4R7MA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
518
structure length
516
Chain Sequence
SEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
total genus 175
structure length 516
sequence length 518
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r7mA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r7mA02
3V38A 3SIGA 4OC3A 5CB3A 2QJ8A 2HC9A 1QQ9A 3BHXA 1CX8A 2EEEA 1M4LA 1IGBA 2BOAA 2PVWA 2AFCA 2AFSA 2C6GA 2ZEMA 3B35A 1TF9A 1BLLE 2ANPA 3D67A 3RZAA 3WABA 3PB7X 4ONWA 3VATA 1AMPA 1F2PA 2PJ5A 4MRIA 2PJCA 5JGFA 4PQAA 4OC0A 3VH9A 3PB4X 5LYFA 3EKEA 1LFWA 1VHOA 3D4UA 1ZG8A 1ZR5A 3D7GA 3EW5A 4NJRA 2ZEDA 4KYBA 4P4EA 3Q6ZA 4W9YA 4F8ZA 2PJ9A 3LWUA 4OMEA 3NH5A 1XJOA 2QYVA 4R7MA 2PE3A 4MHNA 3GQOA 4UEFA 1XMBA 1GYTA 8CPAA 3ETIA 3FJUA 2L8RA 3EWOA 4YU9A 2ZEFA 2FG1A 4NGQA 3SI2A 1HJZA 2ZEEA 2PJBA 3T8WA 3ISXA 4PXBA 3RAMA 4FAIA 5FSVA 4ZY2A 5K8NA 4MMOA 5FSUA 1TKFA 1DE4C 3JZTA 4NGRA 4J4ZA 4P44A 2PJ8A 2DEAA 4R76A 1BPMA 4P6YA 4X2TA 3Q71A 4OC1A 3EJGA 4DYOA 5K8OA 1Z8LA 2PJ3A 3SI1A 4JZ0A 4EMEA 3IIFA 3FEDA 2ZELA 3D7HA 1ZG7A 2AFWA 1YD9A 3PB9X 3L2NA 2PJ1A 5CB5A 1TF8A 1ZLIA 4IQYA 3VARA 4MHYA 4UIAA 3PBBA 3D66A 4F9VA 1ZR3A 4GUAA 3H8EA 4WJBA 3V2BA 5HVHA 4ABLA 4PXEA 1VGYA 3CDXA 3VFQA 3FEEA 4ZX9A 4DUKA 4MCRA 2QVPA 2GLFA 3MN8A 4EWTA 1PYTB 2VL1A 4PXCA 3KR5A 5LYLA 3I1UA 2IJZA 2OOTA 3EJFA 1YMEA 4OIWA 4F9UA 1IY7A 7CPAA 5ELYA 2XEJA 2CIJA 3TX8A 5IB9A 5AILA 4ZYQA 3V45A 1ZLHA 3GB0A 2O4HA 4YWYA 1BPNA 1XFOA 4JCAA 3RBUA 4UEZA 3D7FA 2WYRA 3B3SA 2AFZA 2FVGA 4FWUA 2ZOFA 3D7DA 3WC7A 2ABZA 4B6ZA 4MHZA 3SJEA 6CPAA 3NH8A 4A94A 3KZWA 3PB8X 2FAVA 2XEFA 4K0CA 4ZY0A 3WC5A 3KGQA 3PFOA 1F57A 3KR4A 3IWWA 4MCSA 4NGSA 1UWYA 2XEGA 5D8NA 4A39A 4J5RA 1R43A 3IC1A 4CPAA 2V8VA 2ZOGA 4Q7AA 2DX6A 3B3CA 1CPXA 1HDUA 4JGKA 3KL9A 2X47A 3EWQA 3S9LA 5J1QA 5LRKA 3SJGA 1Q7LA 2ACFA 2JBKA 4TU0A 2NYQA 3B3TA 4ETJA 3IFEA 5HXDA 1Y0YA 2Q43A 4P45A 4ZY1A 4LQGA 2CTBA 4A37A 1HEEA 2POKA 4OC2A 5FSYA 3KHXA 1YLOA 4KSIA 1FT7A 1Z2LA 3CPAA 4AXVA 4R6TA 1ELLP 2PJAA 4P10A 3N5FA 1H8LA 3DLJA 2IMOA 4X3RA 2J9AA 4J5QA 2EWBA 1KWMA 3SIHA 3B3WA 5JH9A 1CP6A 5DUSA 4P4JA 3IEHA 4JYWA 4GM5A 4JVVA 1TKHA 2GREA 4OIDA 1VHUA 3FH4A 2PIYA 3IIBA 3SIIA 4DJLA 4UMLA 1FNOA 4G1PA 1Z5RA 3BXMA 1Y7EA 3GUXA 3SJXA 2EK9A 3GLJA 3PFEA 1AYEA 2EK8A 4UF4A 2GLJA 3FVLA 3EWPA 1NSAA 5FSZA 2PJ2A 3HUVA 5JM6A 1JQGA 2PJ0A 1BAVA 2ZEGA 4UIBA 4ETKA 4ZI6A 3GPOA 5LRGA 3H8FA 1NJRA 2C6CA 5THWA 4PPZA 3BI0A 3ISZA 3CT9A 2ZENA 2F8HA 2I3CA 2G9DA 3KI9A 2XD7A 3TC8A 1YW6A 2PVVA 2GU2A 5F09A 4ESSA 2C1CA 3KQXA 4P4FA 4OP4A 3SIJA 2RFHA 3DGVA 1R3NA 3PEIA 1QMUA 1TXRA 2AFOA 5I4MA 2BO9A 4IK2A 2CF4A 4IHMA 2PRQA 2XEIA 3PBEA 5DS0A 3BI1A 4JLLA 4ZX8A 1Y0RA 3IIDA 1XRYA 3S9NA 1CPSA 5CPAA 2O53A 5HVFA 3S9MA 2Q51A 3IO1A 2BCOA 5E3BA 4OC4A 3PRTA 3KASA 4IAVA 2ZEPA 3WT4A 4PXDA 3NH4A 4NGMA 3K2KA 3HLPA 2AFXA 5K8MA 1EE3P 3D68A 2V8GA 2PJ6A 2V77A 1TY8A 3FECA 4FBEA 1LAPA 1VIXA 4X8IA 1TKJA 3MRUA 5D29A 5FSXA 2LGRA 3NFZA 4FUUA 1SPVA 1YW4A 3B7IA 2IQ6A 5HIHA 2NSMA 3K9TA 2BFQA 3JRUA 2V8HA 4OC5A 2RB7A 1HDQA 2PCUA 5HOLA 3B3VA 5CMSA 3CPXA 3PB6X 3GPGA 2V8DA 2WZNA 2AFMA 5K8PA 2HB6A 2PIZA 4NGNA 2BFRA 1ELMP 4WWVA 5CBMA 4TNUA 4RUHA 4P4IA 4EFDA 2Q4ZA 3IJ3A 4R8FA 4GVVA 1ZG9A 1F2OA 5HVGA 3SI0A 4NGTA 4K3NA 2FXKA 4NGPA 1PCAA 2PJ7A 3KHZA 2F7VA 1LAMA 2ZEHA 2C6PA 3SJFA 4OKOA 4MXUA 4UEEA 3EWRA 1ARLA 1CBXA 2CTCA 1LANA 2ZEOA 2PJ4A 1ARMA 3WC6A 2OR4A 5LYDA 2JBJA 4NFRA 3FX6A 5LRJA 4A38A 3FF3A 4BD9A 3H8GA 1LCPA 1CP7A 4MCQA 4GVWA 3GPQA 3NA6A 4J5SA 3KQZA 4P4BA 1RTQA 1XBUA 1YSJA 4NJQA 4MHPA 1TXZA 4H2KA 4P4DA 3GQEA 2JEWA 4TWEA 2VRIA 3B2YA 3FMCA 1CG2A 1VHEA 2AFUA 1OBRA 3QNVA 3LMSA 4Z65A 4ABKA 3V7ZA 4MCPA 4D86A 1DTDA 4O23A 5LYIA 1LOKA
chains in the Genus database with same CATH superfamily
