4R7MA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
518
structure length
516
Chain Sequence
SEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 175
structure length 516
sequence length 518
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r7mA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r7mA02
2ACFA 4IK2A 3PFOA 2Q51A 2ZEPA 4NJQA 4ZX9A 2AFOA 3HUVA 3EWOA 2ZEOA 2OOTA 3KQZA 4ZX8A 4FUUA 1ARLA 5DUSA 4OIWA 1Z5RA 2PJ8A 4ETKA 3D68A 5CBMA 1VGYA 2DEAA 2XEIA 2GLJA 3D7FA 4OC3A 3B3WA 4P4JA 3IWWA 3KHXA 5LYIA 2AFSA 3EWPA 2BOAA 3VATA 3EWQA 3RAMA 1YW4A 2XEGA 2LGRA 1FNOA 4UMLA 3SJXA 3QNVA 4R7MA 3KI9A 4NFRA 1YD9A 2FAVA 4ZY1A 3PB8X 2WYRA 3L2NA 4GUAA 2VRIA 2EK8A 1VHOA 2ZOFA 1TF9A 2GREA 3Q71A 3SIIA 1ZLIA 3IJ3A 2GLFA 4R76A 2AFWA 4UIBA 4AXVA 1ZG9A 2PJ2A 2PJ5A 1QMUA 3H8FA 4X3RA 1TKJA 2V8VA 2V8DA 2XEFA 2NSMA 3IO1A 2BFRA 5HOLA 2IMOA 3I1UA 4JVVA 2C6CA 4DJLA 3BHXA 4P4BA 1UWYA 4PXCA 1TXZA 2PVVA 3V7ZA 2EWBA 1ZLHA 4PXDA 4ZI6A 3T8WA 3DGVA 4WJBA 1TF8A 3FH4A 3ETIA 4JGKA 2FG1A 2G9DA 5HVGA 4IQYA 5K8NA 5LRKA 1BPMA 2VL1A 1YW6A 4F8ZA 5DS0A 1ZR3A 2CIJA 3VH9A 1LAPA 2JEWA 4NGNA 1OBRA 3V2BA 2ZEHA 4J5SA 4P10A 5HVHA 2ZEEA 4MHYA 3SIHA 3FF3A 3IC1A 1HDQA 4UEEA 3SIGA 4P4DA 3VFQA 4UEZA 1KWMA 3KZWA 3FVLA 4F9UA 2QYVA 3B35A 2V77A 3GPGA 1Z2LA 4K0CA 4MCPA 3D7HA 2V8HA 8CPAA 4A39A 3B2YA 3WC7A 2PJBA 2ZEDA 4OC1A 1ELLP 3D7GA 5THWA 3D67A 4R8FA 5ELYA 3PBEA 4YWYA 2PJ6A 3KASA 5LRGA 5LYLA 3GQEA 3PBBA 2AFUA 4UIAA 2PIYA 2QJ8A 3EWRA 2ZEMA 2I3CA 3V38A 4TWEA 2F8HA 2L8RA 3WT4A 4G1PA 5E3BA 4NGSA 3WC5A 4ESSA 1YSJA 4WWVA 1TKFA 1VHEA 1DTDA 4J4ZA 4PXBA 1IY7A 2Q43A 1AMPA 3S9LA 5D8NA 2ZEGA 2ZEFA 3S9MA 1R3NA 2ZENA 4P44A 2CF4A 4OP4A 2RFHA 3LMSA 2EEEA 3PB4X 4UF4A 3EJFA 3IEHA 1BPNA 5IB9A 3BXMA 3NH5A 2BCOA 1AYEA 2NYQA 4P4FA 3PRTA 2POKA 3MN8A 3SIJA 3EKEA 4ABKA 1Y7EA 3FJUA 4BD9A 2J9AA 1IGBA 4OC4A 4FWUA 3Q6ZA 3BI1A 3V45A 3FX6A 4FAIA 4J5RA 2CTBA 3GPOA 4F9VA 1LAMA 2PJ0A 1CP7A 2PRQA 4ZY0A 2FVGA 2PIZA 4ETJA 3DLJA 3CPAA 5HVFA 2ZELA 2ABZA 4NJRA 1F57A 2C1CA 1PCAA 3EW5A 1TY8A 3D4UA 4Z65A 3FEEA 1CX8A 1H8LA 4IAVA 3GUXA 3K2KA 3S9NA 4KSIA 3NA6A 4D86A 3PEIA 1SPVA 2O4HA 3RZAA 4EFDA 4ONWA 4FBEA 3EJGA 5CB3A 3PB7X 4ABLA 4X8IA 3IFEA 5D29A 3IIFA 2AFZA 3FEDA 4P4EA 5K8PA 4JZ0A 4OKOA 5HIHA 2CTCA 3PB9X 5J1QA 2F7VA 1ARMA 5FSUA 4A94A 2BFQA 2QVPA 4OMEA 3B3VA 4TU0A 2O53A 2PJ3A 2PJ1A 2IQ6A 4KYBA 4MCSA 3KHZA 1RTQA 4UEFA 5LYFA 3D66A 4R6TA 7CPAA 4JLLA 2V8GA 3HLPA 1YLOA 3K9TA 4GM5A 4O23A 1CPSA 1GYTA 4W9YA 3D7DA 3MRUA 2ZOGA 3N5FA 1ZG8A 2EK9A 4J5QA 3NH8A 5CPAA 1PYTB 3JZTA 1ZG7A 1Z8LA 1F2OA 5K8OA 3KGQA 1NSAA 2PJ9A 4OIDA 2AFCA 4H2KA 1LFWA 2PCUA 1HJZA 5JGFA 2Q4ZA 2PJ4A 1CBXA 4MCRA 5LRJA 4DYOA 2JBJA 2PJCA 4YU9A 1XBUA 1QQ9A 5JM6A 1F2PA 4A38A 3KR5A 4Q7AA 4PQAA 4A37A 2GU2A 1JQGA 1HEEA 1XRYA 3TX8A 3GPQA 6CPAA 5LYDA 3SI2A 3PB6X 4CPAA 4GVWA 2C6GA 2C6PA 5I4MA 4P45A 1BAVA 4NGQA 3CPXA 3BI0A 1LOKA 1ELMP 3FMCA 4P4IA 5AILA 4OC5A 3IIBA 3NH4A 4MXUA 5F09A 1VIXA 2OR4A 1Q7LA 1LANA 2PVWA 2IJZA 3LWUA 3GQOA 2FXKA 1TXRA 4K3NA 3RBUA 4JCAA 2X47A 1TKHA 3CDXA 2JBKA 3B3TA 4MRIA 3VARA 1VHUA 4PPZA 5K8MA 4NGTA 2PE3A 4B6ZA 2AFXA 2DX6A 4P6YA 1CPXA 3IIDA 2XEJA 4EWTA 4LQGA 4OC0A 1DE4C 3ISZA 4JYWA 3GLJA 3NFZA 4PXEA 3WABA 3ISXA 3CT9A 1ZR5A 4ZYQA 3H8EA 3SJGA 3TC8A 3B3SA 3SI1A 4MHPA 5HXDA 2PJ7A 4RUHA 2ANPA 1FT7A 4MHZA 1R43A 1Y0RA 4MMOA 4OC2A 3SJEA 5FSZA 4NGRA 1NJRA 4MCQA 1HDUA 2BO9A 3KQXA 2PJAA 1YMEA 4X2TA 5CMSA 4EMEA 3PFEA 4IHMA 4NGMA 2RB7A 3KL9A 3SJFA 1XFOA 3WC6A 4NGPA 3JRUA 1BLLE 1CP6A 2XD7A 1Y0YA 5FSXA 3B7IA 3KR4A 1EE3P 4DUKA 3H8GA 1LCPA 5CB5A 2HC9A 3FECA 5FSVA 1M4LA 2AFMA 1XJOA 1XMBA 4MHNA 4ZY2A 3GB0A 5JH9A 4TNUA 3SI0A 4GVVA 3B3CA 5FSYA 2HB6A 2WZNA 1CG2A
chains in the Genus database with same CATH superfamily
