4TU0A

Crystal structure of chikungunya virus nsp3 macro domain in complex with a 2'-5' oligoadenylate trimer
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
160
Chain Sequence
HHAPSYVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYSESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF CHIKUNGUNYA VIRUS NSP3 MACRO DOMAIN IN COMPLEX WITH A 2'-5' OLIGOADENYLATE TRIMER
rcsb
source organism Chikungunya virus
molecule tags Viral protein
molecule keywords Non-structural polyprotein 3
total genus 53
structure length 160
sequence length 162
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4tu0A00
1LANA 3H8FA 4D86A 1SPVA 3SIGA 4ESSA 1VHUA 3GPOA 4ZX8A 4ZY1A 4UMLA 3V2BA 2FAVA 3KQXA 3V45A 3SIJA 2EEEA 4KSIA 2DX6A 5FSYA 4GVVA 3KQZA 5AILA 4ZX9A 3KR4A 3EJGA 2X47A 3SIIA 2J9AA 4ZY0A 4TU0A 5CB5A 1BLLE 4J5RA 2ACFA 3Q6ZA 3EJFA 3EWQA 3EW5A 4GVWA 3GQEA 5CMSA 1HJZA 4ZI6A 3PEIA 2LGRA 3H8EA 4R7MA 1LCPA 5CB3A 2VRIA 3JZTA 3EWOA 4ETKA 4JLLA 4ABLA 5HOLA 3EWPA 3EWRA 5FSVA 4ZY2A 2FXKA 3EKEA 3VFQA 4GUAA 4ABKA 2AFCA 4J4ZA 4J5QA 1LAPA 2EWBA 5HIHA 1ZR3A 2BFQA 2FG1A 3KR5A 4ETJA 4R76A 1TY8A 5FSZA 5FSUA 4JCAA 4ZYQA 3SIHA 4K0CA 5DUSA 2XD7A 3GPGA 3GQOA 1TXZA 5D8NA 4IQYA 1ZR5A 4R6TA 3ETIA 1YD9A 3IIFA 3T8WA 5E3BA 3IIDA 1BPMA 5CBMA 3GPQA 4X2TA 1LAMA 4J5SA 4K3NA 3H8GA 2L8RA 4JVVA 3KZWA 4KYBA 1NJRA 4JGKA 3IJ3A 1GYTA 3Q71A 2BFRA 3JRUA 5FSXA 1BPNA
chains in the Genus database with same CATH superfamily
1LANA 3H8FA 4D86A 1SPVA 3SIGA 4ESSA 1VHUA 3GPOA 4ZX8A 4ZY1A 4UMLA 3V2BA 2FAVA 3KQXA 3V45A 3SIJA 2EEEA 4KSIA 2DX6A 5FSYA 4GVVA 3KQZA 5AILA 4ZX9A 3KR4A 3EJGA 2X47A 3SIIA 2J9AA 4ZY0A 4TU0A 5CB5A 1BLLE 2RNKA 4J5RA 2ACFA 3Q6ZA 2W2GA 3EJFA 3EWQA 3EW5A 4GVWA 3GQEA 5CMSA 1HJZA 4ZI6A 3PEIA 2LGRA 3H8EA 4R7MA 1LCPA 5CB3A 2VRIA 3JZTA 3EWOA 4ETKA 4JLLA 4ABLA 5HOLA 3EWPA 3EWRA 5FSVA 4ZY2A 2FXKA 3EKEA 3VFQA 4GUAA 4ABKA 2AFCA 4J4ZA 4J5QA 1LAPA 2EWBA 5HIHA 1ZR3A 2BFQA 2FG1A 3KR5A 2JZEA 4ETJA 4R76A 1TY8A 5FSZA 5FSUA 4JCAA 4ZYQA 2JZFA 3SIHA 4K0CA 5DUSA 2XD7A 3GPGA 3GQOA 1TXZA 5D8NA 2JZDA 4IQYA 1ZR5A 2WCTA 4R6TA 3ETIA 1YD9A 3IIFA 3T8WA 5E3BA 3IIDA 1BPMA 5CBMA 3GPQA 4X2TA 1LAMA 4J5SA 4K3NA 3H8GA 2L8RA 4JVVA 3KZWA 4KYBA 1NJRA 4JGKA 2KQVA 3IJ3A 1GYTA 3Q71A 2BFRA 3JRUA 5FSXA 1BPNA