3V38A 3SIGA 4OC3A 4CAWA 1TIQA 5CB3A 2QJ8A 1K4JA 2HC9A 1QQ9A 4NF1A 5FVJA 4PSXA 4MFJA 3IU1A 3BHXA 1CX8A 4CAXA 2EEEA 1B87A 1IGBA 1M4LA 2BOAA 4I49A 2PVWA 2AFCA 5F47A 4B11A 2GANA 2AFSA 2Z0ZA 4F6AA 2C6GA 2ZEMA 1Q2CA 1ZO0A 3B35A 1TF9A 4FD6A 1BLLE 4XPDB 2ANPA 3D67A 3RZAA 3WABA 3PB7X 2R1IA 4ZGYB 4ONWA 5F48A 3VATA 4JLYA 2HV2A 3R9FA 1AMPA 4IUSA 4LX9A 4XNHC 4GXHA 5J8CA 1F2PA 2Z3LA 2PR1A 4CGMA 5H86A 4XPLA 3GYAA 4H6ZA 4HPSA 2PJ5A 2IL4A 1PU9A 4MRIA 2PJCA 2I00A 5H84A 1FY7A 4PQAA 4R3LA 4CRYB 5JGFA 1BOBA 3R9EA 5AG5A 3TO9A 4KOSA 4OC0A 3VH9A 3PB4X 4KOXA 4HNXB 1I12A 2P6FA 4KSAA 4MI4A 4RI1A 4UFVA 5LYFA 3EKEA 1LFWA 5IB0A 4J3GA 1VHOA 3D4UA 1ZG8A 1S3ZA 3V8IA 1ZR5A 3D7GA 3EW5A 4NJRA 2ZEDA 4GS4A 2OZHA 2CXAA 4KYBA 4IF5A 2VQYA 2JDDA 2J8RA 4KOVA 4P4EA 3Q6ZA 4FD5A 4W9YA 4F8ZA 4YRHA 2PJ9A 1M4IA 3LWUA 4OMEA 3TO7A 3NH5A 1XJOA 2PR8A 2QYVA 1ON0A 2ZW5A 4R7MA 3FNCA 2PE3A 2WPXA 4MHNA 4UCPA 3GQOA 4UEFA 1XMBA 1GYTA 1M4DA 4AB7A 3ETIA 8CPAA 3FJUA 2L8RA 3EWOA 3JTKA 4YU9A 2ZEFA 2FG1A 4NGQA 3SI2A 4CAFA 1HJZA 5ISVA 3RNZA 3N7ZA 2ZEEA 3EY5A 3D2PA 2PJBA 3T8WA 3ISXA 4JXRA 4PXBA 5JQ4A 4CS0B 3RAMA 4FAIA 5FSVA 4ZY2A 2A4NA 1MJAA 4MMOA 5FSUA 1TKFA 4HKFA 1DE4C 3JZTA 5K8NA 4H6UA 3B8GA 4NGRA 1IYLA 4J4ZA 1KUVA 2B4DA 4P44A 2PJ8A 3S6FA 4F0XA 1IOIA 2DEAA 3E0KA 4R76A 1BPMA 2B3UA 2Q4VA 5A27A 4P6YA 2Q4YA 4X2TA 3Q71A 4MFZA 4KUAA 2FL4A 4OAEA 4OC1A 3EJGA 4A2ZA 4DYOA 5K8OA 1Z8LA 2PJ3A 3SI1A 2PSWA 4JZ0A 4MHDA 4A33A 4EMEA 3IIFA 3FEDA 2ZELA 1Y9KA 2EBJA 1Z8XA 2Z10A 3D7HA 1ZG7A 2AFWA 4C2ZA 5IX3A 1YD9A 1IB1E 2WCTA 3EXNA 4CAVA 3PB9X 2RNKA 3L2NA 4KORA 4BBHA 4HNWB 2PJ1A 4EVYA 5CB5A 1TF8A 4KUBA 4M6GA 4C7HA 1ZLIA 5IV0A 4IQYA 2FS5A 3FXTA 3VARA 4MHYA 4UIAA 3PBBA 1VHSA 1V0CA 4U9ZA 3D66A 4F9VA 2GIVA 1S7LA 4XPDC 1ZR3A 4GUAA 5GCNA 4QVTA 4UWIA 3H8EA 4BMHA 4BINA 2ZW4A 3KKWA 3IWEA 3V2BA 1RO5A 4WJBA 4A30A 5HVHA 4ABLA 4PXEA 1VGYA 3CDXA 3VFQA 2PQ8A 2DF5A 3FEEA 4ZX9A 2AE6A 4C2YA 2FCKA 3TCVA 4L89A 4DUKA 4MCRA 2EUIA 4DNCA 2QVPA 1CM0A 2HUZA 2GLFA 3SXNA 3NE8A 3MN8A 4EWTA 4CGOA 4B13A 1PYTB 2VL1A 4PXCA 4RS2A 4CGLA 1S7NA 3KR5A 2NMTA 5LYLA 3I1UA 2IJZA 5G22A 2J8MA 1QSNA 2OOTA 4PSWA 3EJFA 3SXOA 1YMEA 3FYNA 4OIWA 4F9UA 4B5PA 1IY7A 2G3AA 7CPAA 1I21A 5ELYA 3G8WA 2XEJA 1XIXA 3VWDA 2CIJA 3CZXA 5BWAB 3TX8A 5IB9A 5AILA 3NE7A 4ZYQA 2P0WA 1MJBA 3W6SA 2B4DB 2G3TA 3V45A 1ZLHA 3TTHA 3GB0A 2O4HA 4YWYA 4CYPA 1XOVA 4NCZA 3RO0A 1BPNA 1XFOA 2VBQA 5KTAA 4K30A 5A28A 2BSWA 4JCAA 2O28A 3H5ZA 4UEZA 3D7FA 2WYRA 3R96A 1KZFA 3B3SA 3RBUA 4B5OA 4C7IA 1VKCA 2AFZA 2B3VA 2FVGA 2G0BA 3G3SA 1M1DA 4FWUA 2ZOFA 3D7DA 3TOBA 3WC7A 2ABZA 2JZEA 1X12A 4Q38A 1U6MA 4MHZA 2ATRA 2OB0A 2YNEA 3NH8A 3SJEA 4A94A 4B6ZA 2FT0A 6CPAA 3KZWA 3PB8X 2FAVA 2XEFA 4K0CA 4ZY0A 2ODFA 3RYOA 3EO4A 2BEIA 1XMTA 3JUWA 4UFXA 2Q7BA 3WC5A 3KGQA 4R9MA 1MK4A 4MFKA 4QUSA 3PFOA 1Z8TA 1F57A 2B5GA 2OH1A 3S6HA 3KR4A 1YQEA 3IWWA 4MCSA 2RC4A 1UWYA 2XEGA 1CJWA 4NGSA 5D8NA 2EO8A 4A39A 4J5RA 1R43A 1BO4A 3IC1A 4KVOE 4UWJA 2V8VA 2ZOGA 2J8NA 4CPAA 4Q7AA 1XF8A 1QSTA 4M6IA 4XPKA 1YVKA 2PRBA 3I9SA 2DX6A 2FSRA 4UCMA 3B3CA 3W6XA 4AG9A 2YGWA 1WK4A 2P6GA 1CPXA 1HDUA 4JGKA 2P6EA 3CXPA 3CXQA 3KL9A 5AGEA 1P0HA 2X47A 3EWQA 3JVNA 3S9LA 5J1QA 5LRKA 3SJGA 2B58A 3MGDA 1Q7LA 2JLMA 2ACFA 2JBKA 4TU0A 2NYQA 3B3TA 4KZTA 4ETJA 3IFEA 1QSRA 5HXDA 1Y0YA 1QSOA 4KLWA 2Q43A 4P45A 4ZY1A 5EC4A 4LQGA 4KVXA 2CTBA 4AVBA 4NEXA 4M6HA 4A37A 2QECA 4FD7A 1HEEA 2POKA 3BJ7A 3OWCA 3IWGA 4MY3A 4OC2A 5J8FA 5FSYA 3EFAA 3H4QA 3D8PA 3KHXA 4U9YA 1YLOA 4KSIA 2EVNA 1FT7A 1Z2LA 3CPAA 4AXVA 4R6TA 1ELLP 2PJAA 4P10A 3N5FA 3R95A 1IOFA 1H8LA 2WSAA 2IMOA 3DLJA 2J9AA 4X3RA 5AG7A 3BLNA 4J5QA 2YNDA 4ORFA 2EWBA 4A32A 1KWMA 3SIHA 2HQYA 4OADA 4CGNA 3B3WA 3F5BA 4FD4A 1PUAA 5JH9A 2CNSA 1CP6A 5DUSA 2AJ6A 3W91A 4P4JA 5G20A 3IEHA 4JYWA 4GM5A 2DPSA 4JVVA 1TKHA 2GREA 1IICA 1OZPA 4OIDA 1YR0A 2Z3OA 1Z8WA 2Z3PA 1VHUA 4AVCA 3S6KA 3FH4A 4JXQA 2PIYA 3IIBA 2ZPAA 3SIIA 5KTCA 4DJLA 2JZFA 4UMLA 1FNOA 4G1PA 4MY0A 1Z5RA 3BXMA 3FB3A 3TO6A 4A31A 4JD6A 3GIUA 2YNCA 1Y7EA 3GUXA 4PV6A 2D4PA 2CNTA 2VZYA 3T9YA 4ONUA 3SJXA 2B5GB 2EK9A 2F5IA 4RN7A 3TT2A 3EC4A 3FRMA 1JWQA 3GLJA 4II9A 3PFEA 3ZJ0A 1AYEA 2EK8A 4UF4A 4KLVA 4CAEA 2GLJA 3FVLA 1R57A 3SHPA 3EWPA 1NSAA 1XE4A 1S60A 1Y7RA 5FSZA 2PC1A 2PJ2A 3WR7A 3HUVA 3TFYA 2R7HA 5JM6A 2OZUA 5G1ZA 1JQGA 5AG6A 2PJ0A 1BAVA 2ZEGA 1A2ZA 1XEBA 4UIBA 4ETKA 5I0CA 3T90A 4R3KA 4ZI6A 4B12A 1IYKA 4Y49B 3GPOA 1X10A 3C26A 3QAHA 5LRGA 3TOAA 3TE4A 1IU8A 3I3GA 5JPHA 4M3SA 5F49A 2I79A 3H8FA 1NJRA 1NE9A 2C6CA 5THWA 4PPZA 5C88A 3BI0A 3ISZA 3CT9A 2X7BA 2ZENA 1UFHA 1S7KA 2F8HA 2G9DA 2I3CA 3KI9A 2XD7A 3TC8A 4UFWA 1S7FA 1YW6A 2PVVA 2GU2A 4HNYB 5F09A 5KTDA 2WUUA 2ZW7A 4ESSA 2C1CA 3KQXA 4P4FA 5CNPA 4UBRA 1YK3A 4OP4A 3P2HA 3SIJA 2RFHA 2ZXVA 2CY2A 3DGVA 1YREA 1R3NA 3PEIA 1QMUA 1TXRA 2AFOA 5I4MA 3BJ8A 1YX0A 3F0AA 2BO9A 1L0CA 1M44A 1P4NA 2CF4A 4IK2A 4IHMA 2PRQA 2B4BA 2XEIA 3PBEA 3QB8A 3BI1A 4U5YA 4JLLA 5DS0A 4ZX8A 4PK2A 1Y9WA 4CYQA 1Y0RA 3IIDA 4KSFA 4LQ6A 2Y0MA 1XRYA 2BUEA 4E0AA 2REEA 