4CS0B 2ACFA 2R1IA 4IK2A 3PFOA 2Q51A 4JXQA 4KOVA 2ZEPA 4NJQA 4ZX9A 2AFOA 5KTCA 3HUVA 4KOYA 4KSAA 3EWOA 2ZEOA 2OOTA 4H89A 3KQZA 4ZX8A 1S3ZA 2F5IA 3EY5A 4FUUA 4XPDC 1ARLA 3BJ7A 5GCNA 5DUSA 4OIWA 1Z5RA 2PJ8A 4ETKA 5G22A 3D68A 5CBMA 1VGYA 2DEAA 2XEIA 2GLJA 3D7FA 1Z4EA 3LD2A 2I00A 4OC3A 5AG6A 2JLMA 2QECA 4YFJA 3B3WA 4MFLA 4B5PB 4P4JA 1MK4A 3IWWA 3LODA 4F0YA 1NE9A 2K5TA 3KHXA 2YGWA 3V8IA 2B3VA 2PRBA 3IWEA 4MFPA 5LYIA 3S6KA 3WR7A 4A32A 2AFSA 2Y0MA 3EWPA 2BOAA 4NSQA 3F8KA 4M85A 5KTDA 4MY0A 3VATA 3EWQA 3RAMA 1YW4A 2XEGA 2LGRA 1FNOA 4UMLA 5F48A 4UFVA 3SJXA 3QNVA 4R7MA 3KI9A 4H6ZA 4NFRA 1YD9A 2FAVA 4ZY1A 3D3SA 3PB8X 4KVXA 2WYRA 3L2NA 4GUAA 3IU1A 2VRIA 2EK8A 4XPDB 2DPSA 1LRZA 1VHOA 2ZOFA 5H84A 1TF9A 2GREA 3Q71A 3TTHA 3FXTA 3SIIA 2AJ6A 1ZLIA 3IJ3A 2GLFA 4R76A 2AFWA 4UIBA 3VWDA 1ZG9A 3TO7A 4AXVA 2PJ2A 1YGHA 2PJ5A 1IYKA 3H8FA 1IICA 1QMUA 2VZZA 1TKJA 2V8VA 2YNEA 2V8DA 4QB9A 4X3RA 4Y49C 3C26A 2XEFA 3PZJA 2NSMA 1I21A 2WPWA 3CXPA 3IO1A 4LQ6A 3VWEA 2BFRA 3IU2A 5HOLA 1SQHA 1XMTA 2OZGA 2IMOA 3I1UA 4M6IA 4JVVA 2C6CA 4U5YA 2ATRA 3BHXA 1P0HA 4DJLA 2WPXA 4P4BA 1UWYA 1YR0A 4PXCA 1TXZA 2IL4A 5F49A 2PVVA 4H6UA 3V7ZA 1KUYA 2OU2A 4MFZA 2EWBA 1Q2YA 1ZLHA 2FIWA 3K9UA 4MY3A 4NF1A 4PXDA 2GE3A 4QC6A 4ZI6A 3S6HA 5J8CA 2NMTA 4KZTA 1XIXA 3T8WA 3DSBA 4QUSA 4MI4A 2PR8A 5JPHA 3T90A 3DGVA 4WJBA 1IYLA 1TF8A 2CY2A 3FH4A 2ZXVA 3ETIA 5AG7A 4QVTA 3FB3A 3EFAA 4JGKA 2PDOA 4BMHA 1IOFA 1QSRA 2FG1A 2G9DA 5HVGA 3FIXA 4IQYA 2VBQA 4R9MA 5K8NA 3SXOA 5LRKA 3TFYA 4R57A 1BPMA 4Y49B 4AVCA 1V0CA 2VL1A 4NCZA 4OLLA 4A95A 1YW6A 4F8ZA 1KZFA 5DS0A 4KORA 1NSLA 1ZR3A 5F47A 2CIJA 3VH9A 1LAPA 2JEWA 4NGNA 1OBRA 5AG4A 3V2BA 2ZEHA 4J5SA 4KVOE 4P10A 4UFXA 4YGOA 3SXNA 1ON0A 2G3TA 5I0CA 1XF8A 3G3SA 5AG5A 4CGPA 5HVHA 2ZEEA 2D4OA 4MHYA 3SIHA 4ZGYB 3FF3A 4KUAA 1B6BA 3IC1A 4B11A 1HDQA 4UEEA 3SIGA 5HMNA 4P4DA 2C27A 2ZW6A 3VFQA 4UEZA 1KWMA 2ZW7A 3KZWA 2B4DA 3FVLA 1VHSA 4F9UA 3GY9A 2QYVA 2Q0YA 3R96A 3B35A 2V77A 3GPGA 1Z2LA 5C82A 3TO6A 4K0CA 4MCPA 2G3AA 1YVKA 3D7HA 3I9SA 2V8HA 3ZJ0A 1CM0A 4KOSA 4A39A 4KUBA 3B2YA 8CPAA 1CJWA 1XOVA 3QB8A 3WC7A 2PJBA 1XE4A 2ZEDA 2FCKA 3EO4A 1ELLP 3D7GA 4M3SA 4OC1A 4PV6A 5THWA 3D67A 2J8RA 2Q7BA 4CAXA 4R8FA 5ELYA 3PBEA 1M4GA 1M44A 4YWYA 3CZXA 2PJ6A 3KASA 2BEIA 4E2AA 4CAFA 5LRGA 4EVYA 4CAVA 5LYLA 3GQEA 1Y9KA 3BJ8A 3P2HA 3PBBA 3FNCA 2EO8A 4XPLA 3RO0A 2P0WA 4AVAA 2AFUA 2DF5A 4RS2A 2PIYA 4UIAA 2QJ8A 3EWRA 2ZEMA 2I3CA 3V38A 1P4NA 4M6GA 1M4IA 4TWEA 3TT2A 1M4DA 5IB0A 4B13A 2F8HA 2L8RA 3KKWA 3WT4A 2GFQA 4G1PA 3A9LA 2FS5A 2CNSA 5E3BA 1U6MA 4KLWA 4NGSA 3WC5A 4ESSA 1YSJA 4WWVA 1TKFA 2PR1A 1VHEA 4C7HA 2Q44A 3IWGA 1DTDA 4KOUA 4CGLA 4J4ZA 4PXBA 1IY7A 2Q43A 1AMPA 2EBJA 4YRHA 3S9LA 5D8NA 1S7NA 4E0AA 2ZEGA 3FYNA 2ZEFA 3S9MA 1R3NA 2ZENA 4P44A 2CF4A 2DXQA 4OP4A 4HNWB 4B10A 1Z9UA 2RFHA 1QSTA 2VQYA 1MJ9A 3R9GA 3LMSA 4LX9A 4CGOA 1Y9WA 2REFA 2X7BA 2EEEA 3PB4X 2EUIA 4UF4A 3EJFA 1I12A 4HKFA 3IEHA 3R9EA 2QMLA 4JWPA 4F6AA 4RI1A 1BPNA 5IB9A 3BXMA 3CXSA 3LACA 2AE6A 3NH5A 3W6XA 2BCOA 4R87A 1AYEA 1IB1E 2NYQA 4MBUA 4P4FA 3PRTA 2BL1A 5BWAB 2POKA 3MN8A 3SIJA 3EKEA 4ABKA 1BOBA 4KVME 4B12A 2YNCC 5DWMA 1Y7EA 3FJUA 4BD9A 2J9AA 1IGBA 4OC4A 4FWUA 3Q6ZA 3BI1A 3V45A 3FX6A 3N7ZA 4C2YA 4FAIA 2WUUA 4J5RA 2CTBA 2PC1A 4CGMA 3GPOA 2ZPAA 4F9VA 3RYOA 1LAMA 4HNXB 5G1ZA 2PJ0A 1CP7A 2PRQA 3FRMA 4Q38A 4OAEA 3S6GA 4NEXA 2Q04A 4ZY0A 1IIDA 2FVGA 2PIZA 3E0KA 3PGPA 4UA3A 4ETJA 3DLJA 3CPAA 4KSFA 2ZELA 2ABZA 2VEZA 1RXTA 3QAHA 2FIAA 1F57A 2B3UA 2C1CA 1PCAA 4NJRA 4C68A 3EW5A 1TY8A 3D4UA 2Z0ZA 4Z65A 4PSWA 3FEEA 1CX8A 1H8LA 2VI7A 4IAVA 5C88A 2FXFA 3R1KA 3GUXA 3K2KA 2ODFA 5ISVA 4UCPA 3CXQA 4PK3A 4B5PA 4C2ZA 3S9NA 4KSIA 2B5GB 3NA6A 4CAEA 4II9A 4HPSA 4D86A 3PEIA 1SPVA 2O4HA 3RZAA 2WSAA 1A2ZA 2Z3OA 2OB0A 4A31A 4EFDA 4ONWA 4FBEA 4FD7A 4A30A 3EJGA 5CB3A 3TE4A 2R98A 4U9ZA 3PB7X 3BLNA 4ABLA 4X8IA 1IOIA 3DDDA 3IFEA 3TO9A 3GKRA 5D29A 3IIFA 4AG9A 2AFZA 3FEDA 3GIUA 4P4EA 1AUGA 3H5ZA 5DWNA 5K8PA 2Q4VA 1QSMA 1S7LA 3FBUA 1M1DA 4KLVA 1VKCA 2D4PA 2JEVA 4JZ0A 1I1DA 4OKOA 3NE8A 5HIHA 2CTCA 3IGRA 2A4NA 4R3LA 4MFQA 5F46A 1S60A 3PB9X 5J1QA 2QIRA 2F7VA 2GIVA 1ARMA 2VZYA 4R3KA 5FSUA 4GS4A 4A94A 3R95A 2BFQA 1Z8TA 4RN7A 2QVPA 4OMEA 3B3VA 4MFJA 1YK3A 4KOTA 1S7KA 4TU0A 2O53A 2PJ3A 2PJ1A 2IQ6A 4KYBA 4MCSA 3KHZA 3TCVA 1RTQA 4MFKA 3JVNA 3T9YA 4A2ZA 4XPKA 2FE7A 4LUAA 3GYAA 4UEFA 3SHPA 5LYFA 3D66A 5AGEA 1S5KA 4R6TA 4AG7A 2W2GA 4CYOA 4CGNA 7CPAA 2PQ8A 4JLLA 2V8GA 3HLPA 3I3GA 4QBJA 4E8OA 1YLOA 1X12A 2ARHA 3K9TA 4GM5A 4O23A 3MGDA 1CPSA 1GYTA 4X5KA 4W9YA 3D7DA 3MRUA 2ZOGA 3N5FA 4IF5A 1ZG8A 2Z3MA 2EK9A 2VXKA 3JUWA 4PSXA 4J5QA 1KUXA 3NH8A 5CPAA 5G21A 4CRZB 1PYTB 2Q4YA 3TOAA 2YNDA 3JZTA 5EBVA 1KUVA 1ZG7A 1Z8LA 4UWJA 2RC4A 2Z3NA 3G8WA 2CNMA 1F2OA 1S7FA 4RUHA 4A33A 3DR6A 4L8AA 3KGQA 5K8OA 4K30A 1NSAA 3JTKA 4JXRA 2PJ9A 1PUAA 2R7HA 2AFCA 1YLEA 4H2KA 2YNCA 4OIDA 4JLYA 3B8GA 4XNHC 4UWIA 1LFWA 2B5GA 2HV2A 1HJZA 2PCUA 5JGFA 2Q4ZA 2PJ4A 1CBXA 3D2PA 4MCRA 5LRJA 4DYOA 2JZFA 4UFWA 2JBJA 1WWZA 4Q36A 