chains in the Genus database with same CATH topology
1LANA 3H8FA 4D86A 1SPVA 3SIGA 4ESSA 1VHUA 3GPOA 4ZX8A 4ZY1A 4UMLA 3V2BA 2FAVA 3KQXA 3V45A 3SIJA 2EEEA 4KSIA 2DX6A 5FSYA 4GVVA 3KQZA 5AILA 4ZX9A 3KR4A 3EJGA 2X47A 3SIIA 2J9AA 4ZY0A 4TU0A 5CB5A 1BLLE 4J5RA 2ACFA 3Q6ZA 3EJFA 3EWQA 3EW5A 4GVWA 3GQEA 5CMSA 1HJZA 4ZI6A 3PEIA 2LGRA 3H8EA 4R7MA 1LCPA 5CB3A 2VRIA 3JZTA 3EWOA 4ETKA 4JLLA 4ABLA 5HOLA 3EWPA 3EWRA 5FSVA 4ZY2A 2FXKA 3EKEA 3VFQA 4GUAA 4ABKA 2AFCA 4J4ZA 4J5QA 1LAPA 2EWBA 5HIHA 1ZR3A 2BFQA 2FG1A 3KR5A 4ETJA 4R76A 1TY8A 5FSZA 5FSUA 4JCAA 4ZYQA 3SIHA 4K0CA 5DUSA 2XD7A 3GPGA 3GQOA 1TXZA 5D8NA 4IQYA 1ZR5A 4R6TA 3ETIA 1YD9A 3IIFA 3T8WA 5E3BA 3IIDA 1BPMA 5CBMA 3GPQA 4X2TA 1LAMA 4J5SA 4K3NA 3H8GA 2L8RA 4JVVA 3KZWA 4KYBA 1NJRA 4JGKA 3IJ3A 1GYTA 3Q71A 2BFRA 3JRUA 5FSXA 1BPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAN A;  3H8F A;  4D86 A;  1SPV A;  3SIG A;  4ESS A;  1VHU A;  3GPO A;  4ZX8 A;  4ZY1 A;  4UML A;  3V2B A;  2FAV A;  3KQX A;  3V45 A;  3SIJ A;  2EEE A;  4KSI A;  2DX6 A;  5FSY A;  4GVV A;  3KQZ A;  5AIL A;  4ZX9 A;  3KR4 A;  3EJG A;  2X47 A;  3SII A;  2J9A A;  4ZY0 A;  4TU0 A;  5CB5 A;  1BLL E;  4J5R A;  2ACF A;  3Q6Z A;  3EJF A;  3EWQ A;  3EW5 A;  4GVW A;  3GQE A;  5CMS A;  1HJZ A;  4ZI6 A;  3PEI A;  2LGR A;  3H8E A;  4R7M A;  1LCP A;  5CB3 A;  2VRI A;  3JZT A;  3EWO A;  4ETK A;  4JLL A;  4ABL A;  5HOL A;  3EWP A;  3EWR A;  5FSV A;  4ZY2 A;  2FXK A;  3EKE A;  3VFQ A;  4GUA A;  4ABK A;  2AFC A;  4J4Z A;  4J5Q A;  1LAP A;  2EWB A;  5HIH A;  1ZR3 A;  2BFQ A;  2FG1 A;  3KR5 A;  4ETJ A;  4R76 A;  1TY8 A;  5FSZ A;  5FSU A;  4JCA A;  4ZYQ A;  3SIH A;  4K0C A;  5DUS A;  2XD7 A;  3GPG A;  3GQO A;  1TXZ A;  5D8N A;  4IQY A;  1ZR5 A;  4R6T A;  3ETI A;  1YD9 A;  3IIF A;  3T8W A;  5E3B A;  3IID A;  1BPM A;  5CBM A;  3GPQ A;  4X2T A;  1LAM A;  4J5S A;  4K3N A;  3H8G A;  2L8R A;  4JVV A;  3KZW A;  4KYB A;  1NJR A;  4JGK A;  3IJ3 A;  1GYT A;  3Q71 A;  2BFR A;  3JRU A;  5FSX A;  1BPN A; 
#chains in the Genus database with same CATH topology