2Q44A 1CPSA 2Q7SA 5CPAA 3S9NA 2FE7A 3DNSA 5E96A 3S6GA 1YGHA 2O53A 3DR6A 3F8KA 5HVFA 2DPTA 5AG4A 1RXTA 3S9MA 2Q51A 4NSQA 3IO1A 2BCOA 5E3BA 4OC4A 3CXSA 3PRTA 3KASA 4KOYA 3D2MA 4A38A 4CYOA 4IAVA 4C68A 2OZGA 2ZEPA 4B14A 3WT4A 4C2XA 4PXDA 2REFA 3NH4A 1QSMA 2R98A 4MBUA 4NGMA 3K2KA 3HLPA 2AFXA 4QBJA 5K8MA 2ZW6A 4JJXA 2QIRA 1EE3P 3D68A 2V8GA 2CNMA 3P2FA 2KCWA 2PJ6A 2V77A 4Q36A 1TY8A 1KUYA 3FECA 4MFPA 4FBEA 2OU2A 1LAPA 1VIXA 4MFLA 4X8IA 5G21A 5EBVA 1TKJA 1Z4EA 3MRUA 3R9GA 4YGOA 5D29A 5FSXA 4JWPA 3GY9A 2LGRA 4ZBGA 1GHEA 2Q0YA 3NFZA 1NSLA 3A9LA 4KVME 4PK3A 2Z3KA 4FUUA 1SPVA 2JDCA 4B5PB 3DR8A 2DXQA 2BL1A 2H5MA 2GE3A 1YW4A 3B7IA 1Z9UA 2IQ6A 3ZZIA 1Q2YA 2VI7A 4AVAA 4QC6A 5HIHA 2NSMA 1M4GA 2QMLA 3K9TA 2BFQA 3JRUA 1MJ9A 2V8HA 4XNHB 5HMNA 4OC5A 3DSBA 2RB7A 1HDQA 2PCUA 4LUAA 3GKRA 5HOLA 2FXFA 3B3VA 5CMSA 2VXKA 3IGRA 3CPXA 2K5TA 3LD2A 3PB6X 1Q2DA 3GPGA 2V8DA 2WZNA 2AFMA 4YFJA 5K8PA 2Z11A 4UA3A 3R1KA 2Q04A 5F46A 2HB6A 2PIZA 2VEZA 4NGNA 2BFRA 1ELMP 2FIWA 4A95A 4WWVA 5CBMA 4TNUA 4E2AA 2WPWA 4RUHA 1SQHA 1NMTA 4Y49C 3FBUA 3FIXA 2D4OA 4P4IA 4EFDA 2Q4ZA 3LODA 3IJ3A 3K9UA 2ARHA 4R8FA 1AUGA 5HH1A 4KS9A 4GVVA 1KUXA 1ZG9A 1F2OA 1Z4RA 5HVGA 3SI0A 2KQVA 1S5KA 3DDDA 2R8VA 4K3NA 4NGTA 2FXKA 4NGPA 1PCAA 2PJ7A 3KHZA 2F7VA 1LAMA 2ZEHA 4R57A 2C6PA 3SJFA 4OKOA 4H89A 4X5KA 2JEVA 4MXUA 2VZZA 3PZJA 4UEEA 3EWRA 5DWNA 3IU2A 3VWEA 4CGPA 3UY5A 1ARLA 1CBXA 2CTCA 2Z3NA 1LANA 2ZEOA 2PJ4A 4E8OA 1ARMA 3WC6A 2C27A 2OR4A 2JBJA 1B6BA 3D3SA 3FX6A 4NFRA 5LRJA 5LYDA 3FF3A 1LRZA 3H8GA 4BD9A 1LCPA 1CP7A 4MCQA 4GVWA 5EMIA 4CYNA 4UCNA 1WWZA 3LACA 4L8AA 3GPQA 3NA6A 4J5SA 3KQZA 3PGPA 4P4BA 1RTQA 3QAYA 4M85A 4MJ8A 1XBUA 1YSJA 4QB9A 4NJQA 4MHPA 1TXZA 4H2KA 4P4DA 5DWMA 3GQEA 2JEWA 4KOUA 2VRIA 1YVOA 4TWEA 3B2YA 3FMCA 4F0YA 2W2GA 1CG2A 4KOWA 1J4JA 2Z3MA 1I1DA 4NXYA 4CRZB 1VHEA 2JZDA 2AFUA 1OBRA 2PDOA 3QNVA 2FIAA 2YNCC 1N71A 4KOTA 3LMSA 4OLLA 4AG7A 4Z65A 4ABKA 5C82A 3V7ZA 4MCPA 1YLEA 1IIDA 2GFQA 4R87A 4B10A 4D86A 1DTDA 4O23A 5LYIA 1LOKA 4MFQA 3PP9A
chains in the Genus database with same CATH topology
3V38A 3SIGA 4OC3A 5CB3A 2QJ8A 2HC9A 1QQ9A 3BHXA 1CX8A 2EEEA 1M4LA 1IGBA 2BOAA 2PVWA 2AFCA 2AFSA 2C6GA 2ZEMA 3B35A 1TF9A 1BLLE 2ANPA 3D67A 3RZAA 3WABA 3PB7X 4ONWA 3VATA 1AMPA 1F2PA 2PJ5A 4MRIA 2PJCA 5JGFA 4PQAA 4OC0A 3VH9A 3PB4X 5LYFA 3EKEA 1LFWA 1VHOA 3D4UA 1ZG8A 1ZR5A 3D7GA 3EW5A 4NJRA 2ZEDA 4KYBA 4P4EA 3Q6ZA 4W9YA 4F8ZA 2PJ9A 3LWUA 4OMEA 3NH5A 1XJOA 2QYVA 4R7MA 2PE3A 4MHNA 3GQOA 4UEFA 1XMBA 1GYTA 8CPAA 3ETIA 3FJUA 2L8RA 3EWOA 4YU9A 2ZEFA 2FG1A 4NGQA 3SI2A 1HJZA 2ZEEA 2PJBA 3T8WA 3ISXA 4PXBA 3RAMA 4FAIA 5FSVA 4ZY2A 5K8NA 4MMOA 5FSUA 1TKFA 1DE4C 3JZTA 4NGRA 4J4ZA 4P44A 2PJ8A 2DEAA 4R76A 1BPMA 4P6YA 4X2TA 3Q71A 4OC1A 3EJGA 4DYOA 5K8OA 1Z8LA 2PJ3A 3SI1A 4JZ0A 4EMEA 3IIFA 3FEDA 2ZELA 3D7HA 1ZG7A 2AFWA 1YD9A 3PB9X 3L2NA 2PJ1A 5CB5A 1TF8A 1ZLIA 4IQYA 3VARA 4MHYA 4UIAA 3PBBA 3D66A 4F9VA 1ZR3A 4GUAA 3H8EA 4WJBA 3V2BA 5HVHA 4ABLA 4PXEA 1VGYA 3CDXA 3VFQA 3FEEA 4ZX9A 4DUKA 4MCRA 2QVPA 2GLFA 3MN8A 4EWTA 1PYTB 2VL1A 4PXCA 3KR5A 5LYLA 3I1UA 2IJZA 2OOTA 3EJFA 1YMEA 4OIWA 4F9UA 1IY7A 7CPAA 5ELYA 2XEJA 2CIJA 3TX8A 5IB9A 5AILA 4ZYQA 3V45A 1ZLHA 3GB0A 2O4HA 4YWYA 1BPNA 1XFOA 4JCAA 3RBUA 4UEZA 3D7FA 2WYRA 3B3SA 2AFZA 2FVGA 4FWUA 2ZOFA 3D7DA 3WC7A 2ABZA 4B6ZA 4MHZA 3SJEA 6CPAA 3NH8A 4A94A 3KZWA 3PB8X 2FAVA 2XEFA 4K0CA 4ZY0A 3WC5A 3KGQA 3PFOA 1F57A 3KR4A 3IWWA 4MCSA 4NGSA 1UWYA 2XEGA 5D8NA 4A39A 4J5RA 1R43A 3IC1A 4CPAA 2V8VA 2ZOGA 4Q7AA 2DX6A 3B3CA 1CPXA 1HDUA 4JGKA 3KL9A 2X47A 3EWQA 3S9LA 5J1QA 5LRKA 3SJGA 1Q7LA 2ACFA 2JBKA 4TU0A 2NYQA 3B3TA 4ETJA 3IFEA 5HXDA 1Y0YA 2Q43A 4P45A 4ZY1A 4LQGA 2CTBA 4A37A 1HEEA 2POKA 4OC2A 5FSYA 3KHXA 1YLOA 4KSIA 1FT7A 1Z2LA 3CPAA 4AXVA 4R6TA 1ELLP 2PJAA 4P10A 3N5FA 1H8LA 3DLJA 2IMOA 4X3RA 2J9AA 4J5QA 2EWBA 1KWMA 3SIHA 3B3WA 5JH9A 1CP6A 5DUSA 4P4JA 3IEHA 4JYWA 4GM5A 4JVVA 1TKHA 2GREA 4OIDA 1VHUA 3FH4A 2PIYA 3IIBA 3SIIA 4DJLA 4UMLA 1FNOA 4G1PA 1Z5RA 3BXMA 1Y7EA 3GUXA 3SJXA 2EK9A 3GLJA 3PFEA 1AYEA 2EK8A 4UF4A 2GLJA 3FVLA 3EWPA 1NSAA 5FSZA 2PJ2A 3HUVA 5JM6A 1JQGA 2PJ0A 1BAVA 2ZEGA 4UIBA 4ETKA 4ZI6A 3GPOA 5LRGA 3H8FA 1NJRA 2C6CA 5THWA 4PPZA 3BI0A 3ISZA 3CT9A 2ZENA 2F8HA 2I3CA 2G9DA 3KI9A 2XD7A 3TC8A 1YW6A 2PVVA 2GU2A 5F09A 4ESSA 2C1CA 3KQXA 4P4FA 4OP4A 3SIJA 2RFHA 3DGVA 1R3NA 3PEIA 1QMUA 1TXRA 2AFOA 5I4MA 2BO9A 4IK2A 