3NE7A 4F0XA 4CAWA 2PJCA 2Z3LA 2P6GA 4YU9A 1XBUA 2JZEA 4CYQA 1QQ9A 5JM6A 1F2PA 2JDDA 4A38A 3KR5A 4Q7AA 4PQAA 4IUSA 4A37A 2GU2A 5HVFA 1JQGA 1HEEA 1XRYA 2J8MA 2KCWA 3TX8A 3GPQA 4JD6A 5A27A 6CPAA 4HNYB 2Z11A 5LYDA 3PB6X 3SI2A 4GVWA 2C6GA 2C6PA 4CPAA 4CYNA 5I4MA 1YREA 5JQ4A 4P45A 1BAVA 4KS9A 4C7IA 4NGQA 4UBRA 3ZZIA 3CPXA 3BI0A 2RNKA 1LOKA 4MHDA 1ELMP 3FMCA 2OH1A 5H86A 4I49A 4P4IA 2G0BA 5AILA 4OC5A 2WCTA 3IIBA 4XNHB 5HH1A 5G20A 1K4JA 3RNZA 3NH4A 4MXUA 5F09A 4CYPA 1VIXA 2DPTA 2OR4A 1Q7LA 1LANA 2R8VA 2PVWA 2IJZA 3LWUA 4OADA 2B4DB 3GQOA 2GANA 5EMIA 4L89A 1NMTA 2FXKA 1RO5A 1TXRA 4PK2A 4K3NA 1QSOA 1UFHA 1Z4RA 1JWQA 3R9FA 2Q7SA 4JCAA 1BO4A 3RBUA 4MJ8A 2X47A 1TKHA 3CDXA 2JBKA 3B3TA 4MRIA 3EC4A 3VARA 1VHUA 4PPZA 2HQYA 5K8MA 4NGTA 2PE3A 2HUZA 2J8NA 4B6ZA 1PU9A 2AFXA 4UCNA 2DX6A 1GHEA 4P6YA 4AB7A 1Q2CA 4KOWA 1CPXA 2O28A 2H5MA 1Z8WA 3IIDA 2XEJA 4EWTA 4LQGA 4BINA 4OC0A 1DE4C 2JDCA 5CNPA 5A28A 3ISZA 1N71A 4JYWA 3F0AA 1MJBA 1XEBA 2REEA 3UY5A 1QSNA 2OZUA 1TIQA 3GLJA 2CXAA 3NFZA 4PXEA 5E96A 3W91A 3TOBA 3WABA 4C2XA 3ISXA 1WK4A 3CT9A 1ZO0A 1ZR5A 4ZYQA 3QAYA 3H8EA 3S6FA 1Y7RA 3SJGA 2Z3PA 3TC8A 5IX3A 1YVOA 2FSRA 3B3SA 4MHPA 3SI1A 4DNCA 5HXDA 2PJ7A 4ONUA 5KTAA 4GXHA 2JZDA 4AVBA 2ANPA 1FT7A 2B4BA 2CNTA 5EC4A 4MHZA 1R43A 1Y0RA 2FT0A 4MMOA 4OC2A 1YQEA 3SJEA 5FSZA 4KOXA 5FVJA 4NGRA 1NJRA 4MCQA 1HDUA 2BO9A 1IU8A 3KQXA 1YX0A 2PJAA 4U9YA 2KQVA 1YMEA 4X2TA 5CMSA 4B5OA 4M6HA 1J4JA 4EMEA 4J3GA 2I79A 3PFEA 1Q2DA 2B58A 4IHMA 1OZPA 3H4QA 4NGMA 2RB7A 2OZHA 3KL9A 4ORFA 3SJFA 2EVNA 2FL4A 5IV0A 3F5BA 3EXNA 1XFOA 3WC6A 3DR8A 4NGPA 1Z8XA 3D8PA 3DNSA 4UCMA 3JRUA 4CRYB 2Z3KA 1BLLE 2PSWA 1CP6A 2XD7A 1Y0YA 4FD6A 2P6FA 4B14A 5FSXA 3B7IA 3KR4A 3D2MA 1EE3P 4BBHA 4NXYA 4DUKA 3H8GA 3OWCA 1LCPA 5CB5A 2BUEA 2HC9A 1B87A 2Z10A 3FECA 4FD4A 4JJXA 1FY7A 2ZW5A 1MJAA 2BSWA 5FSVA 1M4LA 2AFMA 1XJOA 1XMBA 3P2FA 4FD5A 4MHNA 4ZBGA 4ZY2A 2P6EA 3GB0A 5JH9A 4TNUA 3SI0A 4GVVA 1X10A 3B3CA 3PP9A 3W6SA 2ZW4A 1L0CA 5FSYA 1R57A 2HB6A 2WZNA 5J8FA 1CG2A
chains in the Genus database with same CATH topology
2ACFA 4IK2A 3PFOA 2Q51A 2ZEPA 4NJQA 4ZX9A 2AFOA 3HUVA 3EWOA 2ZEOA 2OOTA 3KQZA 4ZX8A 4FUUA 1ARLA 5DUSA 4OIWA 1Z5RA 2PJ8A 4ETKA 3D68A 5CBMA 1VGYA 2DEAA 2XEIA 2GLJA 3D7FA 4OC3A 3B3WA 4P4JA 3IWWA 3KHXA 5LYIA 2AFSA 3EWPA 2BOAA 3VATA 3EWQA 3RAMA 1YW4A 2XEGA 2LGRA 1FNOA 4UMLA 3SJXA 3QNVA 4R7MA 3KI9A 4NFRA 1YD9A 2FAVA 4ZY1A 3PB8X 2WYRA 3L2NA 4GUAA 2VRIA 2EK8A 1VHOA 2ZOFA 1TF9A 2GREA 3Q71A 3SIIA 1ZLIA 3IJ3A 2GLFA 4R76A 2AFWA 4UIBA 4AXVA 1ZG9A 2PJ2A 2PJ5A 1QMUA 3H8FA 4X3RA 1TKJA 2V8VA 2V8DA 2XEFA 2NSMA 3IO1A 2BFRA 5HOLA 2IMOA 3I1UA 4JVVA 2C6CA 4DJLA 3BHXA 4P4BA 1UWYA 4PXCA 1TXZA 2PVVA 3V7ZA 2EWBA 1ZLHA 4PXDA 4ZI6A 3T8WA 3DGVA 4WJBA 1TF8A 3FH4A 3ETIA 4JGKA 2FG1A 2G9DA 5HVGA 4IQYA 5K8NA 5LRKA 1BPMA 2VL1A 1YW6A 4F8ZA 5DS0A 1ZR3A 2CIJA 3VH9A 1LAPA 2JEWA 4NGNA 1OBRA 3V2BA 2ZEHA 4J5SA 4P10A 5HVHA 2ZEEA 4MHYA 3SIHA 3FF3A 3IC1A 1HDQA 4UEEA 3SIGA 4P4DA 3VFQA 4UEZA 1KWMA 3KZWA 3FVLA 4F9UA 2QYVA 3B35A 2V77A 3GPGA 1Z2LA 4K0CA 4MCPA 3D7HA 2V8HA 8CPAA 4A39A 3B2YA 3WC7A 2PJBA 2ZEDA 4OC1A 1ELLP 3D7GA 5THWA 3D67A 4R8FA 5ELYA 3PBEA 4YWYA 2PJ6A 3KASA 5LRGA 5LYLA 3GQEA 3PBBA 2AFUA 4UIAA 2PIYA 2QJ8A 3EWRA 2ZEMA 2I3CA 3V38A 4TWEA 2F8HA 2L8RA 3WT4A 4G1PA 5E3BA 4NGSA 3WC5A 4ESSA 1YSJA 4WWVA 1TKFA 1VHEA 1DTDA 4J4ZA 4PXBA 1IY7A 2Q43A 1AMPA 3S9LA 5D8NA 2ZEGA 2ZEFA 3S9MA 1R3NA 2ZENA 4P44A 2CF4A 4OP4A 2RFHA 3LMSA 2EEEA 3PB4X 4UF4A 3EJFA 3IEHA 1BPNA 5IB9A 3BXMA 3NH5A 2BCOA 1AYEA 2NYQA 4P4FA 3PRTA 2POKA 3MN8A 3SIJA 3EKEA 4ABKA 1Y7EA 3FJUA 4BD9A 2J9AA 1IGBA 4OC4A 4FWUA 3Q6ZA 3BI1A 3V45A 3FX6A 4FAIA 4J5RA 2CTBA 3GPOA 4F9VA 1LAMA 2PJ0A 1CP7A 2PRQA 4ZY0A 2FVGA 2PIZA 4ETJA 3DLJA 3CPAA 5HVFA 2ZELA 2ABZA 4NJRA 1F57A 2C1CA 1PCAA 3EW5A 1TY8A 3D4UA 4Z65A 3FEEA 1CX8A 1H8LA 4IAVA 3GUXA 3K2KA 3S9NA 4KSIA 3NA6A 4D86A 3PEIA 1SPVA 2O4HA 3RZAA 4EFDA 4ONWA 4FBEA 3EJGA 5CB3A 3PB7X 4ABLA 4X8IA 3IFEA 5D29A 3IIFA 2AFZA 3FEDA 4P4EA 5K8PA 4JZ0A 4OKOA 5HIHA 2CTCA 3PB9X 5J1QA 2F7VA 1ARMA 5FSUA 4A94A 2BFQA 2QVPA 4OMEA 3B3VA 4TU0A 2O53A 2PJ3A 2PJ1A 2IQ6A 4KYBA 4MCSA 3KHZA 1RTQA 4UEFA 5LYFA 3D66A 4R6TA 7CPAA 4JLLA 2V8GA 3HLPA 1YLOA 3K9TA 4GM5A 4O23A 1CPSA 1GYTA 4W9YA 3D7DA 3MRUA 2ZOGA 3N5FA 1ZG8A 2EK9A 4J5QA 3NH8A 5CPAA 1PYTB 3JZTA 1ZG7A 1Z8LA 1F2OA 5K8OA 3KGQA 1NSAA 2PJ9A 4OIDA 2AFCA 4H2KA 1LFWA 2PCUA 