4R7MA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
518
structure length
516
Chain Sequence
SEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
total genus 175
structure length 516
sequence length 518
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r7mA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r7mA02
1BLLE 2FG1A 3KGQA 2GU2A 4ZI6A 2V8HA 1DE4C 3V2BA 4PQAA 3B3WA 4FUUA 1ZR3A 1TY8A 2CTCA 4P45A 2C6GA 3IFEA 4UIAA 5IB9A 4J5QA 1BPNA 3SIHA 3RAMA 3V38A 4UMLA 3KI9A 4NGMA 2VRIA 1F2OA 2AFCA 4ZX8A 2F8HA 3VFQA 4TU0A 2ACFA 4OC0A 3NH4A 2I3CA 2CTBA 3H8GA 4PXDA 3ETIA 3SIIA 1TKHA 1CP7A 3VH9A 4J5RA 2NYQA 4P4JA 3FJUA 3RZAA 3PEIA 4ZY0A 3S9LA 2FVGA 5HVFA 2ZEEA 2CF4A 2PJ0A 4B6ZA 3SI0A 4IHMA 3EW5A 3GPOA 4UEEA 4JZ0A 4MHPA 5ELYA 3KQXA 4ZY2A 3MRUA 2XEGA 4F9VA 4P44A 4FBEA 2PVWA 4O23A 3PRTA 3L2NA 4MCRA 3DLJA 3TC8A 1EE3P 1YLOA 4R6TA 3IO1A 4PXCA 3WC6A 2ZENA 5LYFA 2EK8A 3EWOA 3SIGA 1TXRA 2HB6A 3B35A 3WABA 3FEDA 2Q43A 3PBBA 1LFWA 3IWWA 4P10A 3SJXA 4X8IA 3K9TA 3BHXA 1NJRA 4P4EA 4ETKA 3B7IA 2GLFA 2ZOFA 2LGRA 5D29A 1CP6A 4R7MA 4P4FA 3D7HA 3ISXA 3TX8A 2BFQA 2PCUA 2QJ8A 4GM5A 3IIFA 4PXBA 3PB8X 3SI1A 1LAMA 1AMPA 5HVGA 1ZLHA 5FSZA 1YSJA 3ISZA 1TF9A 1HEEA 3SJFA 3WT4A 2HC9A 3JRUA 1F57A 2IMOA 4KSIA 4EFDA 1JQGA 2ZEDA 1ELMP 2PJ6A 2V77A 4D86A 3B3SA 4LQGA 3N5FA 5AILA 3RBUA 4A38A 3KHZA 2EEEA 1ELLP 2F7VA 3PFOA 1VHEA 3EWPA 2XEJA 3LMSA 4ZY1A 4NFRA 2X47A 2BOAA 3BXMA 4A37A 4UEFA 2C1CA 5FSVA 2WZNA 4FWUA 3KASA 1R43A 3LWUA 4NJRA 3EWRA 4X2TA 5DS0A 4RUHA 4X3RA 3D4UA 4OC4A 5JM6A 3KHXA 5CPAA 5D8NA 2PJ3A 4IK2A 4KYBA 1R3NA 1ZG9A 2AFXA 3EKEA 4WJBA 4JLLA 5LRGA 4Z65A 1LANA 2FXKA 6CPAA 4IQYA 3CT9A 2VL1A 2ZEHA 4DJLA 5K8MA 2QYVA 1OBRA 5LRKA 3IC1A 3V45A 3Q6ZA 2ZEFA 4NGQA 3KL9A 2RFHA 4ESSA 1BAVA 1IY7A 8CPAA 3SJEA 3QNVA 1M4LA 2C6CA 2QVPA 3BI1A 4DYOA 5FSYA 2GLJA 1HDQA 2PJ9A 5K8OA 4MHNA 1AYEA 1HJZA 2ANPA 3D66A 1TF8A 1CPSA 4MXUA 1BPMA 4GVVA 1CPXA 2BO9A 5DUSA 3SIJA 3S9NA 1TKFA 3H8EA 1FNOA 4NGRA 1SPVA 4CPAA 1TXZA 4NGNA 4F8ZA 4MRIA 4K0CA 5CB5A 1PYTB 2PJ4A 3B3TA 2AFUA 2PJCA 3IEHA 5F09A 3FX6A 1ZG8A 2AFOA 4OKOA 4OMEA 3V7ZA 4Q7AA 4ZYQA 2EK9A 1IGBA 2V8DA 5JGFA 4P4IA 5CB3A 3B3CA 2V8GA 1Y7EA 3GQEA 4IAVA 3Q71A 5LYLA 1YW6A 3KZWA 5THWA 3I1UA 4GVWA 2AFWA 2PIZA 2DEAA 4PXEA 2NSMA 3D67A 2EWBA 2AFMA 1YMEA 2PVVA 3IIBA 2PJ8A 4W9YA 4ONWA 4UIBA 1ZLIA 4F9UA 3D7FA 2OOTA 3S9MA 3CDXA 1ZR5A 2XD7A 3CPXA 2JBJA 1KWMA 3VATA 1H8LA 4OC5A 1F2PA 4OIWA 3FEEA 1QQ9A 4G1PA 4UF4A 4FAIA 3KR5A 3PB4X 1CG2A 2OR4A 3K2KA 3T8WA 4JGKA 2Q4ZA 5J1QA 2IJZA 3CPAA 3GLJA 4MMOA 2PJ7A 5E3BA 3EJGA 2IQ6A 4TNUA 3VARA 1TKJA 4MHZA 4EMEA 2FAVA 2ZEOA 4WWVA 3BI0A 2JEWA 2PJ1A 4ABLA 1YD9A 3D7GA 3GPQA 3IJ3A 4EWTA 1HDUA 1VGYA 3DGVA 4OP4A 2AFSA 1Z2LA 2PE3A 2ZEMA 5K8NA 4ABKA 2BCOA 3PB7X 2C6PA 2XEFA 1LOKA 3IIDA 3KR4A 5CMSA 4MCSA 4MCPA 4J5SA 4OC3A 5FSUA 5LYDA 4UEZA 3FVLA 4OIDA 1RTQA 1Y0YA 2BFRA 1YW4A 1FT7A 3SJGA 2PJ2A 2JBKA 2WYRA 4PPZA 4OC1A 4A39A 4ZX9A 3PB6X 2RB7A 1LAPA 1XBUA 1XMBA 3B2YA 3MN8A 4JCAA 4NGSA 2J9AA 4YU9A 5FSXA 1Z5RA 5LRJA 5I4MA 1VHUA 4P4BA 2AFZA 1ARLA 3NH8A 3HLPA 1PCAA 2DX6A 5HVHA 4MCQA 1Y0RA 2ABZA 3FH4A 3GPGA 1XRYA 3NH5A 3D7DA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 4J4ZA 7CPAA 1GYTA 2Q51A 4DUKA 3EJFA 4AXVA 2XEIA 4NGPA 3SI2A 3WC7A 2PIYA 4R76A 3B3VA 2O4HA 4JVVA 4H2KA 5CBMA 4JYWA 4P6YA 1VHOA 1CBXA 3PB9X 2ZELA 4R8FA 5HIHA 4TWEA 4YWYA 2PJ5A 3FMCA 3GQOA 4GUAA 1XFOA 2ZEPA 3JZTA 4NJQA 2O53A 5HXDA 1ARMA 2CIJA 5K8PA 2GREA 3D68A 1NSAA 4BD9A 2PRQA 1ZG7A 1QMUA 1UWYA 1Z8LA 4MHYA 3FF3A 2L8RA 2PJBA 3HUVA 5JH9A 3NA6A 3WC5A 4NGTA 4ETJA 3KQZA 4K3NA 2POKA 4OC2A 1CX8A 3PFEA 1VIXA 3GB0A 3PBEA 3GUXA 3EWQA 3NFZA 2ZOGA 3FECA 2V8VA 1XJOA 2ZEGA 2PJAA 5HOLA 2G9DA 1LCPA 4P4DA
chains in the Genus database with same CATH superfamily