2CF4A 4IHMA 2PRQA 2XEIA 3PBEA 5DS0A 3BI1A 4JLLA 4ZX8A 1Y0RA 3IIDA 1XRYA 3S9NA 1CPSA 5CPAA 2O53A 5HVFA 3S9MA 2Q51A 3IO1A 2BCOA 5E3BA 4OC4A 3PRTA 3KASA 4IAVA 2ZEPA 3WT4A 4PXDA 3NH4A 4NGMA 3K2KA 3HLPA 2AFXA 5K8MA 1EE3P 3D68A 2V8GA 2PJ6A 2V77A 1TY8A 3FECA 4FBEA 1LAPA 1VIXA 4X8IA 1TKJA 3MRUA 5D29A 5FSXA 2LGRA 3NFZA 4FUUA 1SPVA 1YW4A 3B7IA 2IQ6A 5HIHA 2NSMA 3K9TA 2BFQA 3JRUA 2V8HA 4OC5A 2RB7A 1HDQA 2PCUA 5HOLA 3B3VA 5CMSA 3CPXA 3PB6X 3GPGA 2V8DA 2WZNA 2AFMA 5K8PA 2HB6A 2PIZA 4NGNA 2BFRA 1ELMP 4WWVA 5CBMA 4TNUA 4RUHA 4P4IA 4EFDA 2Q4ZA 3IJ3A 4R8FA 4GVVA 1ZG9A 1F2OA 5HVGA 3SI0A 4NGTA 4K3NA 2FXKA 4NGPA 1PCAA 2PJ7A 3KHZA 2F7VA 1LAMA 2ZEHA 2C6PA 3SJFA 4OKOA 4MXUA 4UEEA 3EWRA 1ARLA 1CBXA 2CTCA 1LANA 2ZEOA 2PJ4A 1ARMA 3WC6A 2OR4A 5LYDA 2JBJA 4NFRA 3FX6A 5LRJA 4A38A 3FF3A 4BD9A 3H8GA 1LCPA 1CP7A 4MCQA 4GVWA 3GPQA 3NA6A 4J5SA 3KQZA 4P4BA 1RTQA 1XBUA 1YSJA 4NJQA 4MHPA 1TXZA 4H2KA 4P4DA 3GQEA 2JEWA 4TWEA 2VRIA 3B2YA 3FMCA 1CG2A 1VHEA 2AFUA 1OBRA 3QNVA 3LMSA 4Z65A 4ABKA 3V7ZA 4MCPA 4D86A 1DTDA 4O23A 5LYIA 1LOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V38 A;  3SIG A;  4OC3 A;  5CB3 A;  2QJ8 A;  2HC9 A;  1QQ9 A;  3BHX A;  1CX8 A;  2EEE A;  1M4L A;  1IGB A;  2BOA A;  2PVW A;  2AFC A;  2AFS A;  2C6G A;  2ZEM A;  3B35 A;  1TF9 A;  1BLL E;  2ANP A;  3D67 A;  3RZA A;  3WAB A;  3PB7 X;  4ONW A;  3VAT A;  1AMP A;  1F2P A;  2PJ5 A;  4MRI A;  2PJC A;  5JGF A;  4PQA A;  4OC0 A;  3VH9 A;  3PB4 X;  5LYF A;  3EKE A;  1LFW A;  1VHO A;  3D4U A;  1ZG8 A;  1ZR5 A;  3D7G A;  3EW5 A;  4NJR A;  2ZED A;  4KYB A;  4P4E A;  3Q6Z A;  4W9Y A;  4F8Z A;  2PJ9 A;  3LWU A;  4OME A;  3NH5 A;  1XJO A;  2QYV A;  4R7M A;  2PE3 A;  4MHN A;  3GQO A;  4UEF A;  1XMB A;  1GYT A;  8CPA A;  3ETI A;  3FJU A;  2L8R A;  3EWO A;  4YU9 A;  2ZEF A;  2FG1 A;  4NGQ A;  3SI2 A;  1HJZ A;  2ZEE A;  2PJB A;  3T8W A;  3ISX A;  4PXB A;  3RAM A;  4FAI A;  5FSV A;  4ZY2 A;  5K8N A;  4MMO A;  5FSU A;  1TKF A;  1DE4 C;  3JZT A;  4NGR A;  4J4Z A;  4P44 A;  2PJ8 A;  2DEA A;  4R76 A;  1BPM A;  4P6Y A;  4X2T A;  3Q71 A;  4OC1 A;  3EJG A;  4DYO A;  5K8O A;  1Z8L A;  2PJ3 A;  3SI1 A;  4JZ0 A;  4EME A;  3IIF A;  3FED A;  2ZEL A;  3D7H A;  1ZG7 A;  2AFW A;  1YD9 A;  3PB9 X;  3L2N A;  2PJ1 A;  5CB5 A;  1TF8 A;  1ZLI A;  4IQY A;  3VAR A;  4MHY A;  4UIA A;  3PBB A;  3D66 A;  4F9V A;  1ZR3 A;  4GUA A;  3H8E A;  4WJB A;  3V2B A;  5HVH A;  4ABL A;  4PXE A;  1VGY A;  3CDX A;  3VFQ A;  3FEE A;  4ZX9 A;  4DUK A;  4MCR A;  2QVP A;  2GLF A;  3MN8 A;  4EWT A;  1PYT B;  2VL1 A;  4PXC A;  3KR5 A;  5LYL A;  3I1U A;  2IJZ A;  2OOT A;  3EJF A;  1YME A;  4OIW A;  4F9U A;  1IY7 A;  7CPA A;  5ELY A;  2XEJ A;  2CIJ A;  3TX8 A;  5IB9 A;  5AIL A;  4ZYQ A;  3V45 A;  1ZLH A;  3GB0 A;  2O4H A;  4YWY A;  1BPN A;  1XFO A;  4JCA A;  3RBU A;  4UEZ A;  3D7F A;  2WYR A;  3B3S A;  2AFZ A;  2FVG A;  4FWU A;  2ZOF A;  3D7D A;  3WC7 A;  2ABZ A;  4B6Z A;  4MHZ A;  3SJE A;  6CPA A;  3NH8 A;  4A94 A;  3KZW A;  3PB8 X;  2FAV A;  2XEF A;  4K0C A;  4ZY0 A;  3WC5 A;  3KGQ A;  3PFO A;  1F57 A;  3KR4 A;  3IWW A;  4MCS A;  4NGS A;  1UWY A;  2XEG A;  5D8N A;  4A39 A;  4J5R A;  1R43 A;  3IC1 A;  4CPA A;  2V8V A;  2ZOG A;  4Q7A A;  2DX6 A;  3B3C A;  1CPX A;  1HDU A;  4JGK A;  3KL9 A;  2X47 A;  3EWQ A;  3S9L A;  5J1Q A;  5LRK A;  3SJG A;  1Q7L A;  2ACF A;  2JBK A;  4TU0 A;  2NYQ A;  3B3T A;  4ETJ A;  3IFE A;  5HXD A;  1Y0Y A;  2Q43 A;  4P45 A;  4ZY1 A;  4LQG A;  2CTB A;  4A37 A;  1HEE A;  2POK A;  4OC2 A;  5FSY A;  3KHX A;  1YLO A;  4KSI A;  1FT7 A;  1Z2L A;  3CPA A;  4AXV A;  4R6T A;  1ELL P;  2PJA A;  4P10 A;  3N5F A;  1H8L A;  3DLJ A;  2IMO A;  4X3R A;  2J9A A;  4J5Q A;  2EWB A;  1KWM A;  3SIH A;  3B3W A;  5JH9 A;  1CP6 A;  5DUS A;  4P4J A;  3IEH A;  4JYW A;  4GM5 A;  4JVV A;  1TKH A;  2GRE A;  4OID A;  1VHU A;  3FH4 A;  2PIY A;  3IIB A;  3SII A;  4DJL A;  4UML A;  1FNO A;  4G1P A;  1Z5R A;  3BXM A;  1Y7E A;  3GUX A;  3SJX A;  2EK9 A;  3GLJ A;  3PFE A;  1AYE A;  2EK8 A;  4UF4 A;  2GLJ A;  3FVL A;  3EWP A;  1NSA A;  5FSZ A;  2PJ2 A;  3HUV A;  5JM6 A;  1JQG A;  2PJ0 A;  1BAV A;  2ZEG A;  4UIB A;  4ETK A;  4ZI6 A;  3GPO A;  5LRG A;  3H8F A;  1NJR A;  2C6C A;  5THW A;  4PPZ A;  3BI0 A;  3ISZ A;  3CT9 A;  2ZEN A;  2F8H A;  2I3C A;  2G9D A;  3KI9 A;  2XD7 A;  3TC8 A;  1YW6 A;  2PVV A;  