1HJZA 5JGFA 2Q4ZA 2PJ4A 1CBXA 4MCRA 5LRJA 4DYOA 2JBJA 2PJCA 4YU9A 1XBUA 1QQ9A 5JM6A 1F2PA 4A38A 3KR5A 4Q7AA 4PQAA 4A37A 2GU2A 1JQGA 1HEEA 1XRYA 3TX8A 3GPQA 6CPAA 5LYDA 3SI2A 3PB6X 4CPAA 4GVWA 2C6GA 2C6PA 5I4MA 4P45A 1BAVA 4NGQA 3CPXA 3BI0A 1LOKA 1ELMP 3FMCA 4P4IA 5AILA 4OC5A 3IIBA 3NH4A 4MXUA 5F09A 1VIXA 2OR4A 1Q7LA 1LANA 2PVWA 2IJZA 3LWUA 3GQOA 2FXKA 1TXRA 4K3NA 3RBUA 4JCAA 2X47A 1TKHA 3CDXA 2JBKA 3B3TA 4MRIA 3VARA 1VHUA 4PPZA 5K8MA 4NGTA 2PE3A 4B6ZA 2AFXA 2DX6A 4P6YA 1CPXA 3IIDA 2XEJA 4EWTA 4LQGA 4OC0A 1DE4C 3ISZA 4JYWA 3GLJA 3NFZA 4PXEA 3WABA 3ISXA 3CT9A 1ZR5A 4ZYQA 3H8EA 3SJGA 3TC8A 3B3SA 3SI1A 4MHPA 5HXDA 2PJ7A 4RUHA 2ANPA 1FT7A 4MHZA 1R43A 1Y0RA 4MMOA 4OC2A 3SJEA 5FSZA 4NGRA 1NJRA 4MCQA 1HDUA 2BO9A 3KQXA 2PJAA 1YMEA 4X2TA 5CMSA 4EMEA 3PFEA 4IHMA 4NGMA 2RB7A 3KL9A 3SJFA 1XFOA 3WC6A 4NGPA 3JRUA 1BLLE 1CP6A 2XD7A 1Y0YA 5FSXA 3B7IA 3KR4A 1EE3P 4DUKA 3H8GA 1LCPA 5CB5A 2HC9A 3FECA 5FSVA 1M4LA 2AFMA 1XJOA 1XMBA 4MHNA 4ZY2A 3GB0A 5JH9A 4TNUA 3SI0A 4GVVA 3B3CA 5FSYA 2HB6A 2WZNA 1CG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACF A;  4IK2 A;  3PFO A;  2Q51 A;  2ZEP A;  4NJQ A;  4ZX9 A;  2AFO A;  3HUV A;  3EWO A;  2ZEO A;  2OOT A;  3KQZ A;  4ZX8 A;  4FUU A;  1ARL A;  5DUS A;  4OIW A;  1Z5R A;  2PJ8 A;  4ETK A;  3D68 A;  5CBM A;  1VGY A;  2DEA A;  2XEI A;  2GLJ A;  3D7F A;  4OC3 A;  3B3W A;  4P4J A;  3IWW A;  3KHX A;  5LYI A;  2AFS A;  3EWP A;  2BOA A;  3VAT A;  3EWQ A;  3RAM A;  1YW4 A;  2XEG A;  2LGR A;  1FNO A;  4UML A;  3SJX A;  3QNV A;  4R7M A;  3KI9 A;  4NFR A;  1YD9 A;  2FAV A;  4ZY1 A;  3PB8 X;  2WYR A;  3L2N A;  4GUA A;  2VRI A;  2EK8 A;  1VHO A;  2ZOF A;  1TF9 A;  2GRE A;  3Q71 A;  3SII A;  1ZLI A;  3IJ3 A;  2GLF A;  4R76 A;  2AFW A;  4UIB A;  4AXV A;  1ZG9 A;  2PJ2 A;  2PJ5 A;  1QMU A;  3H8F A;  4X3R A;  1TKJ A;  2V8V A;  2V8D A;  2XEF A;  2NSM A;  3IO1 A;  2BFR A;  5HOL A;  2IMO A;  3I1U A;  4JVV A;  2C6C A;  4DJL A;  3BHX A;  4P4B A;  1UWY A;  4PXC A;  1TXZ A;  2PVV A;  3V7Z A;  2EWB A;  1ZLH A;  4PXD A;  4ZI6 A;  3T8W A;  3DGV A;  4WJB A;  1TF8 A;  3FH4 A;  3ETI A;  4JGK A;  2FG1 A;  2G9D A;  5HVG A;  4IQY A;  5K8N A;  5LRK A;  1BPM A;  2VL1 A;  1YW6 A;  4F8Z A;  5DS0 A;  1ZR3 A;  2CIJ A;  3VH9 A;  1LAP A;  2JEW A;  4NGN A;  1OBR A;  3V2B A;  2ZEH A;  4J5S A;  4P10 A;  5HVH A;  2ZEE A;  4MHY A;  3SIH A;  3FF3 A;  3IC1 A;  1HDQ A;  4UEE A;  3SIG A;  4P4D A;  3VFQ A;  4UEZ A;  1KWM A;  3KZW A;  3FVL A;  4F9U A;  2QYV A;  3B35 A;  2V77 A;  3GPG A;  1Z2L A;  4K0C A;  4MCP A;  3D7H A;  2V8H A;  8CPA A;  4A39 A;  3B2Y A;  3WC7 A;  2PJB A;  2ZED A;  4OC1 A;  1ELL P;  3D7G A;  5THW A;  3D67 A;  4R8F A;  5ELY A;  3PBE A;  4YWY A;  2PJ6 A;  3KAS A;  5LRG A;  5LYL A;  3GQE A;  3PBB A;  2AFU A;  4UIA A;  2PIY A;  2QJ8 A;  3EWR A;  2ZEM A;  2I3C A;  3V38 A;  4TWE A;  2F8H A;  2L8R A;  3WT4 A;  4G1P A;  5E3B A;  4NGS A;  3WC5 A;  4ESS A;  1YSJ A;  4WWV A;  1TKF A;  1VHE A;  1DTD A;  4J4Z A;  4PXB A;  1IY7 A;  2Q43 A;  1AMP A;  3S9L A;  5D8N A;  2ZEG A;  2ZEF A;  3S9M A;  1R3N A;  2ZEN A;  4P44 A;  2CF4 A;  4OP4 A;  2RFH A;  3LMS A;  2EEE A;  3PB4 X;  4UF4 A;  3EJF A;  3IEH A;  1BPN A;  5IB9 A;  3BXM A;  3NH5 A;  2BCO A;  1AYE A;  2NYQ A;  4P4F A;  3PRT A;  2POK A;  3MN8 A;  3SIJ A;  3EKE A;  4ABK A;  1Y7E A;  3FJU A;  4BD9 A;  2J9A A;  1IGB A;  4OC4 A;  4FWU A;  3Q6Z A;  3BI1 A;  3V45 A;  3FX6 A;  4FAI A;  4J5R A;  2CTB A;  3GPO A;  4F9V A;  1LAM A;  2PJ0 A;  1CP7 A;  2PRQ A;  4ZY0 A;  2FVG A;  2PIZ A;  4ETJ A;  3DLJ A;  3CPA A;  5HVF A;  2ZEL A;  2ABZ A;  4NJR A;  1F57 A;  2C1C A;  1PCA A;  3EW5 A;  1TY8 A;  3D4U A;  4Z65 A;  3FEE A;  1CX8 A;  1H8L A;  4IAV A;  3GUX A;  3K2K A;  3S9N A;  4KSI A;  3NA6 A;  4D86 A;  3PEI A;  1SPV A;  2O4H A;  3RZA A;  4EFD A;  4ONW A;  4FBE A;  3EJG A;  5CB3 A;  3PB7 X;  4ABL A;  4X8I A;  3IFE A;  5D29 A;  3IIF A;  2AFZ A;  3FED A;  4P4E A;  5K8P A;  4JZ0 A;  4OKO A;  5HIH A;  2CTC A;  3PB9 X;  5J1Q A;  2F7V A;  1ARM A;  5FSU A;  4A94 A;  2BFQ A;  2QVP A;  4OME A;  3B3V A;  4TU0 A;  2O53 A;  2PJ3 A;  2PJ1 A;  2IQ6 A;  4KYB A;  4MCS A;  3KHZ A;  1RTQ A;  4UEF A;  5LYF A;  3D66 A;  4R6T A;  7CPA A;  4JLL A;  2V8G A;  3HLP A;  1YLO A;  3K9T A;  4GM5 A;  4O23 A;  1CPS A;  1GYT A;  4W9Y A;  3D7D A;  3MRU A;  2ZOG A;  3N5F