR A;  1ZLH A;  5K8N A;  2IJZ A;  2OR4 A;  4PQA A;  1VGY A;  3LWU A;  1VIX A;  4MMO A;  2I3C A;  1QMU A;  4DUK A;  3KZW A;  4ABL A;  2AFC A;  2V8G A;  4UIA A;  2ZEG A;  4EME A;  3GQO A;  3V2B A;  4OC3 A;  1R3N A;  3PB4 X;  4GUA A;  5I4M A; 
#chains in the Genus database with same CATH topology
 3UY5 A;  2Z3L A;  4P4F A;  4F0Y A;  1XF8 A;  4F0X A;  2JBJ A;  1QSO A;  2P6G A;  4OLL A;  3SJX A;  4CYN A;  1R57 A;  4ORF A;  4F9V A;  4A32 A;  4TWE A;  2PDO A;  4ZBG A;  1MK4 A;  2C1C A;  2PJB A;  4MHP A;  2JBK A;  4OAE A;  4KLV A;  4R57 A;  1P0H A;  1XIX A;  2AE6 A;  1X10 A;  4K30 A;  2CXA A;  1ELM P;  4A31 A;  3K9U A;  3EY5 A;  1AMP A;  4FD5 A;  3EJG A;  2JDD A;  4ONU A;  4PPZ A;  4P4E A;  4BIN A;  3LMS A;  4F9U A;  2CY2 A;  4MHD A;  3GPG A;  2L8R A;  2B58 A;  4MY3 A;  1QSN A;  2PSW A;  4C2Z A;  4MCS A;  2YNE A;  2QJ8 A;  4OC2 A;  3FMC A;  1YSJ A;  3K2K A;  3NA6 A;  3CDX A;  2VZZ A;  4RI1 A;  3VH9 A;  1PYT B;  3GQE A;  3V8I A;  2R7H A;  3SXO A;  4B14 A;  2HC9 A;  5AG7 A;  2JZF A;  3EO4 A;  3TOA A;  5JM6 A;  2I00 A;  5G1Z A;  1I21 A;  2IMO A;  2Q4V A;  3E0K A;  2DPS A;  4EWT A;  3EXN A;  1ARL A;  4KLW A;  3WAB A;  1L0C A;  2O28 A;  1A2Z A;  3EJF A;  1ZLI A;  3D7H A;  3GY9 A;  2CTB A;  2DF5 A;  4KUB A;  4MFL A;  4KSF A;  3T90 A;  3GUX A;  4YGO A;  3W91 A;  1SPV A;  2POK A;  3B3C A;  4R3L A;  1XBU A;  3BJ8 A;  4B13 A;  1IOI A;  3BI0 A;  1ZG7 A;  5H84 A;  4CGN A;  2EVN A;  2AFZ A;  1CM0 A;  3EKE A;  2Q4Z A;  4ONW A;  4ESS A;  2PJ9 A;  4MFZ A;  3S6H A;  1FNO A;  4B6Z A;  4M6G A;  4OID A;  4P6Y A;  2AJ6 A;  4PK3 A;  5F49 A;  3OWC A;  3SJE A;  4NFR A;  4DJL A;  3CPA A;  4QBJ A;  4CAX A;  1BLL E;  3GPO A;  2OH1 A;  3MRU A;  4KUA A;  4PXC A;  4U9Z A;  2P6F A;  5J8F A;  2PCU A;  5BWA B;  4PSX A;  3RAM A;  2PJ7 A;  1RTQ A;  3IWG A;  3PBE A;  4RS2 A;  5JH9 A;  5KTA A;  2GLF A;  1JQG A;  1S7K A;  3JRU A;  3D68 A;  4XNH B;  2R8V A;  3F5B A;  4FUU A;  1VHE A;  3MN8 A;  1KUY A;  1OZP A;  3FF3 A;  5ELY A;  4CGP A;  1GYT A;  2DPT A;  2PJ8 A;  4DYO A;  2HQY A;  3ZJ0 A;  2F8H A;  2Q0Y A;  1YX0 A;  3BHX A;  3JUW A;  4B5P A;  4MXU A;  4NSQ A;  1QST A;  4J4Z A;  1HDU A;  3IWE A;  4X5K A;  4FD4 A;  5AGE A;  4OC1 A;  3KQZ A;  2JZE A;  5HOL A;  2RB7 