 1LAN A;  3H8F A;  4D86 A;  1SPV A;  3SIG A;  4ESS A;  1VHU A;  3GPO A;  4ZX8 A;  4ZY1 A;  4UML A;  3V2B A;  2FAV A;  3KQX A;  3V45 A;  3SIJ A;  2EEE A;  4KSI A;  2DX6 A;  5FSY A;  4GVV A;  3KQZ A;  5AIL A;  4ZX9 A;  3KR4 A;  3EJG A;  2X47 A;  3SII A;  2J9A A;  4ZY0 A;  4TU0 A;  5CB5 A;  1BLL E;  2RNK A;  4J5R A;  2ACF A;  3Q6Z A;  2W2G A;  3EJF A;  3EWQ A;  3EW5 A;  4GVW A;  3GQE A;  5CMS A;  1HJZ A;  4ZI6 A;  3PEI A;  2LGR A;  3H8E A;  4R7M A;  1LCP A;  5CB3 A;  2VRI A;  3JZT A;  3EWO A;  4ETK A;  4JLL A;  4ABL A;  5HOL A;  3EWP A;  3EWR A;  5FSV A;  4ZY2 A;  2FXK A;  3EKE A;  3VFQ A;  4GUA A;  4ABK A;  2AFC A;  4J4Z A;  4J5Q A;  1LAP A;  2EWB A;  5HIH A;  1ZR3 A;  2BFQ A;  2FG1 A;  3KR5 A;  2JZE A;  4ETJ A;  4R76 A;  1TY8 A;  5FSZ A;  5FSU A;  4JCA A;  4ZYQ A;  2JZF A;  3SIH A;  4K0C A;  5DUS A;  2XD7 A;  3GPG A;  3GQO A;  1TXZ A;  5D8N A;  2JZD A;  4IQY A;  1ZR5 A;  2WCT A;  4R6T A;  3ETI A;  1YD9 A;  3IIF A;  3T8W A;  5E3B A;  3IID A;  1BPM A;  5CBM A;  3GPQ A;  4X2T A;  1LAM A;  4J5S A;  4K3N A;  3H8G A;  2L8R A;  4JVV A;  3KZW A;  4KYB A;  1NJR A;  4JGK A;  2KQV A;  3IJ3 A;  1GYT A;  3Q71 A;  2BFR A;  3JRU A;  5FSX A;  1BPN A; 
#chains in the Genus database with same CATH homology
 1LAN A;  3H8F A;  4D86 A;  1SPV A;  3SIG A;  4ESS A;  1VHU A;  3GPO A;  4ZX8 A;  4ZY1 A;  4UML A;  3V2B A;  2FAV A;  3KQX A;  3V45 A;  3SIJ A;  2EEE A;  4KSI A;  2DX6 A;  5FSY A;  4GVV A;  3KQZ A;  5AIL A;  4ZX9 A;  3KR4 A;  3EJG A;  2X47 A;  3SII A;  2J9A A;  4ZY0 A;  4TU0 A;  5CB5 A;  1BLL E;  4J5R A;  2ACF A;  3Q6Z A;  3EJF A;  3EWQ A;  3EW5 A;  4GVW A;  3GQE A;  5CMS A;  1HJZ A;  4ZI6 A;  3PEI A;  2LGR A;  3H8E A;  4R7M A;  1LCP A;  5CB3 A;  2VRI A;  3JZT A;  3EWO A;  4ETK A;  4JLL A;  4ABL A;  5HOL A;  3EWP A;  3EWR A;  5FSV A;  4ZY2 A;  2FXK A;  3EKE A;  3VFQ A;  4GUA A;  4ABK A;  2AFC A;  4J4Z A;  4J5Q A;  1LAP A;  2EWB A;  5HIH A;  1ZR3 A;  2BFQ A;  2FG1 A;  3KR5 A;  4ETJ A;  4R76 A;  1TY8 A;  5FSZ A;  5FSU A;  4JCA A;  4ZYQ A;  3SIH A;  4K0C A;  5DUS A;  2XD7 A;  3GPG A;  3GQO A;  1TXZ A;  5D8N A;  4IQY A;  1ZR5 A;  4R6T A;  3ETI A;  1YD9 A;  3IIF A;  3T8W A;  5E3B A;  3IID A;  1BPM A;  5CBM A;  3GPQ A;  4X2T A;  1LAM A;  4J5S A;  4K3N A;  3H8G A;  2L8R A;  4JVV A;  3KZW A;  4KYB A;  1NJR A;  4JGK A;  3IJ3 A;  1GYT A;  3Q71 A;  2BFR A;  3JRU A;  5FSX A;  1BPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...