1BLLE 2FG1A 3D2MA 1Z9UA 3CXQA 3FRMA 3KGQA 2GU2A 4ZI6A 2V8HA 1DE4C 4JWPA 3V2BA 3UY5A 2W2GA 1XE4A 4PQAA 3H5ZA 3B3WA 4KOSA 4M6HA 3T90A 4JXQA 4FUUA 1ZR3A 1TY8A 4KOWA 2CTCA 3G8WA 4P45A 2C6GA 2WUUA 3IFEA 4UIAA 5IB9A 4H6UA 3CXSA 4J5QA 1BPNA 3SIHA 2FIWA 3RAMA 4JLYA 5J8FA 3V38A 4UMLA 3BJ7A 2PC1A 3KI9A 3PZJA 4B5OA 2ZW7A 4FD7A 4HNXB 2D4PA 4NGMA 2VRIA 1F2OA 3A9LA 2AFCA 4ZX8A 2F8HA 3VFQA 4TU0A 2ACFA 1YVKA 3NE7A 4FD6A 4PSWA 4OC0A 4YRHA 4F0XA 5FVJA 2CNTA 4AVAA 3DNSA 3NH4A 4NCZA 5IV0A 3QAHA 2I3CA 2CTBA 4UFXA 3V8IA 3H8GA 4PXDA 4CGNA 3ETIA 4KLWA 3SIIA 3EY5A 1TKHA 3S6HA 2K5TA 1CP7A 3TO6A 4CAVA 4NXYA 3S6KA 1A2ZA 1MJ9A 4UCMA 3VH9A 3CXPA 4FD5A 2ATRA 3IGRA 2PQ8A 1YVOA 1Z4EA 4J5RA 1X10A 2NYQA 4KVXA 2ZPAA 4P4JA 1YQEA 2BL1A 3FJUA 3RZAA 1QSNA 3PEIA 4ZY0A 2B4DA 2Z3MA 3TO7A 4R57A 2ODFA 1YLEA 3S9LA 2FVGA 4AG9A 5HVFA 2ZEEA 3R1KA 2CF4A 2PJ0A 4Y49C 4B6ZA 2OU2A 3SI0A 4IHMA 3EW5A 3GPOA 4MJ8A 1ON0A 4UEEA 5F46A 4KOTA 2KCWA 3VWEA 4JZ0A 3E0KA 2J8MA 4MHPA 3FXTA 5ELYA 3KQXA 2Q44A 5JQ4A 4ZY2A 3MRUA 1XEBA 2XEGA 4F9VA 4P44A 4FBEA 4A95A 3SXOA 2PVWA 4O23A 4B14A 3FB3A 3FYNA 3IU1A 4M6IA 1X12A 3PRTA 3L2NA 4MCRA 4QB9A 3EFAA 3DLJA 4C2XA 3TC8A 1EE3P 1YLOA 3FNCA 4R6TA 3IO1A 4PXCA 3WC6A 4B11A 2ZENA 1S7LA 5G21A 1IU8A 4IF5A 5LYFA 2EK8A 3EWOA 1Z4RA 3SIGA 5AG6A 5EMIA 1TXRA 2HB6A 5GCNA 3B35A 3WABA 3FEDA 1KZFA 3GY9A 2O28A 2Q43A 3PBBA 1LFWA 3IWWA 4QVTA 4P10A 3SJXA 1M44A 3EC4A 4X8IA 2QECA 5CNPA 3K9TA 1YX0A 4KSAA 3BHXA 2YNEA 1NJRA 4P4EA 3R96A 2Z11A 1I12A 4QUSA 4ETKA 1QSTA 3B7IA 2GLFA 2CNMA 2LGRA 2I79A 2ZOFA 5D29A 1CP6A 4R7MA 2BSWA 2BUEA 2J8RA 4FD4A 4MHDA 3IWEA 3D7HA 4P4FA 5KTCA 3ISXA 3TX8A 2BFQA 2PCUA 3TO9A 1IOFA 2QJ8A 4JXRA 4GM5A 4E2AA 3IIFA 2DXQA 3I9SA 4PSXA 4GXHA 3PB8X 4PXBA 4C7IA 3SI1A 1LAMA 1AMPA 1P4NA 5HVGA 1ZLHA 4UWIA 4Q38A 5FSZA 1NE9A 1Q2DA 1TF9A 1HEEA 1YSJA 3ISZA 3SJFA 2IL4A 2HC9A 3WT4A 4HNYB 2PSWA 3IWGA 2EBJA 3JRUA 1F57A 2Q0YA 2IMOA 3P2FA 2B3VA 4KSIA 4EFDA 1YR0A 2P6GA 1JQGA 2ZEDA 1ELMP 2PJ6A 2R98A 2V77A 4D86A 3B3SA 4HNWB 3LACA 1S7NA 4LQGA 3N5FA 4R3LA 4U9ZA 5AILA 3RBUA 4A38A 3KHZA 1BOBA 2EEEA 1CM0A 2CY2A 1ELLP 2F7VA 3PFOA 1CJWA 1VHEA 2WPWA 3W6XA 3EWPA 2XEJA 3I3GA 4XPLA 2B5GB 4ZY1A 3LMSA 4NFRA 2X47A 2BOAA 3BXMA 4NSQA 2YNCC 4UEFA 2C1CA 3F5BA 5F47A 5FSVA 2WZNA 4FWUA 2Q7BA 4AB7A 3KASA 1R43A 1MJAA 1WK4A 3LWUA 4NJRA 1U6MA 2GFQA 3EWRA 2OZGA 2WCTA 4X2TA 5DS0A 4B12A 4BMHA 4RUHA 4X3RA 3D4UA 4OC4A 1K4JA 2FCKA 3KHXA 4QC6A 1Q2YA 5CPAA 4MY0A 5D8NA 2PJ3A 4YGOA 4II9A 4IK2A 4RI1A 4KYBA 4L8AA 4B5PA 1R3NA 1IIDA 3KKWA 1ZG9A 4NEXA 3D2PA 4R9MA 2AFXA 4C2YA 4CYPA 2Y0MA 3EKEA 5H84A 4WJBA 4JLLA 5LRGA 4BBHA 4Z65A 1LANA 2FXKA 6CPAA 4IQYA 4JJXA 4YFJA 1IICA 5ISVA 3CT9A 2VL1A 4ZGYB 3R9EA 2ZEHA 2JDDA 4DJLA 5K8MA 2QYVA 1OBRA 5LRKA 1B87A 3IC1A 1IYKA 3V45A 2G3AA 2ARHA 3Q6ZA 4A32A 2ZEFA 2ZXVA 2FXFA 4M3SA 4NGQA 3KL9A 2RFHA 4ESSA 1BAVA 1TIQA 1XIXA 1IY7A 1IYLA 3TTHA 8CPAA 3SJEA 3QNVA 1M4LA 2Z3LA 2C6CA 2QVPA 1YK3A 3LD2A 1S5KA 4R87A 3SXNA 3BI1A 2VI7A 4J3GA 4KVME 4DYOA 4UA3A 5FSYA 4CYQA 2GLJA 1HDQA 2PJ9A 4Q36A 5K8OA 1XF8A 4MHNA 4ONUA 4CYNA 1AYEA 3GKRA 1HJZA 2REEA 4CGLA 2ANPA 3D66A 4KORA 2JZEA 1TF8A 1CPSA 4MXUA 1BPMA 4GVVA 1CPXA 1KUYA 2BO9A 3PP9A 2Q7SA 5DUSA 4UWJA 3SIJA 2VEZA 4MI4A 3S9NA 1TKFA 2B5GA 3D8PA 4E8OA 5JM6A 3B8GA 3K9UA 3H8EA 1FNOA 1WWZA 2EVNA 2HQYA 4NGRA 1SPVA 4PK2A 4XNHB 2PR8A 4CPAA 2B3UA 2EO8A 2YGWA 1TXZA 2VXKA 1QSMA 4NGNA 4F8ZA 1Y9KA 4MRIA 4K0CA 2PRBA 5CB5A 1PYTB 2PJ4A 3B3TA 2FE7A 2CNSA 3DDDA 2AFUA 2FT0A 2PJCA 3IEHA 4B5PB 3FX6A 1ZG8A 4X5KA 1S3ZA 2QMLA 5F09A 3DR8A 2AFOA 1FY7A 4OKOA 4AVCA 4OMEA 3V7ZA 4Q7AA 4ZYQA 2FS5A 2EK9A 1IGBA 2V8DA 2Q4VA 3BJ8A 3T9YA 2ZW6A 5JGFA 4P4IA 5CB3A 3B3CA 2V8GA 1Y7EA 3GQEA 4IAVA 4UFWA 3Q71A 3OWCA 4B13A 5LYLA 3JVNA 3W6SA 1YW6A 3KZWA 2D4OA 2R8VA 4DNCA 1OZPA 4H89A 5AG4A 2AJ6A 5THWA 2WSAA 3I1UA 4GVWA 5DWNA 2AFWA 2GANA 2PIZA 2RC4A 5J8CA 2JZDA 2H5MA 4CGOA 1AUGA 2JEVA 2Z10A 1KUXA 1N71A 2NMTA 2RNKA 2DEAA 2YNDA 2GIVA 2G0BA 1S7FA 2NSMA 3D67A 1Z8WA 4PXEA 2EWBA 1YREA 2A4NA 1YMEA 2AFMA 2PVVA 4AVBA 5A27A 3IIBA 2PJ8A 4W9YA 1PU9A 1B6BA 4KSFA 4CAWA 1LRZA 4ONWA 4UIBA 5EBVA 3GIUA 2REFA 3TOBA 1GHEA 1ZLIA 2J8NA 4F9UA 3D7FA 2OOTA 4E0AA 1QSRA 2B4DB 2HUZA 1ZR5A 2XD7A 1QSOA 3CDXA 2JBJA 3CPXA 1KWMA 4OAEA 3VATA 1P0HA 1H8LA 4PK3A 3C26A 1VHSA 3MGDA 3R9GA 2JZFA 3TE4A 4OC5A 1F2PA 4MY3A 3FEEA 4OIWA 1QQ9A 3GYAA 4KLVA 2BEIA 4G1PA 5BWAB 4UF4A 4FAIA 2I00A 4KOUA 3KR5A 3PB4X 4CAEA 1CG2A 2OR4A 3EXNA 3K2KA 4KUBA 4A31A 5AG5A 3T8WA 2JLMA 3ZJ0A 4JGKA 2Q4ZA 3JTKA 4H6ZA 5AGEA 5J1QA 2IJZA 1IB1E 3CPAA 3GLJA 2OZUA 4NF1A 2B58A 4MMOA 4QBJA 2AE6A 2PJ7A 5EC4A 4KOYA 1Q2CA 5E3BA 1UFHA 3EJGA 4CAFA 1S60A 2P6EA 2IQ6A 2R1IA 4TNUA 4UBRA 3VARA 3JUWA 4UCNA 4UFVA 1TKJA 3D3SA 3QAYA 5DWMA 4A30A 4MHZA 2OB0A 4U9YA 4XPDB 4B10A 4EMEA 2FAVA 2VZZA 2R7HA 2ZEOA 3IU2A 1PUAA 2C27A 4OLLA 3BI0A 4WWVA 1RO5A 5AG7A 2JEWA 3SHPA 2PJ1A 4F0YA 4ABLA 1YD9A 4M6GA 3D7GA 4C2ZA 4XPDC 5KTAA 5KTDA 3GPQA 3IJ3A 4EWTA 1HDUA 1VGYA 2JDCA 3DGVA 2ZW5A 2B4BA 3ZZIA 4C68A 4MBUA 4OP4A 5C82A 2AFSA 1Z2LA 3DR6A 2PE3A 4EVYA 5HMNA 1SQHA 1I1DA 2ZEMA 