A;  3JVN A;  1TY8 A;  3D4U A;  3VFQ A;  1YR0 A;  2D4O A;  1Y7R A;  4UA3 A;  4EFD A;  1Y0Y A;  3PGP A;  4LX9 A;  2Z3M A;  2FIW A;  2YGW A;  4C68 A;  2FT0 A;  3KAS A;  3K9T A;  3DR8 A;  1IU8 A;  4P44 A;  4KYB A;  5AG4 A;  1TF8 A;  5LYI A;  3V7Z A;  4B5O A;  1P4N A;  3SXN A;  3NH5 A;  1YVK A;  2XD7 A;  3V45 A;  2REE A;  2FSR A;  5GCN A;  3KHX A;  1X12 A;  2R98 A;  2Z3N A;  2CNT A;  2ZEH A;  3GB0 A;  3ISX A;  2FVG A;  2OZG A;  2QVP A;  1HDQ A;  2XEJ A;  3D7F A;  4HPS A;  5KTD A;  3SIH A;  4W9Y A;  1VKC A;  3H8F A;  2VQY A;  3C26 A;  3I3G A;  2Q7B A;  5CNP A;  1NJR A;  4UEZ A;  3EWQ A;  2EK8 A;  4R76 A;  3BJ7 A;  3H5Z A;  4TNU A;  5I4M A;  1HJZ A;  1XMT A;  2ZEN A;  4MFQ A;  4P4I A;  2PJ2 A;  2YND A;  3N5F A;  2ZOG A;  4M3S A;  1K4J A;  1YLE A;  1ZO0 A;  2AFM A;  4XNH C;  5F47 A;  3LOD A;  2V8H A;  3B2Y A;  2PR8 A;  3IGR A;  4UFX A;  3FH4 A;  3EW5 A;  4NJR A;  1DTD A;  1Q2D A;  4JZ0 A;  2PVV A;  5THW A;  1GHE A;  3TO7 A;  1Y0R A;  3SI2 A;  2OZU A;  2EEE A;  5CBM A;  3CZX A;  5DS0 A;  4KSI A;  2V8D A;  4OAD A;  3TO9 A;  2X47 A;  5LRK A;  5FSU A;  4CYO A;  2ZW4 A;  3CT9 A;  4P4J A;  2Q44 A;  2A4N A;  1H8L A;  1PUA A;  2GFQ A;  4CRY B;  1IGB A;  3CXP A;  2Z10 A;  4UCP A;  3PZJ A;  5CB5 A;  3WC6 A;  2HUZ A;  2R1I A;  3DNS A;  1CG2 A;  1Y7E A;  2EK9 A;  2QYV A;  2B3V A;  4FWU A;  2AFW A;  5HVG A;  2RFH A;  2WPW A;  4GS4 A;  4M6H A;  4KSA A;  4LUA A;  1ZR5 A;  4PXE A;  3R9E A;  3TX8 A;  4PV6 A;  4JCA A;  2AFO A;  1XE4 A;  2HV2 A;  1IY7 A;  2PJ6 A;  4EVY A;  3Q71 A;  2BOA A;  3D7D A;  4H2K A;  3PB9 X;  4F6A A;  4XPD C;  1AUG A;  5HVH A;  4PK2 A;  3KHZ A;  1Q7L A;  4YU9 A;  3B3W A;  4J3G A;  4HNX B;  3T9Y A;  4NJQ A;  4JGK A;  3W6S A;  2LGR A;  2VI7 A;  1M4L A;  3KL9 A;  1UWY A;  4MHN A;  4WWV A;  2RC4 A;  4L8A A;  4L89 A;  4ABK A;  5K8O A;  1IB1 E;  2C6P A;  4ZX9 A;  4UEF A;  4C7H A;  3PEI A;  3B3V A;  4UCM A;  2ZW7 A;  1CP7 A;  5LYL A;  4X3R A;  3CXS A;  5J1Q A;  4Z65 A;  2FCK A;  2B5G A;  3KGQ A;  4TU0 A;  4RN7 A;  2PQ8 A;  4U5Y A;  1MJ9 A;  4UFW A;  3NH8 A;  4MFP A;  4OME A;  2VBQ A;  1I12 A;  4R87 A;  3VWE A;  1S60 A;  4R7M A;  1S5K A;  4CAE A;  4HNY B;  4MI4 A;  3SJF A;  4JJX A;  5LYD A;  1XRY A;  3CPX A;  2V77 A;  2XEF A;  