2GU2 A;  5F09 A;  4ESS A;  2C1C A;  3KQX A;  4P4F A;  4OP4 A;  3SIJ A;  2RFH A;  3DGV A;  1R3N A;  3PEI A;  1QMU A;  1TXR A;  2AFO A;  5I4M A;  2BO9 A;  4IK2 A;  2CF4 A;  4IHM A;  2PRQ A;  2XEI A;  3PBE A;  5DS0 A;  3BI1 A;  4JLL A;  4ZX8 A;  1Y0R A;  3IID A;  1XRY A;  3S9N A;  1CPS A;  5CPA A;  2O53 A;  5HVF A;  3S9M A;  2Q51 A;  3IO1 A;  2BCO A;  5E3B A;  4OC4 A;  3PRT A;  3KAS A;  4IAV A;  2ZEP A;  3WT4 A;  4PXD A;  3NH4 A;  4NGM A;  3K2K A;  3HLP A;  2AFX A;  5K8M A;  1EE3 P;  3D68 A;  2V8G A;  2PJ6 A;  2V77 A;  1TY8 A;  3FEC A;  4FBE A;  1LAP A;  1VIX A;  4X8I A;  1TKJ A;  3MRU A;  5D29 A;  5FSX A;  2LGR A;  3NFZ A;  4FUU A;  1SPV A;  1YW4 A;  3B7I A;  2IQ6 A;  5HIH A;  2NSM A;  3K9T A;  2BFQ A;  3JRU A;  2V8H A;  4OC5 A;  2RB7 A;  1HDQ A;  2PCU A;  5HOL A;  3B3V A;  5CMS A;  3CPX A;  3PB6 X;  3GPG A;  2V8D A;  2WZN A;  2AFM A;  5K8P A;  2HB6 A;  2PIZ A;  4NGN A;  2BFR A;  1ELM P;  4WWV A;  5CBM A;  4TNU A;  4RUH A;  4P4I A;  4EFD A;  2Q4Z A;  3IJ3 A;  4R8F A;  4GVV A;  1ZG9 A;  1F2O A;  5HVG A;  3SI0 A;  4NGT A;  4K3N A;  2FXK A;  4NGP A;  1PCA A;  2PJ7 A;  3KHZ A;  2F7V A;  1LAM A;  2ZEH A;  2C6P A;  3SJF A;  4OKO A;  4MXU A;  4UEE A;  3EWR A;  1ARL A;  1CBX A;  2CTC A;  1LAN A;  2ZEO A;  2PJ4 A;  1ARM A;  3WC6 A;  2OR4 A;  5LYD A;  2JBJ A;  4NFR A;  3FX6 A;  5LRJ A;  4A38 A;  3FF3 A;  4BD9 A;  3H8G A;  1LCP A;  1CP7 A;  4MCQ A;  4GVW A;  3GPQ A;  3NA6 A;  4J5S A;  3KQZ A;  4P4B A;  1RTQ A;  1XBU A;  1YSJ A;  4NJQ A;  4MHP A;  1TXZ A;  4H2K A;  4P4D A;  3GQE A;  2JEW A;  4TWE A;  2VRI A;  3B2Y A;  3FMC A;  1CG2 A;  1VHE A;  2AFU A;  1OBR A;  3QNV A;  3LMS A;  4Z65 A;  4ABK A;  3V7Z A;  4MCP A;  4D86 A;  1DTD A;  4O23 A;  5LYI A;  1LOK A; 
#chains in the Genus database with same CATH topology
 3V38 A;  3SIG A;  4OC3 A;  4CAW A;  1TIQ A;  5CB3 A;  2QJ8 A;  1K4J A;  2HC9 A;  1QQ9 A;  4NF1 A;  5FVJ A;  4PSX A;  4MFJ A;  3IU1 A;  3BHX A;  1CX8 A;  4CAX A;  2EEE A;  1B87 A;  1IGB A;  1M4L A;  2BOA A;  4I49 A;  2PVW A;  2AFC A;  5F47 A;  4B11 A;  2GAN A;  2AFS A;  2Z0Z A;  4F6A A;  2C6G A;  2ZEM A;  1Q2C A;  1ZO0 A;  3B35 A;  1TF9 A;  4FD6 A;  1BLL E;  4XPD B;  2ANP A;  3D67 A;  3RZA A;  3WAB A;  3PB7 X;  2R1I A;  4ZGY B;  4ONW A;  5F48 A;  3VAT A;  4JLY A;  2HV2 A;  3R9F A;  1AMP A;  4IUS A;  4LX9 A;  4XNH C;  4GXH A;  5J8C A;  1F2P A;  2Z3L A;  2PR1 A;  4CGM A;  5H86 A;  4XPL A;  3GYA A;  4H6Z A;  4HPS A;  2PJ5 A;  2IL4 A;  1PU9 A;  4MRI A;  2PJC A;  2I00 A;  5H84 A;  1FY7 A;  4PQA A;  4R3L A;  4CRY B;  5JGF A;  1BOB A;  3R9E A;  5AG5 A;  3TO9 A;  4KOS A;  4OC0 A;  3VH9 A;  3PB4 X;  4KOX A;  4HNX B;  1I12 A;  2P6F A;  4KSA A;  4MI4 A;  4RI1 A;  4UFV A;  5LYF A;  3EKE A;  1LFW A;  5IB0 A;  4J3G A;  1VHO A;  3D4U A;  1ZG8 A;  1S3Z A;  3V8I A;  1ZR5 A;  3D7G A;  3EW5 A;  4NJR A;  2ZED A;  4GS4 A;  2OZH A;  2CXA A;  4KYB A;  4IF5 A;  2VQY A;  2JDD A;  2J8R A;  4KOV A;  4P4E A;  3Q6Z A;  4FD5 A;  4W9Y A;  4F8Z A;  4YRH A;  2PJ9 A;  1M4I A;  3LWU A;  4OME A;  3TO7 A;  3NH5 A;  1XJO A;  2PR8 A;  2QYV A;  1ON0 A;  2ZW5 A;  4R7M A;  3FNC A;  2PE3 A;  2WPX A;  4MHN A;  4UCP A;  3GQO A;  4UEF A;  1XMB A;  1GYT A;  1M4D A;  4AB7 A;  3ETI A;  8CPA A;  3FJU A;  2L8R A;  3EWO A;  3JTK A;  4YU9 A;  2ZEF A;  2FG1 A;  4NGQ A;  3SI2 A;  4CAF A;  1HJZ A;  5ISV A;  3RNZ A;  3N7Z A;  2ZEE A;  3EY5 A;  3D2P A;  2PJB A;  3T8W A;  3ISX A;  4JXR A;  4PXB A;  5JQ4 A;  4CS0 B;  3RAM A;  4FAI A;  5FSV A;  4ZY2 A;  2A4N A;  1MJA A;  4MMO A;  5FSU A;  1TKF A;  4HKF A;  1DE4 C;  3JZT A;  5K8N A;  4H6U A;  3B8G A;  4NGR A;  1IYL A;  4J4Z A;  1KUV A;  2B4D A;  4P44 A;  2PJ8 A;  3S6F A;  4F0X A;  1IOI A;  2DEA A;  3E0K A;  4R76 A;  1BPM A;  2B3U A;  2Q4V A;  5A27 A;  4P6Y A;  2Q4Y A;  4X2T A;  3Q71 A;  4MFZ A;  4KUA A;  2FL4 A;  4OAE A;  4OC1 A;  3EJG A;  4A2Z A;  4DYO A;  5K8O A;  1Z8L A;  2PJ3 A;  3SI1 A;  2PSW A;  4JZ0 A;  4MHD A;  4A33 A;  4EME A;  3IIF A;  3FED A;  2ZEL A;  1Y9K A;  2EBJ A;  1Z8X A;  2Z10 A;  3D7H A;  1ZG7 A;  2AFW A;  4C2Z A;  5IX3 A;  1YD9 A;  1IB1 E;  2WCT A;  3EXN A;  4CAV A;  3PB9 X;  2RNK A;  3L2N A;  4KOR A;  4BBH A;  4HNW B;  2PJ1 A;  4EVY A;  5CB5 A;  1TF8 A;  4KUB A;  4M6G A;  4C7H A;  1ZLI A;  5IV0 A;  4IQY A;  2FS5 A;  3FXT A;  3VAR A;  4MHY A;  4UIA