5K8NA 4ABKA 2BCOA 3H4QA 3PB7X 4LQ6A 2C6PA 5E96A 2XEFA 3N7ZA 1LOKA 4JD6A 4BINA 3IIDA 3KR4A 2ZW4A 5CMSA 4MCSA 4UCPA 4MCPA 4MFJA 4KUAA 4XNHC 4J5SA 4KOVA 4OC3A 5FSUA 5LYDA 2F5IA 2FIAA 4UEZA 3FVLA 4OIDA 1RTQA 2VZYA 2Q04A 3QB8A 1Y0YA 3FBUA 2BFRA 1YW4A 1FT7A 3BLNA 3SJGA 4PV6A 2PJ2A 2VQYA 2JBKA 2WYRA 4CRZB 4HPSA 1I21A 4PPZA 3WR7A 1M4DA 4OC1A 4A39A 4ZX9A 1BO4A 3PB6X 2RB7A 4KZTA 4CYOA 1LAPA 2KQVA 2FL4A 1XBUA 1Y9WA 1XMBA 3B2YA 3MN8A 4MFKA 4XPKA 4JCAA 5F48A 3RYOA 4NGSA 3DSBA 2J9AA 4YU9A 5FSXA 5JPHA 1Z5RA 4LX9A 4A33A 5LRJA 4CRYB 3R9FA 3S6GA 5I4MA 1VHUA 4P4BA 5C88A 2AFZA 1ARLA 4AG7A 2G3TA 3NH8A 4L89A 4MFZA 4OADA 3PGPA 1NSLA 3HLPA 2Z3KA 1PCAA 2DX6A 5HVHA 1Y7RA 1M4GA 1Y0RA 2ABZA 4MCQA 3S9MA 2DPTA 3GPGA 3FH4A 4GS4A 4KS9A 5H86A 1XRYA 3TOAA 3NH5A 2FSRA 2P6FA 2YNCA 3F8KA 3D7DA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 5IB0A 1ZO0A 4J4ZA 7CPAA 1GYTA 1L0CA 1Z8XA 1S7KA 2QIRA 3W91A 5G22A 2Q51A 4DUKA 4MFLA 3EJFA 4HKFA 1M4IA 2EUIA 4KVOE 4AXVA 2XEIA 4ORFA 2DPSA 4CGMA 1IOIA 1V0CA 4NGPA 3SI2A 3CZXA 3WC7A 2PIYA 2Q4YA 4CS0B 4R76A 2P0WA 2PDOA 3B3VA 2GE3A 4RN7A 3NE8A 4CGPA 2O4HA 4JVVA 4H2KA 5CBMA 3TT2A 4JYWA 1JWQA 5I0CA 4P6YA 1VHOA 1CBXA 3G3SA 3PB9X 4CAXA 3F0AA 2ZELA 1MJBA 1YGHA 4U5YA 4R8FA 2CXAA 5G20A 3TCVA 5HIHA 3FIXA 4TWEA 4A2ZA 4YWYA 1KUVA 2PJ5A 2Z3PA 3FMCA 3GQOA 1NMTA 2OZHA 4GUAA 1XFOA 3P2HA 4IUSA 4K30A 5HH1A 4A37A 5F49A 2ZEPA 2DF5A 4RS2A 3TFYA 1Z8TA 3JZTA 4ZBGA 2VBQA 1R57A 4NJQA 2O53A 3RO0A 5HXDA 1ARMA 1VKCA 2CIJA 3VWDA 5K8PA 2GREA 3D68A 4MFQA 4Y49B 1NSAA 3R95A 4BD9A 2PRQA 2Z3NA 1ZG7A 4F6AA 4MFPA 1QMUA 1UWYA 1Z8LA 4MHYA 2PR1A 3FF3A 2L8RA 2OH1A 2PJBA 3HUVA 5JH9A 5G1ZA 3NA6A 3WC5A 2Z0ZA 2X7BA 4NGTA 4ETJA 4LUAA 3KQZA 4K3NA 1XOVA 4R3KA 3S6FA 2POKA 4OC2A 1J4JA 1CX8A 3PFEA 1RXTA 4C7HA 1VIXA 1MK4A 3GB0A 4M85A 3PBEA 5A28A 3RNZA 2Z3OA 3EWQA 3GUXA 3LODA 2HV2A 2ZOGA 3FECA 3NFZA 1M1DA 4KOXA 2V8VA 1XJOA 2ZEGA 2PJAA 2WPXA 5HOLA 3EO4A 2G9DA 1LCPA 4I49A 1XMTA 5IX3A 4P4DA
chains in the Genus database with same CATH topology
1BLLE 2FG1A 3KGQA 2GU2A 4ZI6A 2V8HA 1DE4C 3V2BA 4PQAA 3B3WA 4FUUA 1ZR3A 1TY8A 2CTCA 4P45A 2C6GA 3IFEA 4UIAA 5IB9A 4J5QA 1BPNA 3SIHA 3RAMA 3V38A 4UMLA 3KI9A 4NGMA 2VRIA 1F2OA 2AFCA 4ZX8A 2F8HA 3VFQA 4TU0A 2ACFA 4OC0A 3NH4A 2I3CA 2CTBA 3H8GA 4PXDA 3ETIA 3SIIA 1TKHA 1CP7A 3VH9A 4J5RA 2NYQA 4P4JA 3FJUA 3RZAA 3PEIA 4ZY0A 3S9LA 2FVGA 5HVFA 2ZEEA 2CF4A 2PJ0A 4B6ZA 3SI0A 4IHMA 3EW5A 3GPOA 4UEEA 4JZ0A 4MHPA 5ELYA 3KQXA 4ZY2A 3MRUA 2XEGA 4F9VA 4P44A 4FBEA 2PVWA 4O23A 3PRTA 3L2NA 4MCRA 3DLJA 3TC8A 1EE3P 1YLOA 4R6TA 3IO1A 4PXCA 3WC6A 2ZENA 5LYFA 2EK8A 3EWOA 3SIGA 1TXRA 2HB6A 3B35A 3WABA 3FEDA 2Q43A 3PBBA 1LFWA 3IWWA 4P10A 3SJXA 4X8IA 3K9TA 3BHXA 1NJRA 4P4EA 4ETKA 3B7IA 2GLFA 2ZOFA 2LGRA 5D29A 1CP6A 4R7MA 4P4FA 3D7HA 3ISXA 3TX8A 2BFQA 2PCUA 2QJ8A 4GM5A 3IIFA 4PXBA 3PB8X 3SI1A 1LAMA 1AMPA 5HVGA 1ZLHA 5FSZA 1YSJA 3ISZA 1TF9A 1HEEA 3SJFA 3WT4A 2HC9A 3JRUA 1F57A 2IMOA 4KSIA 4EFDA 1JQGA 2ZEDA 1ELMP 2PJ6A 2V77A 4D86A 3B3SA 4LQGA 3N5FA 5AILA 3RBUA 4A38A 3KHZA 2EEEA 1ELLP 2F7VA 3PFOA 1VHEA 3EWPA 2XEJA 3LMSA 4ZY1A 4NFRA 2X47A 2BOAA 3BXMA 4A37A 4UEFA 2C1CA 5FSVA 2WZNA 4FWUA 3KASA 1R43A 3LWUA 4NJRA 3EWRA 4X2TA 5DS0A 4RUHA 4X3RA 3D4UA 4OC4A 5JM6A 3KHXA 5CPAA 5D8NA 2PJ3A 4IK2A 4KYBA 1R3NA 1ZG9A 2AFXA 3EKEA 4WJBA 4JLLA 5LRGA 4Z65A 1LANA 2FXKA 6CPAA 4IQYA 3CT9A 2VL1A 2ZEHA 4DJLA 5K8MA 2QYVA 1OBRA 5LRKA 3IC1A 3V45A 3Q6ZA 2ZEFA 4NGQA 3KL9A 2RFHA 4ESSA 1BAVA 1IY7A 8CPAA 3SJEA 3QNVA 1M4LA 2C6CA 2QVPA 3BI1A 4DYOA 5FSYA 2GLJA 1HDQA 2PJ9A 5K8OA 4MHNA 1AYEA 1HJZA 2ANPA 3D66A 1TF8A 1CPSA 4MXUA 1BPMA 4GVVA 1CPXA 2BO9A 5DUSA 3SIJA 3S9NA 1TKFA 3H8EA 1FNOA 4NGRA 1SPVA 4CPAA 1TXZA 4NGNA 4F8ZA 4MRIA 4K0CA 5CB5A 1PYTB 2PJ4A 3B3TA 2AFUA 2PJCA 3IEHA 5F09A 3FX6A 1ZG8A 2AFOA 4OKOA 4OMEA 3V7ZA 4Q7AA 4ZYQA 2EK9A 1IGBA 2V8DA 5JGFA 4P4IA 5CB3A 3B3CA 2V8GA 1Y7EA 3GQEA 4IAVA 3Q71A 5LYLA 1YW6A 3KZWA 5THWA 3I1UA 4GVWA 2AFWA 2PIZA 2DEAA 4PXEA 2NSMA 3D67A 2EWBA 2AFMA 1YMEA 2PVVA 3IIBA 2PJ8A 4W9YA 4ONWA 4UIBA 1ZLIA 4F9UA 3D7FA 2OOTA 3S9MA 3CDXA 1ZR5A 2XD7A 3CPXA 2JBJA 1KWMA 3VATA 1H8LA 4OC5A 1F2PA 4OIWA 3FEEA 1QQ9A 4G1PA 4UF4A 4FAIA 3KR5A 3PB4X 1CG2A 2OR4A 3K2KA 3T8WA 4JGKA 2Q4ZA 5J1QA 2IJZA 3CPAA 3GLJA 4MMOA 2PJ7A 5E3BA 3EJGA 2IQ6A 4TNUA 3VARA 1TKJA 4MHZA 4EMEA 2FAVA 2ZEOA 4WWVA 3BI0A 2JEWA 2PJ1A 4ABLA 1YD9A 3D7GA 3GPQA 3IJ3A 4EWTA 1HDUA 1VGYA 3DGVA 4OP4A 2AFSA 1Z2LA 2PE3A 