3P2F A;  1NSA A;  3FX6 A;  4GM5 A;  4IF5 A;  2ZW6 A;  4AVB A;  3S9L A;  3FB3 A;  5G21 A;  5JPH A;  3QAY A;  2B4D B;  1MJA A;  3L2N A;  4KOR A;  4NGR A;  3W6X A;  2QML A;  1ZG8 A;  4GVV A;  3B3T A;  3WC5 A;  2GIV A;  5HIH A;  4MY0 A;  3D66 A;  1LCP A;  4IUS A;  5A27 A;  2J8N A;  1CP6 A;  3I1U A;  3IC1 A;  7CPA A;  1YGH A;  1Z9U A;  1TXZ A;  4UML A;  3IEH A;  5J8C A;  3QB8 A;  4QUS A;  3WR7 A;  4KZT A;  2DX6 A;  2Q43 A;  3NE7 A;  2Q04 A;  4H6Z A;  4I49 A;  1YRE A;  4IAV A;  2ZEO A;  3EC4 A;  4UCN A;  2JZD A;  3R9F A;  3GKR A;  1FT7 A;  2PJA A;  2Q7S A;  3RBU A;  3IJ3 A;  1VHS A;  5F48 A;  4YRH A;  2PIY A;  3TE4 A;  3JZT A;  2C6C A;  3FED A;  4NGT A;  4GVW A;  1SQH A;  4J5Q A;  1Q2Y A;  2ZEM A;  3GIU A;  3PRT A;  1J4J A;  5AG6 A;  5EC4 A;  3Q6Z A;  3B35 A;  5HVF A;  2FG1 A;  3SII A;  2C27 A;  4IK2 A;  4P4B A;  2XEG A;  4NCZ A;  4Y49 B;  2BCO A;  3PB8 X;  1U6M A;  5I0C A;  4OC0 A;  3N7Z A;  4NGM A;  3F0A A;  3LD2 A;  2JLM A;  5CB3 A;  4LQG A;  4KOY A;  4KOV A;  4A38 A;  4FAI A;  4ZYQ A;  2CIJ A;  4Q7A A;  5AIL A;  3VAR A;  2FXF A;  1ON0 A;  2G3T A;  2WCT A;  1YK3 A;  1TIQ A;  1YW4 A;  3PB6 X;  5FSX A;  1QSM A;  4CAF A;  1NE9 A;  4A33 A;  4B11 A;  4KVM E;  4NGQ A;  2FAV A;  3S6K A;  2PE3 A;  2PJ5 A;  2X7B A;  2WUU A;  1ELL P;  3NH4 A;  4UF4 A;  4UFV A;  1NSL A;  5A28 A;  1R43 A;  2J9A A;  3ETI A;  2PVW A;  4JXR A;  3B8G A;  4K0C A;  1VHO A;  2GRE A;  1TF9 A;  3PB7 X;  4CYQ A;  4OC5 A;  1M1D A;  1LFW A;  4AXV A;  4ZY1 A;  4AB7 A;  3FNC A;  1B87 A;  2PJ4 A;  2Z0Z A;  4UWJ A;  4PXD A;  1NMT A;  4IHM A;  5DUS A;  4R9M A;  3RYO A;  3FBU A;  5IX3 A;  4OP4 A;  4CGL A;  3TT2 A;  5IV0 A;  3IIF A;  2ZW5 A;  5HMN A;  4J5R A;  1BAV A;  4JVV A;  2HB6 A;  2PIZ A;  3HLP A;  4NGS A;  4C7I A;  5G22 A;  4YWY A;  4CAV A;  1B6B A;  4Q36 A;  3JTK A;  5K8M A;  4J5S A;  1FY7 A;  1IIC A;  1F2O A;  3I9S A;  5CMS A;  4A37 A;  4P45 A;  4H6U A;  4KOW A;  4R8F A;  1CBX A;  3S9N A;  4HNW B;  2J8R A;  3R9G A;  3DR6 A;  2K5T A;  3IU1 A;  4P10 A;  2W2G A;  1UFH A;  1BOB A;  3KQX A;  1YME A;  1TKH A;  1V0C A;  3QNV A;  4IQY A;  1N71 A;  4XPK A;  1YQE A;  1YD9 A;  3A9L A;  3GPQ A;  4JXQ A;  3S9M A;  5HH1 A;  2PJC A;  3F8K A;  2YNC C;  3V38 A;  6CPA A;  3SIG