A;  3PBB A;  1VHS A;  1V0C A;  4U9Z A;  3D66 A;  4F9V A;  2GIV A;  1S7L A;  4XPD C;  1ZR3 A;  4GUA A;  5GCN A;  4QVT A;  4UWI A;  3H8E A;  4BMH A;  4BIN A;  2ZW4 A;  3KKW A;  3IWE A;  3V2B A;  1RO5 A;  4WJB A;  4A30 A;  5HVH A;  4ABL A;  4PXE A;  1VGY A;  3CDX A;  3VFQ A;  2PQ8 A;  2DF5 A;  3FEE A;  4ZX9 A;  2AE6 A;  4C2Y A;  2FCK A;  3TCV A;  4L89 A;  4DUK A;  4MCR A;  2EUI A;  4DNC A;  2QVP A;  1CM0 A;  2HUZ A;  2GLF A;  3SXN A;  3NE8 A;  3MN8 A;  4EWT A;  4CGO A;  4B13 A;  1PYT B;  2VL1 A;  4PXC A;  4RS2 A;  4CGL A;  1S7N A;  3KR5 A;  2NMT A;  5LYL A;  3I1U A;  2IJZ A;  5G22 A;  2J8M A;  1QSN A;  2OOT A;  4PSW A;  3EJF A;  3SXO A;  1YME A;  3FYN A;  4OIW A;  4F9U A;  4B5P A;  1IY7 A;  2G3A A;  7CPA A;  1I21 A;  5ELY A;  3G8W A;  2XEJ A;  1XIX A;  3VWD A;  2CIJ A;  3CZX A;  5BWA B;  3TX8 A;  5IB9 A;  5AIL A;  3NE7 A;  4ZYQ A;  2P0W A;  1MJB A;  3W6S A;  2B4D B;  2G3T A;  3V45 A;  1ZLH A;  3TTH A;  3GB0 A;  2O4H A;  4YWY A;  4CYP A;  1XOV A;  4NCZ A;  3RO0 A;  1BPN A;  1XFO A;  2VBQ A;  5KTA A;  4K30 A;  5A28 A;  2BSW A;  4JCA A;  2O28 A;  3H5Z A;  4UEZ A;  3D7F A;  2WYR A;  3R96 A;  1KZF A;  3B3S A;  3RBU A;  4B5O A;  4C7I A;  1VKC A;  2AFZ A;  2B3V A;  2FVG A;  2G0B A;  3G3S A;  1M1D A;  4FWU A;  2ZOF A;  3D7D A;  3TOB A;  3WC7 A;  2ABZ A;  2JZE A;  1X12 A;  4Q38 A;  1U6M A;  4MHZ A;  2ATR A;  2OB0 A;  2YNE A;  3NH8 A;  3SJE A;  4A94 A;  4B6Z A;  2FT0 A;  6CPA A;  3KZW A;  3PB8 X;  2FAV A;  2XEF A;  4K0C A;  4ZY0 A;  2ODF A;  3RYO A;  3EO4 A;  2BEI A;  1XMT A;  3JUW A;  4UFX A;  2Q7B A;  3WC5 A;  3KGQ A;  4R9M A;  1MK4 A;  4MFK A;  4QUS A;  3PFO A;  1Z8T A;  1F57 A;  2B5G A;  2OH1 A;  3S6H A;  3KR4 A;  1YQE A;  3IWW A;  4MCS A;  2RC4 A;  1UWY A;  2XEG A;  1CJW A;  4NGS A;  5D8N A;  2EO8 A;  4A39 A;  4J5R A;  1R43 A;  1BO4 A;  3IC1 A;  4KVO E;  4UWJ A;  2V8V A;  2ZOG A;  2J8N A;  4CPA A;  4Q7A A;  1XF8 A;  1QST A;  4M6I A;  4XPK A;  1YVK A;  2PRB A;  3I9S A;  2DX6 A;  2FSR A;  4UCM A;  3B3C A;  3W6X A;  4AG9 A;  2YGW A;  1WK4 A;  2P6G A;  1CPX A;  1HDU A;  4JGK A;  2P6E A;  3CXP A;  3CXQ A;  3KL9 A;  5AGE A;  1P0H A;  2X47 A;  3EWQ A;  3JVN A;  3S9L A;  5J1Q A;  5LRK A;  3SJG A;  2B58 A;  3MGD A;  1Q7L A;  2JLM A;  2ACF A;  2JBK A;  4TU0 A;  2NYQ A;  3B3T A;  4KZT A;  4ETJ A;  3IFE A;  1QSR A;  5HXD A;  1Y0Y A;  1QSO A;  4KLW A;  2Q43 A;  4P45 A;  4ZY1 A;  5EC4 A;  4LQG A;  4KVX A;  2CTB A;  4AVB A;  4NEX A;  4M6H A;  4A37 A;  2QEC A;  4FD7 A;  1HEE A;  2POK A;  3BJ7 A;  3OWC A;  3IWG A;  4MY3 A;  4OC2 A;  5J8F A;  5FSY A;  3EFA A;  3H4Q A;  3D8P A;  3KHX A;  4U9Y A;  1YLO A;  4KSI A;  2EVN A;  1FT7 A;  1Z2L A;  3CPA A;  4AXV A;  4R6T A;  1ELL P;  2PJA A;  4P10 A;  3N5F A;  3R95 A;  1IOF A;  1H8L A;  2WSA A;  2IMO A;  3DLJ A;  2J9A A;  4X3R A;  5AG7 A;  3BLN A;  4J5Q A;  2YND A;  4ORF A;  2EWB A;  4A32 A;  1KWM A;  3SIH A;  2HQY A;  4OAD A;  4CGN A;  3B3W A;  3F5B A;  4FD4 A;  1PUA A;  5JH9 A;  2CNS A;  1CP6 A;  5DUS A;  2AJ6 A;  3W91 A;  4P4J A;  5G20 A;  3IEH A;  4JYW A;  4GM5 A;  2DPS A;  4JVV A;  1TKH A;  2GRE A;  1IIC A;  1OZP A;  4OID A;  1YR0 A;  2Z3O A;  1Z8W A;  2Z3P A;  1VHU A;  4AVC A;  3S6K A;  3FH4 A;  4JXQ A;  2PIY A;  3IIB A;  2ZPA A;  3SII A;  5KTC A;  4DJL A;  2JZF A;  4UML A;  1FNO A;  4G1P A;  4MY0 A;  1Z5R A;  3BXM A;  3FB3 A;  3TO6 A;  4A31 A;  4JD6 A;  3GIU A;  2YNC A;  1Y7E A;  3GUX A;  4PV6 A;  2D4P A;  2CNT A;  2VZY A;  3T9Y A;  4ONU A;  3SJX A;  2B5G B;  2EK9 A;  2F5I A;  4RN7 A;  3TT2 A;  3EC4 A;  3FRM A;  1JWQ A;  3GLJ A;  4II9 A;  3PFE A;  3ZJ0 A;  1AYE A;  2EK8 A;  4UF4 A;  4KLV A;  4CAE A;  2GLJ A;  3FVL A;  1R57 A;  3SHP A;  3EWP A;  1NSA A;  1XE4 A;  1S60 A;  1Y7R A;  5FSZ A;  2PC1 A;  2PJ2 A;  3WR7 A;  3HUV A;  3TFY A;  2R7H A;  5JM6 A;  2OZU A;  5G1Z A;  1JQG A;  5AG6 A;  2PJ0 A;  1BAV A;  2ZEG A;  1A2Z A;  1XEB A;  4UIB A;  4ETK A;  5I0C A;  3T90 A;  4R3K A;  4ZI6 A;  4B12 A;  1IYK A;  4Y49 B;  3GPO A;  1X10 A;  3C26 A;  3QAH A;  5LRG A;  3TOA A;  3TE4 A;  1IU8 A;  3I3G A;  5JPH A;  4M3S A;  5F49 A;  2I79 A;  3H8F A;  1NJR A;  1NE9 A;  2C6C A;  5THW A;  4PPZ A;  5C88 A;  3BI0 A;  3ISZ A;  3CT9 A;  2X7B A;  2ZEN A;  1UFH A;  1S7K A;  2F8H A;  2G9D A;  2I3C A;  3KI9 A;  2XD7 A;  3TC8 A;  4UFW A;  1S7F A;  1YW6 A;  2PVV