4TU0A

Crystal structure of chikungunya virus nsp3 macro domain in complex with a 2'-5' oligoadenylate trimer
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
160
Chain Sequence
HHAPSYVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYSESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Non-structural polyprotein 3
publication title CRYSTAL STRUCTURE OF CHIKUNGUNYA VIRUS NSP3 MACRO DOMAIN IN COMPLEX WITH A 2'-5' OLIGOADENYLATE TRIMER
rcsb
source organism Chikungunya virus
total genus 53
structure length 160
sequence length 162
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4tu0A00
2EEEA 4JCAA 5CB5A 1LANA 3EW5A 1LAMA 1SPVA 1TY8A 4JLLA 4K0CA 5HIHA 4ZI6A 3GPOA 3EJGA 3T8WA 1ZR3A 3VFQA 4GVWA 1TXZA 3KQXA 5FSUA 3EWQA 2AFCA 5FSYA 3EJFA 3SIJA 3GQEA 3Q71A 2FAVA 3JRUA 3KQZA 1LCPA 4GUAA 1BPMA 2VRIA 1VHUA 3V2BA 3GQOA 5D8NA 3IIDA 4D86A 3H8EA 4TU0A 2ACFA 3SIHA 4IQYA 4ZX9A 4JVVA 5E3BA 5FSXA 5HOLA 5FSZA 1HJZA 5AILA 4K3NA 4ZY0A 5CBMA 2FXKA 2X47A 2L8RA 4ETKA 4ZYQA 4UMLA 4GVVA 4J4ZA 2BFQA 4JGKA 3IIFA 4R76A 1NJRA 3SIIA 4J5SA 2XD7A 3EWPA 1GYTA 4ESSA 4ZX8A 2EWBA 1BLLE 4J5RA 4R6TA 4ZY2A 4ABKA 3GPGA 3KZWA 3GPQA 2FG1A 3KR5A 1LAPA 3H8FA 5CB3A 1YD9A 3EWOA 5CMSA 3IJ3A 4ZY1A 3PEIA 2LGRA 4KYBA 3EWRA 3KR4A 4J5QA 2DX6A 3JZTA 3EKEA 2J9AA 5FSVA 1BPNA 4R7MA 4ETJA 5DUSA 3ETIA 3Q6ZA 2BFRA 3SIGA 3V45A 4ABLA 3H8GA 1ZR5A 4X2TA 4KSIA
chains in the Genus database with same CATH superfamily
2EEEA 4JCAA 5CB5A 1LANA 3EW5A 1LAMA 1SPVA 1TY8A 4JLLA 4K0CA 5HIHA 4ZI6A 2RNKA 3GPOA 3EJGA 3T8WA 1ZR3A 3VFQA 4GVWA 1TXZA 3KQXA 5FSUA 3EWQA 2AFCA 5FSYA 3EJFA 3SIJA 3GQEA 3Q71A 2FAVA 3JRUA 3KQZA 1LCPA 4GUAA 1BPMA 2VRIA 1VHUA 3V2BA 3GQOA 5D8NA 3IIDA 4D86A 3H8EA 4TU0A 2ACFA 3SIHA 4IQYA 4ZX9A 4JVVA 5E3BA 2KQVA 5FSXA 5HOLA 5FSZA 1HJZA 5AILA 4K3NA 4ZY0A 5CBMA 2JZFA 2FXKA 2JZEA 2X47A 2L8RA 4ETKA 4ZYQA 4UMLA 4GVVA 4J4ZA 2BFQA 4JGKA 3IIFA 4R76A 1NJRA 3SIIA 4J5SA 2XD7A 3EWPA 1GYTA 4ESSA 4ZX8A 2EWBA 2WCTA 1BLLE 4J5RA 4R6TA 4ZY2A 4ABKA 3GPGA 3KZWA 3GPQA 2FG1A 3KR5A 1LAPA 3H8FA 5CB3A 2JZDA 1YD9A 3EWOA 5CMSA 3IJ3A 4ZY1A 3PEIA 2LGRA 4KYBA 3EWRA 3KR4A 4J5QA 2DX6A 2W2GA 3JZTA 3EKEA 2J9AA 5FSVA 1BPNA 4R7MA 4ETJA 5DUSA 3ETIA 3Q6ZA 2BFRA 3SIGA 3V45A 4ABLA 3H8GA 1ZR5A 4X2TA 4KSIA
chains in the Genus database with same CATH topology