A;  3GYA A;  1LAM A;  1MJB A;  5C88 A;  2GLJ A;  2IL4 A;  4NGN A;  1CPX A;  2P0W A;  5E96 A;  2D4P A;  2FL4 A;  3IWW A;  2B4B A;  4GXH A;  2FS5 A;  2BEI A;  4R3K A;  1S7L A;  4PSW A;  1S7N A;  2PJ1 A;  4YFJ A;  1XMB A;  3PFO A;  3FJU A;  2BL1 A;  2G0B A;  5EMI A;  4KOT A;  3EWO A;  1KUV A;  1Z4E A;  1Z5R A;  2PJ0 A;  4A95 A;  5LYF A;  2ATR A;  4QVT A;  2J8M A;  4MFJ A;  2O4H A;  4UBR A;  2EBJ A;  4A2Z A;  1PU9 A;  4OKO A;  2DEA A;  2ODF A;  4D86 A;  1BPN A;  2QIR A;  1RO5 A;  2Z3O A;  4MHZ A;  3ZZI A;  5IB9 A;  3FXT A;  3FEC A;  5FSV A;  4QB9 A;  5D29 A;  1WK4 A;  4NF1 A;  3RZA A;  4BD9 A;  1LAN A;  2NSM A;  1TKF A;  4KOU A;  1M4D A;  4PXB A;  5LRG A;  5FSY A;  1F2P A;  1YLO A;  2FE7 A;  2WSA A;  3QAH A;  5LRJ A;  1BO4 A;  1M4I A;  1CX8 A;  2F5I A;  4MFK A;  3DSB A;  3IO1 A;  2PJ3 A;  4A94 A;  4UIB A;  2AFS A;  4CGO A;  4KVX A;  2PRB A;  1XFO A;  3D3S A;  3IIB A;  1DE4 C;  4MHY A;  2ZOF A;  3DLJ A;  4JLL A;  3R95 A;  3D67 A;  3FRM A;  1IOF A;  4MCR A;  1QQ9 A;  2ZEP A;  4M6I A;  4KS9 A;  4ZI6 A;  3IFE A;  3SI1 A;  3D7G A;  3TOB A;  5D8N A;  4BBH A;  4MRI A;  2GU2 A;  3NE8 A;  3H4Q A;  2O53 A;  2CF4 A;  1JWQ A;  4JWP A;  5H86 A;  4A39 A;  4KVO E;  4UEE A;  1TKJ A;  3IU2 A;  2BFQ A;  4ZX8 A;  2CTC A;  2NYQ A;  4B5P B;  2PRQ A;  4AVC A;  2VRI A;  3EWR A;  2GE3 A;  1LOK A;  2WPX A;  4MCQ A;  3S6G A;  5K8P A;  4ZY2 A;  2EWB A;  2FXK A;  2I79 A;  5KTC A;  1F57 A;  2AFX A;  4NEX A;  2RNK A;  3SJG A;  1S7F A;  2VZY A;  2VEZ A;  3RNZ A;  3WC7 A;  4Q38 A;  4AG7 A;  4CS0 B;  2WYR A;  5C82 A;  2BUE A;  3H8E A;  2ZED A;  4U9Y A;  3R1K A;  3ISZ A;  1KUX A;  3FIX A;  4NGP A;  2ZPA A;  4OIW A;  3BI1 A;  3FEE A;  3TTH A;  3D8P A;  1ZR3 A;  3IID A;  1XOV A;  4R6T A;  3BLN A;  1RXT A;  1VHU A;  1M44 A;  2P6E A;  3GLJ A;  5E3B A;  3MGD A;  1CJW A;  2Z3K A;  4F8Z A;  4FD7 A;  2BFR A;  3PP9 A;  1ARM A;  3WT4 A;  2DXQ A;  5FSZ A;  1Z8X A;  3B3S A;  3TFY A;  3T8W A;  5HXD A;  2OZH A;  1XEB A;  3VWD A;  5JGF A;  1HEE A;  3KR5 A;  1Z8W A;  3NFZ A;  2GAN A;  2B4D A;  4FBE A;  4K3N A;  1IID A;  3PBB A;  1YW6 A;  1TXR A;  4C2X A;  1QSR A;  4E0A A;  5ISV A;  4C2Y A;  2OOT A;  4E8O A;  4B10 A;  3P2H A;  4MCP A;  1ZG9 A;  2REF A;  2ZEF A;  4ETK A;  