A;  2GU2 A;  4HNY B;  5F09 A;  5KTD A;  2WUU A;  2ZW7 A;  4ESS A;  2C1C A;  3KQX A;  4P4F A;  5CNP A;  4UBR A;  1YK3 A;  4OP4 A;  3P2H A;  3SIJ A;  2RFH A;  2ZXV A;  2CY2 A;  3DGV A;  1YRE A;  1R3N A;  3PEI A;  1QMU A;  1TXR A;  2AFO A;  5I4M A;  3BJ8 A;  1YX0 A;  3F0A A;  2BO9 A;  1L0C A;  1M44 A;  1P4N A;  2CF4 A;  4IK2 A;  4IHM A;  2PRQ A;  2B4B A;  2XEI A;  3PBE A;  3QB8 A;  3BI1 A;  4U5Y A;  4JLL A;  5DS0 A;  4ZX8 A;  4PK2 A;  1Y9W A;  4CYQ A;  1Y0R A;  3IID A;  4KSF A;  4LQ6 A;  2Y0M A;  1XRY A;  2BUE A;  4E0A A;  2REE A;  2Q44 A;  1CPS A;  2Q7S A;  5CPA A;  3S9N A;  2FE7 A;  3DNS A;  5E96 A;  3S6G A;  1YGH A;  2O53 A;  3DR6 A;  3F8K A;  5HVF A;  2DPT A;  5AG4 A;  1RXT A;  3S9M A;  2Q51 A;  4NSQ A;  3IO1 A;  2BCO A;  5E3B A;  4OC4 A;  3CXS A;  3PRT A;  3KAS A;  4KOY A;  3D2M A;  4A38 A;  4CYO A;  4IAV A;  4C68 A;  2OZG A;  2ZEP A;  4B14 A;  3WT4 A;  4C2X A;  4PXD A;  2REF A;  3NH4 A;  1QSM A;  2R98 A;  4MBU A;  4NGM A;  3K2K A;  3HLP A;  2AFX A;  4QBJ A;  5K8M A;  2ZW6 A;  4JJX A;  2QIR A;  1EE3 P;  3D68 A;  2V8G A;  2CNM A;  3P2F A;  2KCW A;  2PJ6 A;  2V77 A;  4Q36 A;  1TY8 A;  1KUY A;  3FEC A;  4MFP A;  4FBE A;  2OU2 A;  1LAP A;  1VIX A;  4MFL A;  4X8I A;  5G21 A;  5EBV A;  1TKJ A;  1Z4E A;  3MRU A;  3R9G A;  4YGO A;  5D29 A;  5FSX A;  4JWP A;  3GY9 A;  2LGR A;  4ZBG A;  1GHE A;  2Q0Y A;  3NFZ A;  1NSL A;  3A9L A;  4KVM E;  4PK3 A;  2Z3K A;  4FUU A;  1SPV A;  2JDC A;  4B5P B;  3DR8 A;  2DXQ A;  2BL1 A;  2H5M A;  2GE3 A;  1YW4 A;  3B7I A;  1Z9U A;  2IQ6 A;  3ZZI A;  1Q2Y A;  2VI7 A;  4AVA A;  4QC6 A;  5HIH A;  2NSM A;  1M4G A;  2QML A;  3K9T A;  2BFQ A;  3JRU A;  1MJ9 A;  2V8H A;  4XNH B;  5HMN A;  4OC5 A;  3DSB A;  2RB7 A;  1HDQ A;  2PCU A;  4LUA A;  3GKR A;  5HOL A;  2FXF A;  3B3V A;  5CMS A;  2VXK A;  3IGR A;  3CPX A;  2K5T A;  3LD2 A;  3PB6 X;  1Q2D A;  3GPG A;  2V8D A;  2WZN A;  2AFM A;  4YFJ A;  5K8P A;  2Z11 A;  4UA3 A;  3R1K A;  2Q04 A;  5F46 A;  2HB6 A;  2PIZ A;  2VEZ A;  4NGN A;  2BFR A;  1ELM P;  2FIW A;  4A95 A;  4WWV A;  5CBM A;  4TNU A;  4E2A A;  2WPW A;  4RUH A;  1SQH A;  1NMT A;  4Y49 C;  3FBU A;  3FIX A;  2D4O A;  4P4I A;  4EFD A;  2Q4Z A;  3LOD A;  3IJ3 A;  3K9U A;  2ARH A;  4R8F A;  1AUG A;  5HH1 A;  4KS9 A;  4GVV A;  1KUX A;  1ZG9 A;  1F2O A;  1Z4R A;  5HVG A;  3SI0 A;  2KQV A;  1S5K A;  3DDD A;  2R8V A;  4K3N A;  4NGT A;  2FXK A;  4NGP A;  1PCA A;  2PJ7 A;  3KHZ A;  2F7V A;  1LAM A;  2ZEH A;  4R57 A;  2C6P A;  3SJF A;  4OKO A;  4H89 A;  4X5K A;  2JEV A;  4MXU A;  2VZZ A;  3PZJ A;  4UEE A;  3EWR A;  5DWN A;  3IU2 A;  3VWE A;  4CGP A;  3UY5 A;  1ARL A;  1CBX A;  2CTC A;  2Z3N A;  1LAN A;  2ZEO A;  2PJ4 A;  4E8O A;  1ARM A;  3WC6 A;  2C27 A;  2OR4 A;  2JBJ A;  1B6B A;  3D3S A;  3FX6 A;  4NFR A;  5LRJ A;  5LYD A;  3FF3 A;  1LRZ A;  3H8G A;  4BD9 A;  1LCP A;  1CP7 A;  4MCQ A;  4GVW A;  5EMI A;  4CYN A;  4UCN A;  1WWZ A;  3LAC A;  4L8A A;  3GPQ A;  3NA6 A;  4J5S A;  3KQZ A;  3PGP A;  4P4B A;  1RTQ A;  3QAY A;  4M85 A;  4MJ8 A;  1XBU A;  1YSJ A;  4QB9 A;  4NJQ A;  4MHP A;  1TXZ A;  4H2K A;  4P4D A;  5DWM A;  3GQE A;  2JEW A;  4KOU A;  2VRI A;  1YVO A;  4TWE A;  3B2Y A;  3FMC A;  4F0Y A;  2W2G A;  1CG2 A;  4KOW A;  1J4J A;  2Z3M A;  1I1D A;  4NXY A;  4CRZ B;  1VHE A;  2JZD A;  2AFU A;  1OBR A;  2PDO A;  3QNV A;  2FIA A;  2YNC C;  1N71 A;  4KOT A;  3LMS A;  4OLL A;  4AG7 A;  4Z65 A;  4ABK A;  5C82 A;  3V7Z A;  4MCP A;  1YLE A;  1IID A;  2GFQ A;  4R87 A;  4B10 A;  4D86 A;  1DTD A;  4O23 A;  5LYI A;  1LOK A;  4MFQ A;  3PP9 A; 
#chains in the Genus database with same CATH homology
 3V38 A;  3SIG A;  4OC3 A;  5CB3 A;  2QJ8 A;  2HC9 A;  1QQ9 A;  3BHX A;  1CX8 A;  2EEE A;  1M4L A;  1IGB A;  2BOA A;  2PVW A;  2AFC A;  2AFS A;  2C6G A;  2ZEM A;  3B35 A;  1TF9 A;  1BLL E;  2ANP A;  3D67 A;  3RZA A;  3WAB A;  3PB7 X;  4ONW A;  3VAT A;  1AMP A;  1F2P A;  2PJ5 A;  4MRI A;  2PJC A;  5JGF A;  4PQA A;  4OC0 A;  3VH9 A;  3PB4 X;  5LYF A;  3EKE A;  1LFW A;  1VHO A;  3D4U A;  1ZG8 A;  1ZR5 A;  3D7G A;  3EW5 A;  4NJR A;  2ZED A;  4KYB A;  4P4E A;  3Q6Z A;  4W9Y A;  4F8Z A;  2PJ9 A;  3LWU A;  4OME A;  3NH5 A;  1XJO A;  2QYV A;  4R7M A;  2PE3 A;  4MHN A;  3GQO A;  4UEF A;  1XMB A;  1GYT A;  8CPA A;  3ETI A;  3FJU A;  2L8R A;  3EWO A;  4YU9 A;  2ZEF A;  2FG1 