A;  1ZG8 A;  2EK9 A;  4J5Q A;  3NH8 A;  5CPA A;  1PYT B;  3JZT A;  1ZG7 A;  1Z8L A;  1F2O A;  5K8O A;  3KGQ A;  1NSA A;  2PJ9 A;  4OID A;  2AFC A;  4H2K A;  1LFW A;  2PCU A;  1HJZ A;  5JGF A;  2Q4Z A;  2PJ4 A;  1CBX A;  4MCR A;  5LRJ A;  4DYO A;  2JBJ A;  2PJC A;  4YU9 A;  1XBU A;  1QQ9 A;  5JM6 A;  1F2P A;  4A38 A;  3KR5 A;  4Q7A A;  4PQA A;  4A37 A;  2GU2 A;  1JQG A;  1HEE A;  1XRY A;  3TX8 A;  3GPQ A;  6CPA A;  5LYD A;  3SI2 A;  3PB6 X;  4CPA A;  4GVW A;  2C6G A;  2C6P A;  5I4M A;  4P45 A;  1BAV A;  4NGQ A;  3CPX A;  3BI0 A;  1LOK A;  1ELM P;  3FMC A;  4P4I A;  5AIL A;  4OC5 A;  3IIB A;  3NH4 A;  4MXU A;  5F09 A;  1VIX A;  2OR4 A;  1Q7L A;  1LAN A;  2PVW A;  2IJZ A;  3LWU A;  3GQO A;  2FXK A;  1TXR A;  4K3N A;  3RBU A;  4JCA A;  2X47 A;  1TKH A;  3CDX A;  2JBK A;  3B3T A;  4MRI A;  3VAR A;  1VHU A;  4PPZ A;  5K8M A;  4NGT A;  2PE3 A;  4B6Z A;  2AFX A;  2DX6 A;  4P6Y A;  1CPX A;  3IID A;  2XEJ A;  4EWT A;  4LQG A;  4OC0 A;  1DE4 C;  3ISZ A;  4JYW A;  3GLJ A;  3NFZ A;  4PXE A;  3WAB A;  3ISX A;  3CT9 A;  1ZR5 A;  4ZYQ A;  3H8E A;  3SJG A;  3TC8 A;  3B3S A;  3SI1 A;  4MHP A;  5HXD A;  2PJ7 A;  4RUH A;  2ANP A;  1FT7 A;  4MHZ A;  1R43 A;  1Y0R A;  4MMO A;  4OC2 A;  3SJE A;  5FSZ A;  4NGR A;  1NJR A;  4MCQ A;  1HDU A;  2BO9 A;  3KQX A;  2PJA A;  1YME A;  4X2T A;  5CMS A;  4EME A;  3PFE A;  4IHM A;  4NGM A;  2RB7 A;  3KL9 A;  3SJF A;  1XFO A;  3WC6 A;  4NGP A;  3JRU A;  1BLL E;  1CP6 A;  2XD7 A;  1Y0Y A;  5FSX A;  3B7I A;  3KR4 A;  1EE3 P;  4DUK A;  3H8G A;  1LCP A;  5CB5 A;  2HC9 A;  3FEC A;  5FSV A;  1M4L A;  2AFM A;  1XJO A;  1XMB A;  4MHN A;  4ZY2 A;  3GB0 A;  5JH9 A;  4TNU A;  3SI0 A;  4GVV A;  3B3C A;  5FSY A;  2HB6 A;  2WZN A;  1CG2 A; 
#chains in the Genus database with same CATH topology
 4CS0 B;  2ACF A;  2R1I A;  4IK2 A;  3PFO A;  2Q51 A;  4JXQ A;  4KOV A;  2ZEP A;  4NJQ A;  4ZX9 A;  2AFO A;  5KTC A;  3HUV A;  4KOY A;  4KSA A;  3EWO A;  2ZEO A;  2OOT A;  4H89 A;  3KQZ A;  4ZX8 A;  1S3Z A;  2F5I A;  3EY5 A;  4FUU A;  4XPD C;  1ARL A;  3BJ7 A;  5GCN A;  5DUS A;  4OIW A;  1Z5R A;  2PJ8 A;  4ETK A;  5G22 A;  3D68 A;  5CBM A;  1VGY A;  2DEA A;  2XEI A;  2GLJ A;  3D7F A;  1Z4E A;  3LD2 A;  2I00 A;  4OC3 A;  5AG6 A;  2JLM A;  2QEC A;  4YFJ A;  3B3W A;  4MFL A;  4B5P B;  4P4J A;  1MK4 A;  3IWW A;  3LOD A;  4F0Y A;  1NE9 A;  2K5T A;  3KHX A;  2YGW A;  3V8I A;  2B3V A;  2PRB A;  3IWE A;  4MFP A;  5LYI A;  3S6K A;  3WR7 A;  4A32 A;  2AFS A;  2Y0M A;  3EWP A;  2BOA A;  4NSQ A;  3F8K A;  4M85 A;  5KTD A;  4MY0 A;  3VAT A;  3EWQ A;  3RAM A;  1YW4 A;  2XEG A;  2LGR A;  1FNO A;  4UML A;  5F48 A;  4UFV A;  3SJX A;  3QNV A;  4R7M A;  3KI9 A;  4H6Z A;  4NFR A;  1YD9 A;  2FAV A;  4ZY1 A;  3D3S A;  3PB8 X;  4KVX A;  2WYR A;  3L2N A;  4GUA A;  3IU1 A;  2VRI A;  2EK8 A;  4XPD B;  2DPS A;  1LRZ A;  1VHO A;  2ZOF A;  5H84 A;  1TF9 A;  2GRE A;  3Q71 A;  3TTH A;  3FXT A;  3SII A;  2AJ6 A;  1ZLI A;  3IJ3 A;  2GLF A;  4R76 A;  2AFW A;  4UIB A;  3VWD A;  1ZG9 A;  3TO7 A;  4AXV A;  2PJ2 A;  1YGH A;  2PJ5 A;  1IYK A;  3H8F A;  1IIC A;  1QMU A;  2VZZ A;  1TKJ A;  2V8V A;  2YNE A;  2V8D A;  4QB9 A;  4X3R A;  4Y49 C;  3C26 A;  2XEF A;  3PZJ A;  2NSM A;  1I21 A;  2WPW A;  3CXP A;  3IO1 A;  4LQ6 A;  3VWE A;  2BFR A;  3IU2 A;  5HOL A;  1SQH A;  1XMT A;  2OZG A;  2IMO A;  3I1U A;  4M6I A;  4JVV A;  2C6C A;  4U5Y A;  2ATR A;  3BHX A;  1P0H A;  4DJL A;  2WPX A;  4P4B A;  1UWY A;  1YR0 A;  4PXC A;  1TXZ A;  2IL4 A;  5F49 A;  2PVV A;  4H6U A;  3V7Z A;  1KUY A;  2OU2 A;  4MFZ A;  2EWB A;  1Q2Y A;  1ZLH A;  2FIW A;  3K9U A;  4MY3 A;  4NF1 A;  4PXD A;  2GE3 A;  4QC6 A;  4ZI6 A;  3S6H A;  5J8C A;  2NMT A;  4KZT A;  1XIX A;  3T8W A;  3DSB A;  4QUS A;  4MI4 A;  2PR8 A;  5JPH A;  3T90 A;  3DGV A;  4WJB A;  1IYL A;  1TF8 A;  2CY2 A;  3FH4 A;  2ZXV A;  3ETI A;  5AG7 A;  4QVT A;  3FB3 A;  3EFA A;  4JGK A;  2PDO A;  4BMH A;  1IOF A;  1QSR A;  2FG1 A;  2G9D A;  5HVG A;  3FIX A;  4IQY A;  2VBQ A;  4R9M A;  5K8N A;  3SXO A;  5LRK A;  3TFY A;  4R57 A;  1BPM A;  4Y49 B;  4AVC A;  1V0C A;  2VL1 A;  4NCZ A;  4OLL A;  4A95 A;  1YW6 A;  4F8Z A;  1KZF A;  5DS0 A;  4KOR A;  1NSL A;  1ZR3 A;  5F47 A;  2CIJ A;  3VH9 A;  1LAP A;  2JEW A;  4NGN A;  1OBR A;  5AG4 A;  3V2B A;  2ZEH A;  4J5S A;  4KVO E;  4P10 A;  