2ZEMA 5K8NA 4ABKA 2BCOA 3PB7X 2C6PA 2XEFA 1LOKA 3IIDA 3KR4A 5CMSA 4MCSA 4MCPA 4J5SA 4OC3A 5FSUA 5LYDA 4UEZA 3FVLA 4OIDA 1RTQA 1Y0YA 2BFRA 1YW4A 1FT7A 3SJGA 2PJ2A 2JBKA 2WYRA 4PPZA 4OC1A 4A39A 4ZX9A 3PB6X 2RB7A 1LAPA 1XBUA 1XMBA 3B2YA 3MN8A 4JCAA 4NGSA 2J9AA 4YU9A 5FSXA 1Z5RA 5LRJA 5I4MA 1VHUA 4P4BA 2AFZA 1ARLA 3NH8A 3HLPA 1PCAA 2DX6A 5HVHA 4MCQA 1Y0RA 2ABZA 3FH4A 3GPGA 1XRYA 3NH5A 3D7DA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 4J4ZA 7CPAA 1GYTA 2Q51A 4DUKA 3EJFA 4AXVA 2XEIA 4NGPA 3SI2A 3WC7A 2PIYA 4R76A 3B3VA 2O4HA 4JVVA 4H2KA 5CBMA 4JYWA 4P6YA 1VHOA 1CBXA 3PB9X 2ZELA 4R8FA 5HIHA 4TWEA 4YWYA 2PJ5A 3FMCA 3GQOA 4GUAA 1XFOA 2ZEPA 3JZTA 4NJQA 2O53A 5HXDA 1ARMA 2CIJA 5K8PA 2GREA 3D68A 1NSAA 4BD9A 2PRQA 1ZG7A 1QMUA 1UWYA 1Z8LA 4MHYA 3FF3A 2L8RA 2PJBA 3HUVA 5JH9A 3NA6A 3WC5A 4NGTA 4ETJA 3KQZA 4K3NA 2POKA 4OC2A 1CX8A 3PFEA 1VIXA 3GB0A 3PBEA 3GUXA 3EWQA 3NFZA 2ZOGA 3FECA 2V8VA 1XJOA 2ZEGA 2PJAA 5HOLA 2G9DA 1LCPA 4P4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  2FG1 A;  3KGQ A;  2GU2 A;  4ZI6 A;  2V8H A;  1DE4 C;  3V2B A;  4PQA A;  3B3W A;  4FUU A;  1ZR3 A;  1TY8 A;  2CTC A;  4P45 A;  2C6G A;  3IFE A;  4UIA A;  5IB9 A;  4J5Q A;  1BPN A;  3SIH A;  3RAM A;  3V38 A;  4UML A;  3KI9 A;  4NGM A;  2VRI A;  1F2O A;  2AFC A;  4ZX8 A;  2F8H A;  3VFQ A;  4TU0 A;  2ACF A;  4OC0 A;  3NH4 A;  2I3C A;  2CTB A;  3H8G A;  4PXD A;  3ETI A;  3SII A;  1TKH A;  1CP7 A;  3VH9 A;  4J5R A;  2NYQ A;  4P4J A;  3FJU A;  3RZA A;  3PEI A;  4ZY0 A;  3S9L A;  2FVG A;  5HVF A;  2ZEE A;  2CF4 A;  2PJ0 A;  4B6Z A;  3SI0 A;  4IHM A;  3EW5 A;  3GPO A;  4UEE A;  4JZ0 A;  4MHP A;  5ELY A;  3KQX A;  4ZY2 A;  3MRU A;  2XEG A;  4F9V A;  4P44 A;  4FBE A;  2PVW A;  4O23 A;  3PRT A;  3L2N A;  4MCR A;  3DLJ A;  3TC8 A;  1EE3 P;  1YLO A;  4R6T A;  3IO1 A;  4PXC A;  3WC6 A;  2ZEN A;  5LYF A;  2EK8 A;  3EWO A;  3SIG A;  1TXR A;  2HB6 A;  3B35 A;  3WAB A;  3FED A;  2Q43 A;  3PBB A;  1LFW A;  3IWW A;  4P10 A;  3SJX A;  4X8I A;  3K9T A;  3BHX A;  1NJR A;  4P4E A;  4ETK A;  3B7I A;  2GLF A;  2ZOF A;  2LGR A;  5D29 A;  1CP6 A;  4R7M A;  4P4F A;  3D7H A;  3ISX A;  3TX8 A;  2BFQ A;  2PCU A;  2QJ8 A;  4GM5 A;  3IIF A;  4PXB A;  3PB8 X;  3SI1 A;  1LAM A;  1AMP A;  5HVG A;  1ZLH A;  5FSZ A;  1YSJ A;  3ISZ A;  1TF9 A;  1HEE A;  3SJF A;  3WT4 A;  2HC9 A;  3JRU A;  1F57 A;  2IMO A;  4KSI A;  4EFD A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2V77 A;  4D86 A;  3B3S A;  4LQG A;  3N5F A;  5AIL A;  3RBU A;  4A38 A;  3KHZ A;  2EEE A;  1ELL P;  2F7V A;  3PFO A;  1VHE A;  3EWP A;  2XEJ A;  3LMS A;  4ZY1 A;  4NFR A;  2X47 A;  2BOA A;  3BXM A;  4A37 A;  4UEF A;  2C1C A;  5FSV A;  2WZN A;  4FWU A;  3KAS A;  1R43 A;  3LWU A;  4NJR A;  3EWR A;  4X2T A;  5DS0 A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  5JM6 A;  3KHX A;  5CPA A;  5D8N A;  2PJ3 A;  4IK2 A;  4KYB A;  1R3N A;  1ZG9 A;  2AFX A;  3EKE A;  4WJB A;  4JLL A;  5LRG A;  4Z65 A;  1LAN A;  2FXK A;  6CPA A;  4IQY A;  3CT9 A;  2VL1 A;  2ZEH A;  4DJL A;  5K8M A;  2QYV A;  1OBR A;  5LRK A;  3IC1 A;  3V45 A;  3Q6Z A;  2ZEF A;  4NGQ A;  3KL9 A;  2RFH A;  4ESS A;  1BAV A;  1IY7 A;  8CPA A;  3SJE A;  3QNV A;  1M4L A;  2C6C A;  2QVP A;  3BI1 A;  4DYO A;  5FSY A;  2GLJ A;  1HDQ A;  2PJ9 A;  5K8O A;  4MHN A;  1AYE A;  1HJZ A;  2ANP A;  3D66 A;  1TF8 A;  1CPS A;  4MXU A;  1BPM A;  4GVV A;  1CPX A;  2BO9 A;  5DUS A;  3SIJ A;  3S9N A;  1TKF A;  3H8E A;  1FNO A;  4NGR A;  1SPV A;  4CPA A;  1TXZ A;  4NGN A;  4F8Z A;  4MRI A;  4K0C A;  5CB5 A;  1PYT B;  2PJ4 A;  3B3T A;  2AFU A;  2PJC A;  3IEH A;  5F09 A;  3FX6 A;  1ZG8 A;  2AFO A;  4OKO A;  4OME A;  3V7Z A;  4Q7A A;  4ZYQ A;  2EK9 A;  1IGB A;  2V8D A;  5JGF A;  4P4I A;  5CB3 A;  3B3C A;  2V8G A;  1Y7E A;  3GQE A;  4IAV A;  3Q71 A;  5LYL A;  1YW6 A;  3KZW A;  5THW A;  3I1U A;  4GVW A;  2AFW A;  2PIZ A;  2DEA A;  4PXE A;  2NSM A;  3D67 A;  2EWB A;  2AFM A;  1YME A;  2PVV A;  3IIB A;  2PJ8 A;  4W9Y A;  4ONW A;  4UIB A;  1ZLI A;  4F9U A;  3D7F A;  2OOT A;  3S9M A;  3CDX A;  1ZR5 A;  2XD7 A;  3CPX A;  2JBJ A;  1KWM A;  3VAT A;  1H8L A;  4OC5 A;  1F2P A;  4OIW A;  3FEE A;  1QQ9 A;  4G1P A;  4UF4 A;  4FAI A;  3KR5 A;  3PB4 X;  1CG2 A;  2OR4 A;  3K2K A;  3T8W A;  4JGK A;  2Q4Z A;  5J1Q A;  2IJZ A;  3CPA A;  3GLJ A;  4MMO A;  2PJ7 A;  5E3B A;  3EJG A;  2IQ6 A;  