2WCTA

Human sars coronavirus unique domain (triclinic form)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
264
structure length
257
Chain Sequence
KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLRAPAVVSVSSPDAVTTYNGYLTSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Sars-Unique Domain (Sud) of Sars Coronavirus Contains Two Macrodomains that Bind G-Quadruplexes.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Rna binding protein
molecule keywords NON-STRUCTURAL PROTEIN 3
total genus 77
structure length 257
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11633 SUD-M Single-stranded poly(A) binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2wctA02
3.40.220.30 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2wctA01
2WCTA 2JZFA 2KQVA 2JZEA 2RNKA 2W2GA 2JZDA
chains in the Genus database with same CATH superfamily
3EWQA 5D8NA 2X47A 4ETKA 5FSZA 4IQYA 2ACFA 1BPMA 4ZX8A 2EWBA 2FXKA 3IIFA 4ZX9A 3EWPA 3SIGA 3H8FA 5FSUA 4J4ZA 5CMSA 2KQVA 3IJ3A 2FAVA 3EKEA 1TXZA 3SIJA 3KQZA 3KQXA 1LAPA 4X2TA 3JRUA 1TY8A 1YD9A 3PEIA 3GQEA 4D86A 2RNKA 1VHUA 3IIDA 1ZR3A 5FSXA 3KR4A 3H8GA 4JGKA 4R6TA 2VRIA 1HJZA 3GQOA 3V45A 4K3NA 3SIHA 4R76A 2BFRA 1LANA 3Q6ZA 4GVVA 2JZEA 1GYTA 4KSIA 4ZY2A 2WCTA 3H8EA 4J5RA 3Q71A 3V2BA 2FG1A 4K0CA 3VFQA 4GVWA 4ESSA 3GPOA 4ABKA 3KZWA 2EEEA 5AILA 2DX6A 5E3BA 3KR5A 5FSYA 5CBMA 3SIIA 2J9AA 4ETJA 3EW5A 3T8WA 4R7MA 1LAMA 4UMLA 1LCPA 1ZR5A 2XD7A 3EJGA 4JVVA 2AFCA 4JCAA 4ZY0A 2LGRA 4ABLA 2BFQA 5CB3A 2JZDA 2L8RA 5DUSA 4ZI6A 3GPGA 4ZY1A 4JLLA 3GPQA 3EWOA 2W2GA 5HIHA 3EWRA 4J5SA 1SPVA 1BPNA 5CB5A 4J5QA 3EJFA 4TU0A 4GUAA 3ETIA 5FSVA 5HOLA 3JZTA 4ZYQA 2JZFA 1NJRA 4KYBA 1BLLE
chains in the Genus database with same CATH topology
2WCTA 2JZFA 2KQVA 2JZEA 2RNKA 2W2GA 2JZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCT A;  2JZF A;  2KQV A;  2JZE A;  2RNK A;  2W2G A;  2JZD A; 
#chains in the Genus database with same CATH topology
 3EWQ A;  5D8N A;  2X47 A;  4ETK A;  5FSZ A;  4IQY A;  2ACF A;  1BPM A;  4ZX8 A;  2EWB A;  2FXK A;  3IIF A;  4ZX9 A;  3EWP A;  3SIG A;  3H8F A;  5FSU A;  4J4Z A;  5CMS A;  2KQV A;  3IJ3 A;  2FAV A;  3EKE A;  1TXZ A;  3SIJ A;  3KQZ A;  3KQX A;  1LAP A;  4X2T A;  3JRU A;  1TY8 A;  1YD9 A;  3PEI A;  3GQE A;  4D86 A;  2RNK A;  1VHU A;  3IID A;  1ZR3 A;  5FSX A;  3KR4 A;  3H8G A;  4JGK A;  4R6T A;  2VRI A;  1HJZ A;  3GQO A;  3V45 A;  4K3N A;  3SIH A;  4R76 A;  2BFR A;  1LAN A;  3Q6Z A;  4GVV A;  2JZE A;  1GYT A;  4KSI A;  4ZY2 A;  2WCT A;  3H8E A;  4J5R A;  3Q71 A;  3V2B A;  2FG1 A;  4K0C A;  3VFQ A;  4GVW A;  4ESS A;  3GPO A;  4ABK A;  3KZW A;  2EEE A;  5AIL A;  2DX6 A;  5E3B A;  3KR5 A;  5FSY A;  5CBM A;  3SII A;  2J9A A;  4ETJ A;  3EW5 A;  3T8W A;  4R7M A;  1LAM A;  4UML A;  1LCP A;  1ZR5 A;  2XD7 A;  3EJG A;  4JVV A;  2AFC A;  4JCA A;  4ZY0 A;  2LGR A;  4ABL A;  2BFQ A;  5CB3 A;  2JZD A;  2L8R A;  5DUS A;  4ZI6 A;  3GPG A;  4ZY1 A;  4JLL A;  3GPQ A;  3EWO A;  2W2G A;  5HIH A;  3EWR A;  4J5S A;  1SPV A;  1BPN A;  5CB5 A;  4J5Q A;  3EJF A;  4TU0 A;  4GUA A;  3ETI A;  5FSV A;  5HOL A;  3JZT A;  4ZYQ A;  2JZF A;  1NJR A;  4KYB A;  1BLL E; 
#chains in the Genus database with same CATH homology
 2WCT A;  2JZF A;  2KQV A;  2JZE A;  2RNK A;  2W2G A;  2JZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...