1Z8L A;  2VXK A;  3HUV A;  2ZEE A;  1XJO A;  3TO6 A;  3VAT A;  5G20 A;  3G8W A;  3SI0 A;  1M4G A;  2FIA A;  1YVO A;  3KKW A;  2WZN A;  3S6F A;  1S3Z A;  2IQ6 A;  4P4D A;  5CPA A;  4HKF A;  1IYK A;  1I1D A;  8CPA A;  2KCW A;  4KOX A;  4B12 A;  3SIJ A;  2Z3P A;  2ANP A;  2JDC A;  4G1P A;  4H89 A;  4O23 A;  2H5M A;  1Y9K A;  1Z4R A;  4WJB A;  2CNM A;  1BPM A;  4ETJ A;  2G3A A;  2QEC A;  3KI9 A;  4JYW A;  4MBU A;  3KR4 A;  4M85 A;  2Z11 A;  5FVJ A;  2OB0 A;  4JD6 A;  4AG9 A;  4ZY0 A;  4AVA A;  1KWM A;  4JLY A;  5DWM A;  2Y0M A;  1LAP A;  1Z8T A;  1PCA A;  2JEV A;  1WWZ A;  3BXM A;  5F09 A;  4DNC A;  2CNS A;  2XEI A;  3TC8 A;  4Y49 C;  3D2M A;  3DGV A;  2Q4Y A;  2BO9 A;  4RUH A;  3DDD A;  2JEW A;  2ZEL A;  4XPD B;  3R96 A;  2ACF A;  2OU2 A;  2Q51 A;  3LAC A;  2G9D A;  4A30 A;  3FVL A;  5EBV A;  4CRZ B;  2YNC A;  2VL1 A;  3B7I A;  2KQV A;  3H8G A;  2C6G A;  1CPS A;  4OC4 A;  4CAW A;  5JQ4 A;  2ARH A;  4QC6 A;  4CPA A;  4NXY A;  1Z2L A;  4X8I A;  1AYE A;  2V8V A;  1EE3 P;  2ABZ A;  2ZXV A;  4KOS A;  2F7V A;  4MJ8 A;  3EWP A;  2BSW A;  3PFE A;  4CYP A;  2AFU A;  4X2T A;  2B3U A;  1OBR A;  1ZLH A;  2EUI A;  2PC1 A;  5DWN A;  3EFA A;  2IJZ A;  3TCV A;  4E2A A;  5K8N A;  2OR4 A;  4PQA A;  1VGY A;  3SHP A;  1Q2C A;  2NMT A;  3FYN A;  3LWU A;  4XPL A;  3CXQ A;  3RO0 A;  5F46 A;  1VIX A;  2EO8 A;  1KZF A;  4MMO A;  2I3C A;  4ZGY B;  1QMU A;  1Y9W A;  2PR1 A;  4DUK A;  3KZW A;  2B5G B;  4II9 A;  4ABL A;  4LQ6 A;  1IYL A;  2AFC A;  2V8G A;  3D2P A;  4UIA A;  2ZEG A;  4CGM A;  4EME A;  3GQO A;  1LRZ A;  3V2B A;  3G3S A;  4OC3 A;  1R3N A;  3PB4 X;  4FD6 A;  5AG5 A;  4UWI A;  5IB0 A;  4GUA A;  4BMH A; 
#chains in the Genus database with same CATH homology
 4P4F A;  2JBJ A;  3SJX A;  4F9V A;  4TWE A;  2C1C A;  2PJB A;  4MHP A;  2JBK A;  1ELM P;  1AMP A;  4P4E A;  3EJG A;  4PPZ A;  3LMS A;  4F9U A;  3GPG A;  2L8R A;  4MCS A;  2QJ8 A;  4OC2 A;  3FMC A;  1YSJ A;  3K2K A;  3NA6 A;  3CDX A;  3VH9 A;  1PYT B;  3GQE A;  2HC9 A;  5JM6 A;  2IMO A;  4EWT A;  1ARL A;  3WAB A;  3EJF A;  1ZLI A;  3D7H A;  2CTB A;  3GUX A;  1SPV A;  2POK A;  3B3C A;  1XBU A;  3BI0 A;  1ZG7 A;  2AFZ A;  2Q4Z A;  3EKE A;  4ONW A;  4ESS A;  2PJ9 A;  4B6Z A;  1FNO A;  4OID