4TNU A;  3VAR A;  1TKJ A;  4MHZ A;  4EME A;  2FAV A;  2ZEO A;  4WWV A;  3BI0 A;  2JEW A;  2PJ1 A;  4ABL A;  1YD9 A;  3D7G A;  3GPQ A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  3DGV A;  4OP4 A;  2AFS A;  1Z2L A;  2PE3 A;  2ZEM A;  5K8N A;  4ABK A;  2BCO A;  3PB7 X;  2C6P A;  2XEF A;  1LOK A;  3IID A;  3KR4 A;  5CMS A;  4MCS A;  4MCP A;  4J5S A;  4OC3 A;  5FSU A;  5LYD A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  1Y0Y A;  2BFR A;  1YW4 A;  1FT7 A;  3SJG A;  2PJ2 A;  2JBK A;  2WYR A;  4PPZ A;  4OC1 A;  4A39 A;  4ZX9 A;  3PB6 X;  2RB7 A;  1LAP A;  1XBU A;  1XMB A;  3B2Y A;  3MN8 A;  4JCA A;  4NGS A;  2J9A A;  4YU9 A;  5FSX A;  1Z5R A;  5LRJ A;  5I4M A;  1VHU A;  4P4B A;  2AFZ A;  1ARL A;  3NH8 A;  3HLP A;  1PCA A;  2DX6 A;  5HVH A;  4MCQ A;  1Y0R A;  2ABZ A;  3FH4 A;  3GPG A;  1XRY A;  3NH5 A;  3D7D A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  4J4Z A;  7CPA A;  1GYT A;  2Q51 A;  4DUK A;  3EJF A;  4AXV A;  2XEI A;  4NGP A;  3SI2 A;  3WC7 A;  2PIY A;  4R76 A;  3B3V A;  2O4H A;  4JVV A;  4H2K A;  5CBM A;  4JYW A;  4P6Y A;  1VHO A;  1CBX A;  3PB9 X;  2ZEL A;  4R8F A;  5HIH A;  4TWE A;  4YWY A;  2PJ5 A;  3FMC A;  3GQO A;  4GUA A;  1XFO A;  2ZEP A;  3JZT A;  4NJQ A;  2O53 A;  5HXD A;  1ARM A;  2CIJ A;  5K8P A;  2GRE A;  3D68 A;  1NSA A;  4BD9 A;  2PRQ A;  1ZG7 A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  3FF3 A;  2L8R A;  2PJB A;  3HUV A;  5JH9 A;  3NA6 A;  3WC5 A;  4NGT A;  4ETJ A;  3KQZ A;  4K3N A;  2POK A;  4OC2 A;  1CX8 A;  3PFE A;  1VIX A;  3GB0 A;  3PBE A;  3GUX A;  3EWQ A;  3NFZ A;  2ZOG A;  3FEC A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  5HOL A;  2G9D A;  1LCP A;  4P4D A; 
#chains in the Genus database with same CATH topology
 1BLL E;  2FG1 A;  3D2M A;  1Z9U A;  3CXQ A;  3FRM A;  3KGQ A;  2GU2 A;  4ZI6 A;  2V8H A;  1DE4 C;  4JWP A;  3V2B A;  3UY5 A;  2W2G A;  1XE4 A;  4PQA A;  3H5Z A;  3B3W A;  4KOS A;  4M6H A;  3T90 A;  4JXQ A;  4FUU A;  1ZR3 A;  1TY8 A;  4KOW A;  2CTC A;  3G8W A;  4P45 A;  2C6G A;  2WUU A;  3IFE A;  4UIA A;  5IB9 A;  4H6U A;  3CXS A;  4J5Q A;  1BPN A;  3SIH A;  2FIW A;  3RAM A;  4JLY A;  5J8F A;  3V38 A;  4UML A;  3BJ7 A;  2PC1 A;  3KI9 A;  3PZJ A;  4B5O A;  2ZW7 A;  4FD7 A;  4HNX B;  2D4P A;  4NGM A;  2VRI A;  1F2O A;  3A9L A;  2AFC A;  4ZX8 A;  2F8H A;  3VFQ A;  4TU0 A;  2ACF A;  1YVK A;  3NE7 A;  4FD6 A;  4PSW A;  4OC0 A;  4YRH A;  4F0X A;  5FVJ A;  2CNT A;  4AVA A;  3DNS A;  3NH4 A;  4NCZ A;  5IV0 A;  3QAH A;  2I3C A;  2CTB A;  4UFX A;  3V8I A;  3H8G A;  4PXD A;  4CGN A;  3ETI A;  4KLW A;  3SII A;  3EY5 A;  1TKH A;  3S6H A;  2K5T A;  1CP7 A;  3TO6 A;  4CAV A;  4NXY A;  3S6K A;  1A2Z A;  1MJ9 A;  4UCM A;  3VH9 A;  3CXP A;  4FD5 A;  2ATR A;  3IGR A;  2PQ8 A;  1YVO A;  1Z4E A;  4J5R A;  1X10 A;  2NYQ A;  4KVX A;  2ZPA A;  4P4J A;  1YQE A;  2BL1 A;  3FJU A;  3RZA A;  1QSN A;  3PEI A;  4ZY0 A;  2B4D A;  2Z3M A;  3TO7 A;  4R57 A;  2ODF A;  1YLE A;  3S9L A;  2FVG A;  4AG9 A;  5HVF A;  2ZEE A;  3R1K A;  2CF4 A;  2PJ0 A;  4Y49 C;  4B6Z A;  2OU2 A;  3SI0 A;  4IHM A;  3EW5 A;  3GPO A;  4MJ8 A;  1ON0 A;  4UEE A;  5F46 A;  4KOT A;  2KCW A;  3VWE A;  4JZ0 A;  3E0K A;  2J8M A;  4MHP A;  3FXT A;  5ELY A;  3KQX A;  2Q44 A;  5JQ4 A;  4ZY2 A;  3MRU A;  1XEB A;  2XEG A;  4F9V A;  4P44 A;  4FBE A;  4A95 A;  3SXO A;  2PVW A;  4O23 A;  4B14 A;  3FB3 A;  3FYN A;  3IU1 A;  4M6I A;  1X12 A;  3PRT A;  3L2N A;  4MCR A;  4QB9 A;  3EFA A;  3DLJ A;  4C2X A;  3TC8 A;  1EE3 P;  1YLO A;  3FNC A;  4R6T A;  3IO1 A;  4PXC A;  3WC6 A;  4B11 A;  2ZEN A;  1S7L A;  5G21 A;  1IU8 A;  4IF5 A;  5LYF A;  2EK8 A;  3EWO A;  1Z4R A;  3SIG A;  5AG6 A;  5EMI A;  1TXR A;  2HB6 A;  5GCN A;  3B35 A;  3WAB A;  3FED A;  1KZF A;  3GY9 A;  2O28 A;  2Q43 A;  3PBB A;  1LFW A;  3IWW A;  4QVT A;  4P10 A;  3SJX A;  1M44 A;  3EC4 A;  4X8I A;  2QEC A;  5CNP A;  3K9T A;  1YX0 A;  4KSA A;  3BHX A;  2YNE A;  1NJR A;  4P4E A;  3R96 A;  2Z11 A;  1I12 A;  4QUS A;  4ETK A;  1QST A;  3B7I A;  2GLF A;  2CNM A;  2LGR A;  2I79 A;  2ZOF A;  5D29 A;  1CP6 A;  4R7M A;  2BSW A;  2BUE A;  2J8R A;  4FD4 A;  4MHD A;  3IWE A;  3D7H A;  4P4F A;  5KTC A;  3ISX A;  3TX8 A;  2BFQ A;  2PCU A;  3TO9 A;  1IOF A;  2QJ8 A;  4JXR A;  4GM5 A;  4E2A A;  3IIF A;  2DXQ A;  3I9S A;  4PSX A;  4GXH A;  3PB8 X;  4PXB A;  