4UFX A;  4YGO A;  3SXN A;  1ON0 A;  2G3T A;  5I0C A;  1XF8 A;  3G3S A;  5AG5 A;  4CGP A;  5HVH A;  2ZEE A;  2D4O A;  4MHY A;  3SIH A;  4ZGY B;  3FF3 A;  4KUA A;  1B6B A;  3IC1 A;  4B11 A;  1HDQ A;  4UEE A;  3SIG A;  5HMN A;  4P4D A;  2C27 A;  2ZW6 A;  3VFQ A;  4UEZ A;  1KWM A;  2ZW7 A;  3KZW A;  2B4D A;  3FVL A;  1VHS A;  4F9U A;  3GY9 A;  2QYV A;  2Q0Y A;  3R96 A;  3B35 A;  2V77 A;  3GPG A;  1Z2L A;  5C82 A;  3TO6 A;  4K0C A;  4MCP A;  2G3A A;  1YVK A;  3D7H A;  3I9S A;  2V8H A;  3ZJ0 A;  1CM0 A;  4KOS A;  4A39 A;  4KUB A;  3B2Y A;  8CPA A;  1CJW A;  1XOV A;  3QB8 A;  3WC7 A;  2PJB A;  1XE4 A;  2ZED A;  2FCK A;  3EO4 A;  1ELL P;  3D7G A;  4M3S A;  4OC1 A;  4PV6 A;  5THW A;  3D67 A;  2J8R A;  2Q7B A;  4CAX A;  4R8F A;  5ELY A;  3PBE A;  1M4G A;  1M44 A;  4YWY A;  3CZX A;  2PJ6 A;  3KAS A;  2BEI A;  4E2A A;  4CAF A;  5LRG A;  4EVY A;  4CAV A;  5LYL A;  3GQE A;  1Y9K A;  3BJ8 A;  3P2H A;  3PBB A;  3FNC A;  2EO8 A;  4XPL A;  3RO0 A;  2P0W A;  4AVA A;  2AFU A;  2DF5 A;  4RS2 A;  2PIY A;  4UIA A;  2QJ8 A;  3EWR A;  2ZEM A;  2I3C A;  3V38 A;  1P4N A;  4M6G A;  1M4I A;  4TWE A;  3TT2 A;  1M4D A;  5IB0 A;  4B13 A;  2F8H A;  2L8R A;  3KKW A;  3WT4 A;  2GFQ A;  4G1P A;  3A9L A;  2FS5 A;  2CNS A;  5E3B A;  1U6M A;  4KLW A;  4NGS A;  3WC5 A;  4ESS A;  1YSJ A;  4WWV A;  1TKF A;  2PR1 A;  1VHE A;  4C7H A;  2Q44 A;  3IWG A;  1DTD A;  4KOU A;  4CGL A;  4J4Z A;  4PXB A;  1IY7 A;  2Q43 A;  1AMP A;  2EBJ A;  4YRH A;  3S9L A;  5D8N A;  1S7N A;  4E0A A;  2ZEG A;  3FYN A;  2ZEF A;  3S9M A;  1R3N A;  2ZEN A;  4P44 A;  2CF4 A;  2DXQ A;  4OP4 A;  4HNW B;  4B10 A;  1Z9U A;  2RFH A;  1QST A;  2VQY A;  1MJ9 A;  3R9G A;  3LMS A;  4LX9 A;  4CGO A;  1Y9W A;  2REF A;  2X7B A;  2EEE A;  3PB4 X;  2EUI A;  4UF4 A;  3EJF A;  1I12 A;  4HKF A;  3IEH A;  3R9E A;  2QML A;  4JWP A;  4F6A A;  4RI1 A;  1BPN A;  5IB9 A;  3BXM A;  3CXS A;  3LAC A;  2AE6 A;  3NH5 A;  3W6X A;  2BCO A;  4R87 A;  1AYE A;  1IB1 E;  2NYQ A;  4MBU A;  4P4F A;  3PRT A;  2BL1 A;  5BWA B;  2POK A;  3MN8 A;  3SIJ A;  3EKE A;  4ABK A;  1BOB A;  4KVM E;  4B12 A;  2YNC C;  5DWM A;  1Y7E A;  3FJU A;  4BD9 A;  2J9A A;  1IGB A;  4OC4 A;  4FWU A;  3Q6Z A;  3BI1 A;  3V45 A;  3FX6 A;  3N7Z A;  4C2Y A;  4FAI A;  2WUU A;  4J5R A;  2CTB A;  2PC1 A;  4CGM A;  3GPO A;  2ZPA A;  4F9V A;  3RYO A;  1LAM A;  4HNX B;  5G1Z A;  2PJ0 A;  1CP7 A;  2PRQ A;  3FRM A;  4Q38 A;  4OAE A;  3S6G A;  4NEX A;  2Q04 A;  4ZY0 A;  1IID A;  2FVG A;  2PIZ A;  3E0K A;  3PGP A;  4UA3 A;  4ETJ A;  3DLJ A;  3CPA A;  4KSF A;  2ZEL A;  2ABZ A;  2VEZ A;  1RXT A;  3QAH A;  2FIA A;  1F57 A;  2B3U A;  2C1C A;  1PCA A;  4NJR A;  4C68 A;  3EW5 A;  1TY8 A;  3D4U A;  2Z0Z A;  4Z65 A;  4PSW A;  3FEE A;  1CX8 A;  1H8L A;  2VI7 A;  4IAV A;  5C88 A;  2FXF A;  3R1K A;  3GUX A;  3K2K A;  2ODF A;  5ISV A;  4UCP A;  3CXQ A;  4PK3 A;  4B5P A;  4C2Z A;  3S9N A;  4KSI A;  2B5G B;  3NA6 A;  4CAE A;  4II9 A;  4HPS A;  4D86 A;  3PEI A;  1SPV A;  2O4H A;  3RZA A;  2WSA A;  1A2Z A;  2Z3O A;  2OB0 A;  4A31 A;  4EFD A;  4ONW A;  4FBE A;  4FD7 A;  4A30 A;  3EJG A;  5CB3 A;  3TE4 A;  2R98 A;  4U9Z A;  3PB7 X;  3BLN A;  4ABL A;  4X8I A;  1IOI A;  3DDD A;  3IFE A;  3TO9 A;  3GKR A;  5D29 A;  3IIF A;  4AG9 A;  2AFZ A;  3FED A;  3GIU A;  4P4E A;  1AUG A;  3H5Z A;  5DWN A;  5K8P A;  2Q4V A;  1QSM A;  1S7L A;  3FBU A;  1M1D A;  4KLV A;  1VKC A;  2D4P A;  2JEV A;  4JZ0 A;  1I1D A;  4OKO A;  3NE8 A;  5HIH A;  2CTC A;  3IGR A;  2A4N A;  4R3L A;  4MFQ A;  5F46 A;  1S60 A;  3PB9 X;  5J1Q A;  2QIR A;  2F7V A;  2GIV A;  1ARM A;  2VZY A;  4R3K A;  5FSU A;  4GS4 A;  4A94 A;  3R95 A;  2BFQ A;  1Z8T A;  4RN7 A;  2QVP A;  4OME A;  3B3V A;  4MFJ A;  1YK3 A;  4KOT A;  1S7K A;  4TU0 A;  2O53 A;  2PJ3 A;  2PJ1 A;  2IQ6 A;  4KYB A;  4MCS A;  3KHZ A;  3TCV A;  1RTQ A;  4MFK A;  3JVN A;  3T9Y A;  4A2Z A;  4XPK A;  2FE7 A;  4LUA A;  3GYA A;  4UEF A;  3SHP A;  5LYF A;  3D66 A;  5AGE A;  1S5K A;  4R6T A;  4AG7 A;  2W2G A;  4CYO A;  4CGN A;  7CPA A;  2PQ8 A;  4JLL A;  2V8G A;  3HLP A;  3I3G A;  4QBJ A;  4E8O A;  1YLO A;  1X12 A;  2ARH A;  3K9T A;  4GM5 A;  4O23 A;  3MGD A;  1CPS A;  1GYT A;  4X5K A;  4W9Y A;  3D7D A;  3MRU A;  2ZOG A;  3N5F A;  4IF5 A;  1ZG8 A;  2Z3M A;  2EK9 A;  2VXK A;  3JUW A;  4PSX A;  4J5Q A;  1KUX A;  3NH8 A;  5CPA A;  5G21 A;  4CRZ B;  1PYT B;  2Q4Y A;  3TOA A;  2YND A;  3JZT A;  5EBV A;  1KUV A;  1ZG7 A;  1Z8L A;  4UWJ A;  2RC4 A;  2Z3N A;  3G8W A;  2CNM A;  1F2O A;  1S7F A;  4RUH A;  4A33 A;  3DR6 A;  4L8A A;  3KGQ A;  5K8O A;  4K30 A;  1NSA A;  3JTK A;  4JXR A;  2PJ9 A;  1PUA A;  2R7H A;  2AFC A;  1YLE A;  4H2K A;  2YNC A;  4OID A;  4JLY A;  3B8G A;  4XNH C;  4UWI A;  1LFW A;  2B5G A;  2HV2 A;  1HJZ A;  2PCU A;  5JGF A;  2Q4Z A;  2PJ4 A;  1CBX A;  3D2P A;  4MCR A;  5LRJ A;  4DYO A;  2JZF A;  4UFW A;  2JBJ A;  1WWZ A;  4Q36 A;  3NE7 A;  4F0X A;  4CAW A;  2PJC A;  2Z3L A;  2P6G A;  4YU9 A;  1XBU A;  2JZE A;  4CYQ A;  1QQ9 A;  5JM6 A;  1F2P A;  2JDD A;  4A38 A;  3KR5 A;  4Q7A A;  4PQA A;  4IUS A;  4A37 A;  2GU2 A;  5HVF A;  1JQG A;  1HEE A;  1XRY A;  2J8M A;  2KCW A;  3TX8 A;  3GPQ A;  4JD6 A;  5A27 A;  6CPA A;  4HNY B;  2Z11 A;  5LYD A;  3PB6 X;  3SI2 A;  4GVW A;  2C6G A;  2C6P A;  4CPA A;  4CYN A;  5I4M A;  1YRE A;  5JQ4 A;  4P45 A;  1BAV A;  4KS9 A;  4C7I A;  4NGQ A;  4UBR A;  3ZZI A;  3CPX A;  3BI0 A;  2RNK A;  1LOK A;  4MHD A;  1ELM P;  3FMC A;  2OH1 A;  5H86 A;  4I49 A;  4P4I A;  2G0B A;  5AIL A;  4OC5 A;  2WCT A;  3IIB A;  4XNH B;  5HH1 A;  5G20 A;  1K4J A;  3RNZ A;  3NH4 A;  4MXU A;  5F09 A;  4CYP A;  1VIX A;  2DPT A;  2OR4 A;  1Q7L A;  1LAN A;  2R8V A;  2PVW A;  2IJZ A;  3LWU A;  4OAD A;  2B4D B;  3GQO A;  2GAN A;  5EMI A;  4L89 A;  1NMT A;  2FXK A;  1RO5 A;  1TXR A;  4PK2 A;  4K3N A;  1QSO A;  1UFH A;  1Z4R A;  1JWQ A;  3R9F A;  2Q7S A;  4JCA A;  1BO4 A;  3RBU A;  4MJ8 A;  2X47 A;  1TKH A;  3CDX A;  2JBK A;  3B3T A;  4MRI A;  3EC4 A;  3VAR A;  1VHU A;  4PPZ A;  2HQY A;  5K8M A;  4NGT A;  2PE3 A;  2HUZ A;  2J8N A;  4B6Z A;  1PU9 A;  2AFX A;  4UCN A;  2DX6 A;  1GHE A;  4P6Y A;  4AB7 A;  1Q2C A;  4KOW A;  1CPX A;  2O28 A;  2H5M A;  1Z8W A;  3IID A;  2XEJ A;  4EWT A;  4LQG A;  4BIN A;  4OC0 A;  1DE4 C;  2JDC A;  5CNP A;  5A28 A;  3ISZ A;  1N71 A;  4JYW A;  3F0A A;  1MJB A;  1XEB A;  2REE A;  3UY5 A;  1QSN A;  2OZU A;  1TIQ A;  3GLJ A;  2CXA A;  3NFZ A;  4PXE A;  5E96 A;  3W91 A;  3TOB A;  3WAB A;  4C2X A;  3ISX A;  1WK4 A;  3CT9 A;  1ZO0 A;  1ZR5 A;  4ZYQ A;  3QAY A;  3H8E A;  3S6F A;  1Y7R A;  3SJG A;  2Z3P A;  3TC8 A;  5IX3 A;  1YVO A;  2FSR A;  3B3S A;  4MHP A;  3SI1 A;  4DNC A;  5HXD A;  2PJ7 A;  4ONU A;  5KTA A;  4GXH A;  2JZD A;  4AVB A;  2ANP A;  1FT7 A;  2B4B A;  2CNT A;  5EC4 A;  4MHZ A;  1R43 A;  1Y0R A;  2FT0 A;  4MMO A;  4OC2 A;  1YQE A;  3SJE A;  5FSZ A;  4KOX A;  5FVJ A;  4NGR A;  1NJR A;  4MCQ A;  1HDU A;  2BO9 A;  1IU8 A;  3KQX A;  1YX0 A;  2PJA A;  4U9Y A;  2KQV A;  1YME A;  4X2T A;  5CMS A;  4B5O A;  4M6H A;  1J4J A;  4EME A;  4J3G A;  2I79 A;  3PFE A;  1Q2D A;  2B58 A;  4IHM A;  1OZP A;  3H4Q A;  4NGM A;  2RB7 A;  2OZH A;  3KL9 A;  4ORF A;  3SJF A;  2EVN A;  2FL4 A;  5IV0 A;  3F5B A;  3EXN A;  1XFO A;  3WC6 A;  3DR8 A;  4NGP A;  1Z8X A;  3D8P A;  3DNS A;  4UCM A;  3JRU A;  4CRY B;  2Z3K A;  1BLL E;  2PSW A;  1CP6 A;  2XD7 A;  1Y0Y A;  4FD6 A;  2P6F A;  4B14 A;  5FSX A;  3B7I A;  3KR4 A;  3D2M A;  1EE3 P;  4BBH A;  4NXY A;  4DUK A;  3H8G A;  3OWC A;  1LCP A;  5CB5 A;  2BUE A;  2HC9 A;  1B87 A;  2Z10 A;  3FEC A;  4FD4 A;  4JJX A;  1FY7 A;  2ZW5 A;  1MJA A;  2BSW A;  5FSV A;  1M4L A;  2AFM A;  1XJO A;  1XMB A;  3P2F A;  4FD5 A;  4MHN A;  4ZBG A;  4ZY2 A;  2P6E A;  3GB0 A;  5JH9 A;  4TNU A;  3SI0 A;  4GVV A;  1X10 A;  3B3C A;  3PP9 A;  3W6S A;  2ZW4 A;  1L0C A;  5FSY A;  1R57 A;  2HB6 A;  2WZN A;  5J8F A;  1CG2 A; 
#chains in the Genus database with same CATH homology
 2ACF A;  4IK2 A;  3PFO A;  2Q51 A;  2ZEP A;  4NJQ A;  4ZX9 A;  2AFO A;  3HUV A;  3EWO A;  2ZEO A;  2OOT A;  3KQZ A;  4ZX8 A;  4FUU A;  1ARL A;  5DUS A;  4OIW A;  1Z5R A;  2PJ8 A;  4ETK A;  3D68 A;  5CBM A;  1VGY A;  2DEA A;  2XEI A;  2GLJ A;  3D7F A;  4OC3 A;  3B3W A;  4P4J A;  3IWW A;  3KHX A;  5LYI A;  2AFS A;  3EWP A;  2BOA A;  3VAT A;  3EWQ A;  3RAM A;  1YW4 A;  2XEG A;  2LGR A;  1FNO A;  4UML A;  3SJX A;  3QNV A;  4R7M A;  3KI9 A;  4NFR A;  1YD9 A;  2FAV A;  4ZY1 A;  3PB8 X;  2WYR A;  3L2N A;  4GUA A;  2VRI A;  2EK8 A;  1VHO A;  2ZOF A;  1TF9 A;  2GRE A;  3Q71 A;  3SII A;  1ZLI A;  3IJ3 A;  2GLF A;  4R76 A;  2AFW A;  4UIB A;  4AXV A;  1ZG9 A;  2PJ2 A;  2PJ5 