A;  4DJL A;  4P6Y A;  3SJE A;  4NFR A;  3CPA A;  1BLL E;  3GPO A;  3MRU A;  2PCU A;  3RAM A;  2PJ7 A;  1RTQ A;  3PBE A;  5JH9 A;  2GLF A;  1JQG A;  3D68 A;  3JRU A;  4FUU A;  1VHE A;  3MN8 A;  3FF3 A;  5ELY A;  1GYT A;  4DYO A;  2PJ8 A;  2F8H A;  3BHX A;  4MXU A;  4J4Z A;  1HDU A;  4OC1 A;  3KQZ A;  5HOL A;  2RB7 A;  1TY8 A;  3D4U A;  3VFQ A;  4EFD A;  1Y0Y A;  3KAS A;  3K9T A;  4P44 A;  4KYB A;  1TF8 A;  5LYI A;  3V7Z A;  3NH5 A;  2XD7 A;  3V45 A;  3KHX A;  3GB0 A;  2ZEH A;  3ISX A;  4PXC A;  2FVG A;  2QVP A;  1HDQ A;  2XEJ A;  3D7F A;  3SIH A;  4W9Y A;  3H8F A;  1NJR A;  4UEZ A;  3EWQ A;  2EK8 A;  4R76 A;  4TNU A;  1HJZ A;  4P4I A;  2ZEN A;  2PJ2 A;  3N5F A;  2ZOG A;  2AFM A;  2V8H A;  3B2Y A;  3FH4 A;  3EW5 A;  4NJR A;  1DTD A;  4JZ0 A;  2PVV A;  5THW A;  1Y0R A;  3SI2 A;  2EEE A;  5CBM A;  5DS0 A;  4KSI A;  2V8D A;  2X47 A;  5LRK A;  5FSU A;  3CT9 A;  4P4J A;  1H8L A;  1IGB A;  5CB5 A;  3WC6 A;  1CG2 A;  1Y7E A;  2EK9 A;  2QYV A;  4FWU A;  2AFW A;  5HVG A;  2RFH A;  1ZR5 A;  4PXE A;  3TX8 A;  4JCA A;  2AFO A;  1IY7 A;  2PJ6 A;  3Q71 A;  2BOA A;  3D7D A;  4H2K A;  3PB9 X;  5HVH A;  3KHZ A;  1Q7L A;  4YU9 A;  3B3W A;  4NJQ A;  4JGK A;  2LGR A;  1M4L A;  3KL9 A;  1UWY A;  4MHN A;  4WWV A;  4ABK A;  5K8O A;  2C6P A;  4ZX9 A;  4UEF A;  3PEI A;  3B3V A;  1CP7 A;  5LYL A;  4X3R A;  5J1Q A;  4Z65 A;  3KGQ A;  4TU0 A;  3NH8 A;  4OME A;  4R7M A;  3SJF A;  5LYD A;  1XRY A;  3CPX A;  2V77 A;  2XEF A;  1NSA A;  3FX6 A;  4GM5 A;  3S9L A;  3L2N A;  4NGR A;  1ZG8 A;  4GVV A;  3B3T A;  3WC5 A;  5HIH A;  3D66 A;  1LCP A;  1CP6 A;  3I1U A;  3IC1 A;  7CPA A;  1TXZ A;  4UML A;  3IEH A;  2DX6 A;  2Q43 A;  4IAV A;  2ZEO A;  3RBU A;  1FT7 A;  2PJA A;  3IJ3 A;  2PIY A;  3JZT A;  2C6C A;  3FED A;  4NGT A;  4GVW A;  4J5Q A;  2ZEM A;  3PRT A;  3Q6Z A;  3B35 A;  5HVF A;  2FG1 A;  3SII A;  4IK2 A;  4P4B A;  2XEG A;  2BCO A;  3PB8 X;  4OC0 A;  4NGM A;  5CB3 A;  4LQG A;  4A38 A;  4FAI A;  4ZYQ A;  2CIJ A;  4Q7A A;  5AIL A;  3VAR A;  3PB6 X;  1YW4 A;  5FSX A;  4NGQ A;  2FAV A;  2PE3 A;  2PJ5 A;  1ELL P;  3NH4 A;  4UF4 A;  1R43 A;  2J9A A;  3ETI A;  2PVW A;  4K0C A;  1VHO A;  2GRE A;  1TF9 A;  3PB7 X;  4OC5 A;  4AXV A;  1LFW A;  4ZY1 A;  2PJ4 A;  