4C7I A;  3SI1 A;  1LAM A;  1AMP A;  1P4N A;  5HVG A;  1ZLH A;  4UWI A;  4Q38 A;  5FSZ A;  1NE9 A;  1Q2D A;  1TF9 A;  1HEE A;  1YSJ A;  3ISZ A;  3SJF A;  2IL4 A;  2HC9 A;  3WT4 A;  4HNY B;  2PSW A;  3IWG A;  2EBJ A;  3JRU A;  1F57 A;  2Q0Y A;  2IMO A;  3P2F A;  2B3V A;  4KSI A;  4EFD A;  1YR0 A;  2P6G A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2R98 A;  2V77 A;  4D86 A;  3B3S A;  4HNW B;  3LAC A;  1S7N A;  4LQG A;  3N5F A;  4R3L A;  4U9Z A;  5AIL A;  3RBU A;  4A38 A;  3KHZ A;  1BOB A;  2EEE A;  1CM0 A;  2CY2 A;  1ELL P;  2F7V A;  3PFO A;  1CJW A;  1VHE A;  2WPW A;  3W6X A;  3EWP A;  2XEJ A;  3I3G A;  4XPL A;  2B5G B;  4ZY1 A;  3LMS A;  4NFR A;  2X47 A;  2BOA A;  3BXM A;  4NSQ A;  2YNC C;  4UEF A;  2C1C A;  3F5B A;  5F47 A;  5FSV A;  2WZN A;  4FWU A;  2Q7B A;  4AB7 A;  3KAS A;  1R43 A;  1MJA A;  1WK4 A;  3LWU A;  4NJR A;  1U6M A;  2GFQ A;  3EWR A;  2OZG A;  2WCT A;  4X2T A;  5DS0 A;  4B12 A;  4BMH A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  1K4J A;  2FCK A;  3KHX A;  4QC6 A;  1Q2Y A;  5CPA A;  4MY0 A;  5D8N A;  2PJ3 A;  4YGO A;  4II9 A;  4IK2 A;  4RI1 A;  4KYB A;  4L8A A;  4B5P A;  1R3N A;  1IID A;  3KKW A;  1ZG9 A;  4NEX A;  3D2P A;  4R9M A;  2AFX A;  4C2Y A;  4CYP A;  2Y0M A;  3EKE A;  5H84 A;  4WJB A;  4JLL A;  5LRG A;  4BBH A;  4Z65 A;  1LAN A;  2FXK A;  6CPA A;  4IQY A;  4JJX A;  4YFJ A;  1IIC A;  5ISV A;  3CT9 A;  2VL1 A;  4ZGY B;  3R9E A;  2ZEH A;  2JDD A;  4DJL A;  5K8M A;  2QYV A;  1OBR A;  5LRK A;  1B87 A;  3IC1 A;  1IYK A;  3V45 A;  2G3A A;  2ARH A;  3Q6Z A;  4A32 A;  2ZEF A;  2ZXV A;  2FXF A;  4M3S A;  4NGQ A;  3KL9 A;  2RFH A;  4ESS A;  1BAV A;  1TIQ A;  1XIX A;  1IY7 A;  1IYL A;  3TTH A;  8CPA A;  3SJE A;  3QNV A;  1M4L A;  2Z3L A;  2C6C A;  2QVP A;  1YK3 A;  3LD2 A;  1S5K A;  4R87 A;  3SXN A;  3BI1 A;  2VI7 A;  4J3G A;  4KVM E;  4DYO A;  4UA3 A;  5FSY A;  4CYQ A;  2GLJ A;  1HDQ A;  2PJ9 A;  4Q36 A;  5K8O A;  1XF8 A;  4MHN A;  4ONU A;  4CYN A;  1AYE A;  3GKR A;  1HJZ A;  2REE A;  4CGL A;  2ANP A;  3D66 A;  4KOR A;  2JZE A;  1TF8 A;  1CPS A;  4MXU A;  1BPM A;  4GVV A;  1CPX A;  1KUY A;  2BO9 A;  3PP9 A;  2Q7S A;  5DUS A;  4UWJ A;  3SIJ A;  2VEZ A;  4MI4 A;  3S9N A;  1TKF A;  2B5G A;  3D8P A;  4E8O A;  5JM6 A;  3B8G A;  3K9U A;  3H8E A;  1FNO A;  1WWZ A;  2EVN A;  2HQY A;  4NGR A;  1SPV A;  4PK2 A;  4XNH B;  2PR8 A;  4CPA A;  2B3U A;  2EO8 A;  2YGW A;  1TXZ A;  2VXK A;  1QSM A;  4NGN A;  4F8Z A;  1Y9K A;  4MRI A;  4K0C A;  2PRB A;  5CB5 A;  1PYT B;  2PJ4 A;  3B3T A;  2FE7 A;  2CNS A;  3DDD A;  2AFU A;  2FT0 A;  2PJC A;  3IEH A;  4B5P B;  3FX6 A;  1ZG8 A;  4X5K A;  1S3Z A;  2QML A;  5F09 A;  3DR8 A;  2AFO A;  1FY7 A;  4OKO A;  4AVC A;  4OME A;  3V7Z A;  4Q7A A;  4ZYQ A;  2FS5 A;  2EK9 A;  1IGB A;  2V8D A;  2Q4V A;  3BJ8 A;  3T9Y A;  2ZW6 A;  5JGF A;  4P4I A;  5CB3 A;  3B3C A;  2V8G A;  1Y7E A;  3GQE A;  4IAV A;  4UFW A;  3Q71 A;  3OWC A;  4B13 A;  5LYL A;  3JVN A;  3W6S A;  1YW6 A;  3KZW A;  2D4O A;  2R8V A;  4DNC A;  1OZP A;  4H89 A;  5AG4 A;  2AJ6 A;  5THW A;  2WSA A;  3I1U A;  4GVW A;  5DWN A;  2AFW A;  2GAN A;  2PIZ A;  2RC4 A;  5J8C A;  2JZD A;  2H5M A;  4CGO A;  1AUG A;  2JEV A;  2Z10 A;  1KUX A;  1N71 A;  2NMT A;  2RNK A;  2DEA A;  2YND A;  2GIV A;  2G0B A;  1S7F A;  2NSM A;  3D67 A;  1Z8W A;  4PXE A;  2EWB A;  1YRE A;  2A4N A;  1YME A;  2AFM A;  2PVV A;  4AVB A;  5A27 A;  3IIB A;  2PJ8 A;  4W9Y A;  1PU9 A;  1B6B A;  4KSF A;  4CAW A;  1LRZ A;  4ONW A;  4UIB A;  5EBV A;  3GIU A;  2REF A;  3TOB A;  1GHE A;  1ZLI A;  2J8N A;  4F9U A;  3D7F A;  2OOT A;  4E0A A;  1QSR A;  2B4D B;  2HUZ A;  1ZR5 A;  2XD7 A;  1QSO A;  3CDX A;  2JBJ A;  3CPX A;  1KWM A;  4OAE A;  3VAT A;  1P0H A;  1H8L A;  4PK3 A;  3C26 A;  1VHS A;  3MGD A;  3R9G A;  2JZF A;  3TE4 A;  4OC5 A;  1F2P A;  4MY3 A;  3FEE A;  4OIW A;  1QQ9 A;  3GYA A;  4KLV A;  2BEI A;  4G1P A;  5BWA B;  4UF4 A;  4FAI A;  2I00 A;  4KOU A;  3KR5 A;  3PB4 X;  4CAE A;  1CG2 A;  2OR4 A;  3EXN A;  3K2K A;  4KUB A;  4A31 A;  5AG5 A;  3T8W A;  2JLM A;  3ZJ0 A;  4JGK A;  2Q4Z A;  3JTK A;  4H6Z A;  5AGE A;  5J1Q A;  2IJZ A;  1IB1 E;  3CPA A;  3GLJ A;  2OZU A;  4NF1 A;  2B58 A;  4MMO A;  4QBJ A;  2AE6 A;  2PJ7 A;  5EC4 A;  4KOY A;  1Q2C A;  5E3B A;  1UFH A;  3EJG A;  4CAF A;  1S60 A;  2P6E A;  2IQ6 A;  2R1I A;  4TNU A;  4UBR A;  3VAR