A;  4NGQ A;  3SI2 A;  1HJZ A;  2ZEE A;  2PJB A;  3T8W A;  3ISX A;  4PXB A;  3RAM A;  4FAI A;  5FSV A;  4ZY2 A;  5K8N A;  4MMO A;  5FSU A;  1TKF A;  1DE4 C;  3JZT A;  4NGR A;  4J4Z A;  4P44 A;  2PJ8 A;  2DEA A;  4R76 A;  1BPM A;  4P6Y A;  4X2T A;  3Q71 A;  4OC1 A;  3EJG A;  4DYO A;  5K8O A;  1Z8L A;  2PJ3 A;  3SI1 A;  4JZ0 A;  4EME A;  3IIF A;  3FED A;  2ZEL A;  3D7H A;  1ZG7 A;  2AFW A;  1YD9 A;  3PB9 X;  3L2N A;  2PJ1 A;  5CB5 A;  1TF8 A;  1ZLI A;  4IQY A;  3VAR A;  4MHY A;  4UIA A;  3PBB A;  3D66 A;  4F9V A;  1ZR3 A;  4GUA A;  3H8E A;  4WJB A;  3V2B A;  5HVH A;  4ABL A;  4PXE A;  1VGY A;  3CDX A;  3VFQ A;  3FEE A;  4ZX9 A;  4DUK A;  4MCR A;  2QVP A;  2GLF A;  3MN8 A;  4EWT A;  1PYT B;  2VL1 A;  4PXC A;  3KR5 A;  5LYL A;  3I1U A;  2IJZ A;  2OOT A;  3EJF A;  1YME A;  4OIW A;  4F9U A;  1IY7 A;  7CPA A;  5ELY A;  2XEJ A;  2CIJ A;  3TX8 A;  5IB9 A;  5AIL A;  4ZYQ A;  3V45 A;  1ZLH A;  3GB0 A;  2O4H A;  4YWY A;  1BPN A;  1XFO A;  4JCA A;  3RBU A;  4UEZ A;  3D7F A;  2WYR A;  3B3S A;  2AFZ A;  2FVG A;  4FWU A;  2ZOF A;  3D7D A;  3WC7 A;  2ABZ A;  4B6Z A;  4MHZ A;  3SJE A;  6CPA A;  3NH8 A;  4A94 A;  3KZW A;  3PB8 X;  2FAV A;  2XEF A;  4K0C A;  4ZY0 A;  3WC5 A;  3KGQ A;  3PFO A;  1F57 A;  3KR4 A;  3IWW A;  4MCS A;  4NGS A;  1UWY A;  2XEG A;  5D8N A;  4A39 A;  4J5R A;  1R43 A;  3IC1 A;  4CPA A;  2V8V A;  2ZOG A;  4Q7A A;  2DX6 A;  3B3C A;  1CPX A;  1HDU A;  4JGK A;  3KL9 A;  2X47 A;  3EWQ A;  3S9L A;  5J1Q A;  5LRK A;  3SJG A;  1Q7L A;  2ACF A;  2JBK A;  4TU0 A;  2NYQ A;  3B3T A;  4ETJ A;  3IFE A;  5HXD A;  1Y0Y A;  2Q43 A;  4P45 A;  4ZY1 A;  4LQG A;  2CTB A;  4A37 A;  1HEE A;  2POK A;  4OC2 A;  5FSY A;  3KHX A;  1YLO A;  4KSI A;  1FT7 A;  1Z2L A;  3CPA A;  4AXV A;  4R6T A;  1ELL P;  2PJA A;  4P10 A;  3N5F A;  1H8L A;  3DLJ A;  2IMO A;  4X3R A;  2J9A A;  4J5Q A;  2EWB A;  1KWM A;  3SIH A;  3B3W A;  5JH9 A;  1CP6 A;  5DUS A;  4P4J A;  3IEH A;  4JYW A;  4GM5 A;  4JVV A;  1TKH A;  2GRE A;  4OID A;  1VHU A;  3FH4 A;  2PIY A;  3IIB A;  3SII A;  4DJL A;  4UML A;  1FNO A;  4G1P A;  1Z5R A;  3BXM A;  1Y7E A;  3GUX A;  3SJX A;  2EK9 A;  3GLJ A;  3PFE A;  1AYE A;  2EK8 A;  4UF4 A;  2GLJ A;  3FVL A;  3EWP A;  1NSA A;  5FSZ A;  2PJ2 A;  3HUV A;  5JM6 A;  1JQG A;  2PJ0 A;  1BAV A;  2ZEG A;  4UIB A;  4ETK A;  4ZI6 A;  3GPO A;  5LRG A;  3H8F A;  1NJR A;  2C6C A;  5THW A;  4PPZ A;  3BI0 A;  3ISZ A;  3CT9 A;  2ZEN A;  2F8H A;  2I3C A;  2G9D A;  3KI9 A;  2XD7 A;  3TC8 A;  1YW6 A;  2PVV A;  2GU2 A;  5F09 A;  4ESS A;  2C1C A;  3KQX A;  4P4F A;  4OP4 A;  3SIJ A;  2RFH A;  3DGV A;  1R3N A;  3PEI A;  1QMU A;  1TXR A;  2AFO A;  5I4M A;  2BO9 A;  4IK2 A;  2CF4 A;  4IHM A;  2PRQ A;  2XEI A;  3PBE A;  5DS0 A;  3BI1 A;  4JLL A;  4ZX8 A;  1Y0R A;  3IID A;  1XRY A;  3S9N A;  1CPS A;  5CPA A;  2O53 A;  5HVF A;  3S9M A;  2Q51 A;  3IO1 A;  2BCO A;  5E3B A;  4OC4 A;  3PRT A;  3KAS A;  4IAV A;  2ZEP A;  3WT4 A;  4PXD A;  3NH4 A;  4NGM A;  3K2K A;  3HLP A;  2AFX A;  5K8M A;  1EE3 P;  3D68 A;  2V8G A;  2PJ6 A;  2V77 A;  1TY8 A;  3FEC A;  4FBE A;  1LAP A;  1VIX A;  4X8I A;  1TKJ A;  3MRU A;  5D29 A;  5FSX A;  2LGR A;  3NFZ A;  4FUU A;  1SPV A;  1YW4 A;  3B7I A;  2IQ6 A;  5HIH A;  2NSM A;  3K9T A;  2BFQ A;  3JRU A;  2V8H A;  4OC5 A;  2RB7 A;  1HDQ A;  2PCU A;  5HOL A;  3B3V A;  5CMS A;  3CPX A;  3PB6 X;  3GPG A;  2V8D A;  2WZN A;  2AFM A;  5K8P A;  2HB6 A;  2PIZ A;  4NGN A;  2BFR A;  1ELM P;  4WWV A;  5CBM A;  4TNU A;  4RUH A;  4P4I A;  4EFD A;  2Q4Z A;  3IJ3 A;  4R8F A;  4GVV A;  1ZG9 A;  1F2O A;  5HVG A;  3SI0 A;  4NGT A;  4K3N A;  2FXK A;  4NGP A;  1PCA A;  2PJ7 A;  3KHZ A;  2F7V A;  1LAM A;  2ZEH A;  2C6P A;  3SJF A;  4OKO A;  4MXU A;  4UEE A;  3EWR A;  1ARL A;  1CBX A;  2CTC A;  1LAN A;  2ZEO A;  2PJ4 A;  1ARM A;  3WC6 A;  2OR4 A;  5LYD A;  2JBJ A;  4NFR A;  3FX6 A;  5LRJ A;  4A38 A;  3FF3 A;  4BD9 A;  3H8G A;  1LCP A;  1CP7 A;  4MCQ A;  4GVW A;  3GPQ A;  3NA6 A;  4J5S A;  3KQZ A;  4P4B A;  1RTQ A;  1XBU A;  1YSJ A;  4NJQ A;  4MHP A;  1TXZ A;  4H2K A;  4P4D A;  3GQE A;  2JEW A;  4TWE A;  2VRI A;  3B2Y A;  3FMC A;  1CG2 A;  1VHE A;  2AFU A;  1OBR A;  3QNV A;  3LMS A;  4Z65 A;  4ABK A;  3V7Z A;  4MCP A;  4D86 A;  1DTD A;  4O23 A;  5LYI A;  1LOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...