A;  1QMU A;  3H8F A;  4X3R A;  1TKJ A;  2V8V A;  2V8D A;  2XEF A;  2NSM A;  3IO1 A;  2BFR A;  5HOL A;  2IMO A;  3I1U A;  4JVV A;  2C6C A;  4DJL A;  3BHX A;  4P4B A;  1UWY A;  4PXC A;  1TXZ A;  2PVV A;  3V7Z A;  2EWB A;  1ZLH A;  4PXD A;  4ZI6 A;  3T8W A;  3DGV A;  4WJB A;  1TF8 A;  3FH4 A;  3ETI A;  4JGK A;  2FG1 A;  2G9D A;  5HVG A;  4IQY A;  5K8N A;  5LRK A;  1BPM A;  2VL1 A;  1YW6 A;  4F8Z A;  5DS0 A;  1ZR3 A;  2CIJ A;  3VH9 A;  1LAP A;  2JEW A;  4NGN A;  1OBR A;  3V2B A;  2ZEH A;  4J5S A;  4P10 A;  5HVH A;  2ZEE A;  4MHY A;  3SIH A;  3FF3 A;  3IC1 A;  1HDQ A;  4UEE A;  3SIG A;  4P4D A;  3VFQ A;  4UEZ A;  1KWM A;  3KZW A;  3FVL A;  4F9U A;  2QYV A;  3B35 A;  2V77 A;  3GPG A;  1Z2L A;  4K0C A;  4MCP A;  3D7H A;  2V8H A;  8CPA A;  4A39 A;  3B2Y A;  3WC7 A;  2PJB A;  2ZED A;  4OC1 A;  1ELL P;  3D7G A;  5THW A;  3D67 A;  4R8F A;  5ELY A;  3PBE A;  4YWY A;  2PJ6 A;  3KAS A;  5LRG A;  5LYL A;  3GQE A;  3PBB A;  2AFU A;  4UIA A;  2PIY A;  2QJ8 A;  3EWR A;  2ZEM A;  2I3C A;  3V38 A;  4TWE A;  2F8H A;  2L8R A;  3WT4 A;  4G1P A;  5E3B A;  4NGS A;  3WC5 A;  4ESS A;  1YSJ A;  4WWV A;  1TKF A;  1VHE A;  1DTD A;  4J4Z A;  4PXB A;  1IY7 A;  2Q43 A;  1AMP A;  3S9L A;  5D8N A;  2ZEG A;  2ZEF A;  3S9M A;  1R3N A;  2ZEN A;  4P44 A;  2CF4 A;  4OP4 A;  2RFH A;  3LMS A;  2EEE A;  3PB4 X;  4UF4 A;  3EJF A;  3IEH A;  1BPN A;  5IB9 A;  3BXM A;  3NH5 A;  2BCO A;  1AYE A;  2NYQ A;  4P4F A;  3PRT A;  2POK A;  3MN8 A;  3SIJ A;  3EKE A;  4ABK A;  1Y7E A;  3FJU A;  4BD9 A;  2J9A A;  1IGB A;  4OC4 A;  4FWU A;  3Q6Z A;  3BI1 A;  3V45 A;  3FX6 A;  4FAI A;  4J5R A;  2CTB A;  3GPO A;  4F9V A;  1LAM A;  2PJ0 A;  1CP7 A;  2PRQ A;  4ZY0 A;  2FVG A;  2PIZ A;  4ETJ A;  3DLJ A;  3CPA A;  5HVF A;  2ZEL A;  2ABZ A;  4NJR A;  1F57 A;  2C1C A;  1PCA A;  3EW5 A;  1TY8 A;  3D4U A;  4Z65 A;  3FEE A;  1CX8 A;  1H8L A;  4IAV A;  3GUX A;  3K2K A;  3S9N A;  4KSI A;  3NA6 A;  4D86 A;  3PEI A;  1SPV A;  2O4H A;  3RZA A;  4EFD A;  4ONW A;  4FBE A;  3EJG A;  5CB3 A;  3PB7 X;  4ABL A;  4X8I A;  3IFE A;  5D29 A;  3IIF A;  2AFZ A;  3FED A;  4P4E A;  5K8P A;  4JZ0 A;  4OKO A;  5HIH A;  2CTC A;  3PB9 X;  5J1Q A;  2F7V A;  1ARM A;  5FSU A;  4A94 A;  2BFQ A;  2QVP A;  4OME A;  3B3V A;  4TU0 A;  2O53 A;  2PJ3 A;  2PJ1 A;  2IQ6 A;  4KYB A;  4MCS A;  3KHZ A;  1RTQ A;  4UEF A;  5LYF A;  3D66 A;  4R6T A;  7CPA A;  4JLL A;  2V8G A;  3HLP A;  1YLO A;  3K9T A;  4GM5 A;  4O23 A;  1CPS A;  1GYT A;  4W9Y A;  3D7D A;  3MRU A;  2ZOG A;  3N5F A;  1ZG8 A;  2EK9 A;  4J5Q A;  3NH8 A;  5CPA A;  1PYT B;  3JZT A;  1ZG7 A;  1Z8L A;  1F2O A;  5K8O A;  3KGQ A;  1NSA A;  2PJ9 A;  4OID A;  2AFC A;  4H2K A;  1LFW A;  2PCU A;  1HJZ A;  5JGF A;  2Q4Z A;  2PJ4 A;  1CBX A;  4MCR A;  5LRJ A;  4DYO A;  2JBJ A;  2PJC A;  4YU9 A;  1XBU A;  1QQ9 A;  5JM6 A;  1F2P A;  4A38 A;  3KR5 A;  4Q7A A;  4PQA A;  4A37 A;  2GU2 A;  1JQG A;  1HEE A;  1XRY A;  3TX8 A;  3GPQ A;  6CPA A;  5LYD A;  3SI2 A;  3PB6 X;  4CPA A;  4GVW A;  2C6G A;  2C6P A;  5I4M A;  4P45 A;  1BAV A;  4NGQ A;  3CPX A;  3BI0 A;  1LOK A;  1ELM P;  3FMC A;  4P4I A;  5AIL A;  4OC5 A;  3IIB A;  3NH4 A;  4MXU A;  5F09 A;  1VIX A;  2OR4 A;  1Q7L A;  1LAN A;  2PVW A;  2IJZ A;  3LWU A;  3GQO A;  2FXK A;  1TXR A;  4K3N A;  3RBU A;  4JCA A;  2X47 A;  1TKH A;  3CDX A;  2JBK A;  3B3T A;  4MRI A;  3VAR A;  1VHU A;  4PPZ A;  5K8M A;  4NGT A;  2PE3 A;  4B6Z A;  2AFX A;  2DX6 A;  4P6Y A;  1CPX A;  3IID A;  2XEJ A;  4EWT A;  4LQG A;  4OC0 A;  1DE4 C;  3ISZ A;  4JYW A;  3GLJ A;  3NFZ A;  4PXE A;  3WAB A;  3ISX A;  3CT9 A;  1ZR5 A;  4ZYQ A;  3H8E A;  3SJG A;  3TC8 A;  3B3S A;  3SI1 A;  4MHP A;  5HXD A;  2PJ7 A;  4RUH A;  2ANP A;  1FT7 A;  4MHZ A;  1R43 A;  1Y0R A;  4MMO A;  4OC2 A;  3SJE A;  5FSZ A;  4NGR A;  1NJR A;  4MCQ A;  1HDU A;  2BO9 A;  3KQX A;  2PJA A;  1YME A;  4X2T A;  5CMS A;  4EME A;  3PFE A;  4IHM A;  4NGM A;  2RB7 A;  3KL9 A;  3SJF A;  1XFO A;  3WC6 A;  4NGP A;  3JRU A;  1BLL E;  1CP6 A;  2XD7 A;  1Y0Y A;  5FSX A;  3B7I A;  3KR4 A;  1EE3 P;  4DUK A;  3H8G A;  1LCP A;  5CB5 A;  2HC9 A;  3FEC A;  5FSV A;  1M4L A;  2AFM A;  1XJO A;  1XMB A;  4MHN A;  4ZY2 A;  3GB0 A;  5JH9 A;  4TNU A;  3SI0 A;  4GVV A;  3B3C A;  5FSY A;  2HB6 A;  2WZN A;  1CG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...