A;  3JUW A;  4UCN A;  4UFV A;  1TKJ A;  3D3S A;  3QAY A;  5DWM A;  4A30 A;  4MHZ A;  2OB0 A;  4U9Y A;  4XPD B;  4B10 A;  4EME A;  2FAV A;  2VZZ A;  2R7H A;  2ZEO A;  3IU2 A;  1PUA A;  2C27 A;  4OLL A;  3BI0 A;  4WWV A;  1RO5 A;  5AG7 A;  2JEW A;  3SHP A;  2PJ1 A;  4F0Y A;  4ABL A;  1YD9 A;  4M6G A;  3D7G A;  4C2Z A;  4XPD C;  5KTA A;  5KTD A;  3GPQ A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  2JDC A;  3DGV A;  2ZW5 A;  2B4B A;  3ZZI A;  4C68 A;  4MBU A;  4OP4 A;  5C82 A;  2AFS A;  1Z2L A;  3DR6 A;  2PE3 A;  4EVY A;  5HMN A;  1SQH A;  1I1D A;  2ZEM A;  5K8N A;  4ABK A;  2BCO A;  3H4Q A;  3PB7 X;  4LQ6 A;  2C6P A;  5E96 A;  2XEF A;  3N7Z A;  1LOK A;  4JD6 A;  4BIN A;  3IID A;  3KR4 A;  2ZW4 A;  5CMS A;  4MCS A;  4UCP A;  4MCP A;  4MFJ A;  4KUA A;  4XNH C;  4J5S A;  4KOV A;  4OC3 A;  5FSU A;  5LYD A;  2F5I A;  2FIA A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  2VZY A;  2Q04 A;  3QB8 A;  1Y0Y A;  3FBU A;  2BFR A;  1YW4 A;  1FT7 A;  3BLN A;  3SJG A;  4PV6 A;  2PJ2 A;  2VQY A;  2JBK A;  2WYR A;  4CRZ B;  4HPS A;  1I21 A;  4PPZ A;  3WR7 A;  1M4D A;  4OC1 A;  4A39 A;  4ZX9 A;  1BO4 A;  3PB6 X;  2RB7 A;  4KZT A;  4CYO A;  1LAP A;  2KQV A;  2FL4 A;  1XBU A;  1Y9W A;  1XMB A;  3B2Y A;  3MN8 A;  4MFK A;  4XPK A;  4JCA A;  5F48 A;  3RYO A;  4NGS A;  3DSB A;  2J9A A;  4YU9 A;  5FSX A;  5JPH A;  1Z5R A;  4LX9 A;  4A33 A;  5LRJ A;  4CRY B;  3R9F A;  3S6G A;  5I4M A;  1VHU A;  4P4B A;  5C88 A;  2AFZ A;  1ARL A;  4AG7 A;  2G3T A;  3NH8 A;  4L89 A;  4MFZ A;  4OAD A;  3PGP A;  1NSL A;  3HLP A;  2Z3K A;  1PCA A;  2DX6 A;  5HVH A;  1Y7R A;  1M4G A;  1Y0R A;  2ABZ A;  4MCQ A;  3S9M A;  2DPT A;  3GPG A;  3FH4 A;  4GS4 A;  4KS9 A;  5H86 A;  1XRY A;  3TOA A;  3NH5 A;  2FSR A;  2P6F A;  2YNC A;  3F8K A;  3D7D A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  5IB0 A;  1ZO0 A;  4J4Z A;  7CPA A;  1GYT A;  1L0C A;  1Z8X A;  1S7K A;  2QIR A;  3W91 A;  5G22 A;  2Q51 A;  4DUK A;  4MFL A;  3EJF A;  4HKF A;  1M4I A;  2EUI A;  4KVO E;  4AXV A;  2XEI A;  4ORF A;  2DPS A;  4CGM A;  1IOI A;  1V0C A;  4NGP A;  3SI2 A;  3CZX A;  3WC7 A;  2PIY A;  2Q4Y A;  4CS0 B;  4R76 A;  2P0W A;  2PDO A;  3B3V A;  2GE3 A;  4RN7 A;  3NE8 A;  4CGP A;  2O4H A;  4JVV A;  4H2K A;  5CBM A;  3TT2 A;  4JYW A;  1JWQ A;  5I0C A;  4P6Y A;  1VHO A;  1CBX A;  3G3S A;  3PB9 X;  4CAX A;  3F0A A;  2ZEL A;  1MJB A;  1YGH A;  4U5Y A;  4R8F A;  2CXA A;  5G20 A;  3TCV A;  5HIH A;  3FIX A;  4TWE A;  4A2Z A;  4YWY A;  1KUV A;  2PJ5 A;  2Z3P A;  3FMC A;  3GQO A;  1NMT A;  2OZH A;  4GUA A;  1XFO A;  3P2H A;  4IUS A;  4K30 A;  5HH1 A;  4A37 A;  5F49 A;  2ZEP A;  2DF5 A;  4RS2 A;  3TFY A;  1Z8T A;  3JZT A;  4ZBG A;  2VBQ A;  1R57 A;  4NJQ A;  2O53 A;  3RO0 A;  5HXD A;  1ARM A;  1VKC A;  2CIJ A;  3VWD A;  5K8P A;  2GRE A;  3D68 A;  4MFQ A;  4Y49 B;  1NSA A;  3R95 A;  4BD9 A;  2PRQ A;  2Z3N A;  1ZG7 A;  4F6A A;  4MFP A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  2PR1 A;  3FF3 A;  2L8R A;  2OH1 A;  2PJB A;  3HUV A;  5JH9 A;  5G1Z A;  3NA6 A;  3WC5 A;  2Z0Z A;  2X7B A;  4NGT A;  4ETJ A;  4LUA A;  3KQZ A;  4K3N A;  1XOV A;  4R3K A;  3S6F A;  2POK A;  4OC2 A;  1J4J A;  1CX8 A;  3PFE A;  1RXT A;  4C7H A;  1VIX A;  1MK4 A;  3GB0 A;  4M85 A;  3PBE A;  5A28 A;  3RNZ A;  2Z3O A;  3EWQ A;  3GUX A;  3LOD A;  2HV2 A;  2ZOG A;  3FEC A;  3NFZ A;  1M1D A;  4KOX A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  2WPX A;  5HOL A;  3EO4 A;  2G9D A;  1LCP A;  4I49 A;  1XMT A;  5IX3 A;  4P4D A; 
#chains in the Genus database with same CATH homology
 1BLL E;  2FG1 A;  3KGQ A;  2GU2 A;  4ZI6 A;  2V8H A;  1DE4 C;  3V2B A;  4PQA A;  3B3W A;  4FUU A;  1ZR3 A;  1TY8 A;  2CTC A;  4P45 A;  2C6G A;  3IFE A;  4UIA A;  5IB9 A;  4J5Q A;  1BPN A;  3SIH A;  3RAM A;  3V38 A;  4UML A;  3KI9 A;  4NGM A;  2VRI A;  1F2O A;  2AFC A;  4ZX8 A;  2F8H A;  3VFQ A;  4TU0 A;  2ACF A;  4OC0 A;  3NH4 A;  2I3C A;  2CTB A;  3H8G A;  4PXD A;  3ETI A;  3SII A;  1TKH A;  1CP7 A;  3VH9 A;  4J5R A;  2NYQ A;  4P4J A;  3FJU A;  3RZA A;  3PEI A;  4ZY0 A;  3S9L A;  2FVG A;  5HVF A;  2ZEE A;  2CF4 A;  2PJ0 A;  4B6Z A;  3SI0 A;  4IHM A;  3EW5 A;  3GPO A;  4UEE A;  4JZ0 A;  4MHP A;  5ELY A;  3KQX A;  4ZY2 A;  3MRU A;  2XEG A;  4F9V A;  4P44 A;  4FBE A;  2PVW A;  4O23 A;  3PRT A;  3L2N A;  4MCR A;  3DLJ A;  3TC8 A;  1EE3 P;  1YLO A;  4R6T A;  3IO1 A;  4PXC A;  3WC6 A;  2ZEN A;  5LYF A;  2EK8 A;  3EWO A;  3SIG A;  1TXR A;  2HB6 A;  3B35 A;  3WAB A;  3FED A;  2Q43 A;  3PBB A;  1LFW A;  3IWW A;  4P10 A;  3SJX A;  4X8I A;  3K9T A;  3BHX A;  1NJR A;  4P4E A;  4ETK A;  3B7I A;  2GLF A;  2ZOF A;  2LGR A;  5D29 A;  1CP6 A;  4R7M A;  4P4F A;  3D7H A;  3ISX A;  3TX8 A;  2BFQ A;  2PCU A;  2QJ8 A;  4GM5 A;  3IIF A;  4PXB A;  3PB8 X;  3SI1 A;  1LAM A;  1AMP A;  5HVG A;  1ZLH A;  5FSZ A;  1YSJ A;  3ISZ A;  1TF9 A;  1HEE A;  3SJF A;  3WT4 A;  2HC9 A;  3JRU A;  1F57 A;  2IMO A;  4KSI A;  4EFD A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2V77 A;  4D86 A;  3B3S A;  4LQG A;  3N5F A;  5AIL A;  3RBU A;  4A38 A;  3KHZ A;  2EEE A;  1ELL P;  2F7V A;  3PFO A;  1VHE A;  3EWP A;  2XEJ A;  3LMS A;  4ZY1 A;  4NFR A;  2X47 A;  2BOA A;  3BXM A;  4A37 A;  4UEF A;  2C1C A;  5FSV A;  2WZN A;  4FWU A;  3KAS A;  1R43 A;  3LWU A;  4NJR A;  3EWR A;  4X2T A;  5DS0 A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  5JM6 A;  3KHX A;  5CPA A;  5D8N A;  2PJ3 A;  4IK2 A;  4KYB A;  1R3N A;  1ZG9 A;  2AFX A;  3EKE A;  4WJB A;  4JLL A;  5LRG A;  4Z65 A;  1LAN A;  2FXK A;  6CPA A;  4IQY A;  3CT9 A;  2VL1 A;  2ZEH A;  4DJL A;  5K8M A;  2QYV A;  1OBR A;  5LRK A;  3IC1 A;  3V45 A;  3Q6Z A;  2ZEF A;  4NGQ A;  3KL9 A;  2RFH A;  4ESS A;  1BAV A;  1IY7 A;  8CPA A;  3SJE A;  3QNV A;  1M4L A;  2C6C A;  2QVP A;  3BI1 A;  4DYO A;  5FSY A;  2GLJ A;  1HDQ A;  2PJ9 A;  5K8O A;  4MHN A;  1AYE A;  1HJZ A;  2ANP A;  3D66 A;  1TF8 A;  1CPS A;  4MXU A;  1BPM A;  4GVV A;  1CPX A;  2BO9 A;  5DUS A;  3SIJ A;  3S9N A;  1TKF A;  3H8E A;  1FNO A;  4NGR A;  1SPV A;  4CPA A;  1TXZ A;  4NGN A;  4F8Z A;  4MRI A;  4K0C A;  5CB5 A;  1PYT B;  2PJ4 A;  3B3T A;  2AFU A;  2PJC A;  3IEH A;  5F09 A;  3FX6 A;  1ZG8 A;  2AFO A;  4OKO A;  4OME A;  3V7Z A;  4Q7A A;  4ZYQ A;  2EK9 A;  1IGB A;  2V8D A;  5JGF A;  4P4I A;  5CB3 A;  3B3C A;  2V8G A;  1Y7E A;  3GQE A;  4IAV A;  3Q71 A;  5LYL A;  1YW6 A;  3KZW A;  5THW A;  3I1U A;  4GVW A;  2AFW A;  2PIZ A;  2DEA A;  4PXE A;  2NSM A;  3D67 A;  2EWB A;  2AFM A;  1YME A;  2PVV A;  3IIB A;  2PJ8 A;  4W9Y A;  4ONW A;  4UIB A;  1ZLI A;  4F9U A;  3D7F A;  2OOT A;  3S9M A;  3CDX A;  1ZR5 A;  2XD7 A;  3CPX A;  2JBJ A;  1KWM A;  3VAT A;  1H8L A;  4OC5 A;  1F2P A;  4OIW A;  3FEE A;  1QQ9 A;  4G1P A;  4UF4 A;  4FAI A;  3KR5 A;  3PB4 X;  1CG2 A;  2OR4 A;  3K2K A;  3T8W A;  4JGK A;  2Q4Z A;  5J1Q A;  2IJZ A;  3CPA A;  3GLJ A;  4MMO A;  2PJ7 A;  5E3B A;  3EJG A;  2IQ6 A;  4TNU A;  3VAR A;  1TKJ A;  4MHZ A;  4EME A;  2FAV A;  2ZEO A;  4WWV A;  3BI0 A;  2JEW A;  2PJ1 A;  4ABL A;  1YD9 A;  3D7G A;  3GPQ A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  3DGV A;  4OP4 A;  2AFS A;  1Z2L A;  2PE3 A;  2ZEM A;  5K8N A;  4ABK A;  2BCO A;  3PB7 X;  2C6P A;  2XEF A;  1LOK A;  3IID A;  3KR4 A;  5CMS A;  4MCS A;  4MCP A;  4J5S A;  4OC3 A;  5FSU A;  5LYD A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  1Y0Y A;  2BFR A;  1YW4 A;  1FT7 A;  3SJG A;  2PJ2 A;  2JBK A;  2WYR A;  4PPZ A;  4OC1 A;  4A39 A;  4ZX9 A;  3PB6 X;  2RB7 A;  1LAP A;  1XBU A;  1XMB A;  3B2Y A;  3MN8 A;  4JCA A;  4NGS A;  2J9A A;  4YU9 A;  5FSX A;  1Z5R A;  5LRJ A;  5I4M A;  1VHU A;  4P4B A;  2AFZ A;  1ARL A;  3NH8 A;  3HLP A;  1PCA A;  2DX6 A;  5HVH A;  4MCQ A;  1Y0R A;  2ABZ A;  3FH4 A;  3GPG A;  1XRY A;  3NH5 A;  3D7D A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  4J4Z A;  7CPA A;  1GYT A;  2Q51 A;  4DUK A;  3EJF A;  4AXV A;  2XEI A;  4NGP A;  3SI2 A;  3WC7 A;  2PIY A;  4R76 A;  3B3V A;  2O4H A;  4JVV A;  4H2K A;  5CBM A;  4JYW A;  4P6Y A;  1VHO A;  1CBX A;  3PB9 X;  2ZEL A;  4R8F A;  5HIH A;  4TWE A;  4YWY A;  2PJ5 A;  3FMC A;  3GQO A;  4GUA A;  1XFO A;  2ZEP A;  3JZT A;  4NJQ A;  2O53 A;  5HXD A;  1ARM A;  2CIJ A;  5K8P A;  2GRE A;  3D68 A;  1NSA A;  4BD9 A;  2PRQ A;  1ZG7 A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  3FF3 A;  2L8R A;  2PJB A;  3HUV A;  5JH9 A;  3NA6 A;  3WC5 A;  4NGT A;  4ETJ A;  3KQZ A;  4K3N A;  2POK A;  4OC2 A;  1CX8 A;  3PFE A;  1VIX A;  3GB0 A;  3PBE A;  3GUX A;  3EWQ A;  3NFZ A;  2ZOG A;  3FEC A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  5HOL A;  2G9D A;  1LCP A;  4P4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...