4PXD A;  4IHM A;  5DUS A;  4OP4 A;  3IIF A;  4J5R A;  1BAV A;  4JVV A;  2HB6 A;  2PIZ A;  3HLP A;  4NGS A;  4YWY A;  5K8M A;  4J5S A;  1F2O A;  5CMS A;  4A37 A;  4P45 A;  4R8F A;  1CBX A;  3S9N A;  4P10 A;  3KQX A;  1YME A;  1TKH A;  3QNV A;  4IQY A;  1YD9 A;  3GPQ A;  3S9M A;  2PJC A;  3V38 A;  6CPA A;  3SIG A;  1LAM A;  2GLJ A;  4NGN A;  1CPX A;  3IWW A;  2PJ1 A;  1XMB A;  3PFO A;  3FJU A;  3EWO A;  1Z5R A;  2PJ0 A;  5LYF A;  2O4H A;  4OKO A;  2DEA A;  4D86 A;  1BPN A;  4MHZ A;  5IB9 A;  3FEC A;  5FSV A;  5D29 A;  3RZA A;  4BD9 A;  1LAN A;  2NSM A;  1TKF A;  4PXB A;  5LRG A;  5FSY A;  1F2P A;  1YLO A;  5LRJ A;  1CX8 A;  3IO1 A;  2PJ3 A;  4A94 A;  4UIB A;  2AFS A;  1XFO A;  3IIB A;  1DE4 C;  4MHY A;  2ZOF A;  3DLJ A;  4JLL A;  3D67 A;  4MCR A;  1QQ9 A;  2ZEP A;  4ZI6 A;  3IFE A;  3SI1 A;  3D7G A;  5D8N A;  4MRI A;  2GU2 A;  2O53 A;  2CF4 A;  4A39 A;  4UEE A;  1TKJ A;  2BFQ A;  4ZX8 A;  2CTC A;  2NYQ A;  2PRQ A;  2VRI A;  3EWR A;  1LOK A;  4MCQ A;  5K8P A;  4ZY2 A;  2EWB A;  2FXK A;  1F57 A;  2AFX A;  3SJG A;  3WC7 A;  2WYR A;  3H8E A;  2ZED A;  3ISZ A;  4NGP A;  4OIW A;  3BI1 A;  3FEE A;  1ZR3 A;  3IID A;  4R6T A;  1VHU A;  3GLJ A;  5E3B A;  4F8Z A;  2BFR A;  1ARM A;  3WT4 A;  5FSZ A;  3B3S A;  3T8W A;  5HXD A;  5JGF A;  1HEE A;  3KR5 A;  3NFZ A;  4FBE A;  4K3N A;  3PBB A;  1YW6 A;  1TXR A;  2OOT A;  4MCP A;  1ZG9 A;  2ZEF A;  4ETK A;  1Z8L A;  3HUV A;  2ZEE A;  1XJO A;  3VAT A;  3SI0 A;  2WZN A;  2IQ6 A;  4P4D A;  5CPA A;  8CPA A;  3SIJ A;  4G1P A;  2ANP A;  4O23 A;  4WJB A;  1BPM A;  4ETJ A;  3KI9 A;  4JYW A;  3KR4 A;  4ZY0 A;  1KWM A;  1LAP A;  3BXM A;  1PCA A;  5F09 A;  2XEI A;  3TC8 A;  4RUH A;  3DGV A;  2BO9 A;  2JEW A;  2ZEL A;  2ACF A;  2Q51 A;  2G9D A;  3FVL A;  2VL1 A;  3B7I A;  2C6G A;  3H8G A;  4OC4 A;  1CPS A;  4CPA A;  1Z2L A;  4X8I A;  1AYE A;  2V8V A;  1EE3 P;  2ABZ A;  2F7V A;  3EWP A;  3PFE A;  2AFU A;  4X2T A;  1OBR A;  1ZLH A;  5K8N A;  2IJZ A;  2OR4 A;  4PQA A;  1VGY A;  3LWU A;  1VIX A;  4MMO A;  2I3C A;  1QMU A;  4DUK A;  3KZW A;  4ABL A;  2AFC A;  2V8G A;  4UIA A;  2ZEG A;  4EME A;  3GQO A;  3V2B A;  4OC3 A;  1R3N A;  3PB4 X;  4GUA A;  5I4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...