2EEEA 4JCAA 5CB5A 1LANA 3EW5A 1LAMA 1SPVA 1TY8A 4JLLA 4K0CA 5HIHA 4ZI6A 3GPOA 3EJGA 3T8WA 1ZR3A 3VFQA 4GVWA 1TXZA 3KQXA 5FSUA 3EWQA 2AFCA 5FSYA 3EJFA 3SIJA 3GQEA 3Q71A 2FAVA 3JRUA 3KQZA 1LCPA 4GUAA 1BPMA 2VRIA 1VHUA 3V2BA 3GQOA 5D8NA 3IIDA 4D86A 3H8EA 4TU0A 2ACFA 3SIHA 4IQYA 4ZX9A 4JVVA 5E3BA 5FSXA 5HOLA 5FSZA 1HJZA 5AILA 4K3NA 4ZY0A 5CBMA 2FXKA 2X47A 2L8RA 4ETKA 4ZYQA 4UMLA 4GVVA 4J4ZA 2BFQA 4JGKA 3IIFA 4R76A 1NJRA 3SIIA 4J5SA 2XD7A 3EWPA 1GYTA 4ESSA 4ZX8A 2EWBA 1BLLE 4J5RA 4R6TA 4ZY2A 4ABKA 3GPGA 3KZWA 3GPQA 2FG1A 3KR5A 1LAPA 3H8FA 5CB3A 1YD9A 3EWOA 5CMSA 3IJ3A 4ZY1A 3PEIA 2LGRA 4KYBA 3EWRA 3KR4A 4J5QA 2DX6A 3JZTA 3EKEA 2J9AA 5FSVA 1BPNA 4R7MA 4ETJA 5DUSA 3ETIA 3Q6ZA 2BFRA 3SIGA 3V45A 4ABLA 3H8GA 1ZR5A 4X2TA 4KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EEE A;  4JCA A;  5CB5 A;  1LAN A;  3EW5 A;  1LAM A;  1SPV A;  1TY8 A;  4JLL A;  4K0C A;  5HIH A;  4ZI6 A;  3GPO A;  3EJG A;  3T8W A;  1ZR3 A;  3VFQ A;  4GVW A;  1TXZ A;  3KQX A;  5FSU A;  3EWQ A;  2AFC A;  5FSY A;  3EJF A;  3SIJ A;  3GQE A;  3Q71 A;  2FAV A;  3JRU A;  3KQZ A;  1LCP A;  4GUA A;  1BPM A;  2VRI A;  1VHU A;  3V2B A;  3GQO A;  5D8N A;  3IID A;  4D86 A;  3H8E A;  4TU0 A;  2ACF A;  3SIH A;  4IQY A;  4ZX9 A;  4JVV A;  5E3B A;  5FSX A;  5HOL A;  5FSZ A;  1HJZ A;  5AIL A;  4K3N A;  4ZY0 A;  5CBM A;  2FXK A;  2X47 A;  2L8R A;  4ETK A;  4ZYQ A;  4UML A;  4GVV A;  4J4Z A;  2BFQ A;  4JGK A;  3IIF A;  4R76 A;  1NJR A;  3SII A;  4J5S A;  2XD7 A;  3EWP A;  1GYT A;  4ESS A;  4ZX8 A;  2EWB A;  1BLL E;  4J5R A;  4R6T A;  4ZY2 A;  4ABK A;  3GPG A;  3KZW A;  3GPQ A;  2FG1 A;  3KR5 A;  1LAP A;  3H8F A;  5CB3 A;  1YD9 A;  3EWO A;  5CMS A;  3IJ3 A;  4ZY1 A;  3PEI A;  2LGR A;  4KYB A;  3EWR A;  3KR4 A;  4J5Q A;  2DX6 A;  3JZT A;  3EKE A;  2J9A A;  5FSV A;  1BPN A;  4R7M A;  4ETJ A;  5DUS A;  3ETI A;  3Q6Z A;  2BFR A;  3SIG A;  3V45 A;  4ABL A;  3H8G A;  1ZR5 A;  4X2T A;  4KSI A; 
#chains in the Genus database with same CATH topology
 2EEE A;  4JCA A;  5CB5 A;  1LAN A;  3EW5 A;  1LAM A;  1SPV A;  1TY8 A;  4JLL A;  4K0C A;  5HIH A;  4ZI6 A;  2RNK A;  3GPO A;  3EJG A;  3T8W A;  1ZR3 A;  3VFQ A;  4GVW A;  1TXZ A;  3KQX A;  5FSU A;  3EWQ A;  2AFC A;  5FSY A;  3EJF A;  3SIJ A;  3GQE A;  3Q71 A;  2FAV A;  3JRU A;  3KQZ A;  1LCP A;  4GUA A;  1BPM A;  2VRI A;  1VHU A;  3V2B A;  3GQO A;  5D8N A;  3IID A;  4D86 A;  3H8E A;  4TU0 A;  2ACF A;  3SIH A;  4IQY A;  4ZX9 A;  4JVV A;  5E3B A;  2KQV A;  5FSX A;  5HOL A;  5FSZ A;  1HJZ A;  5AIL A;  4K3N A;  4ZY0 A;  5CBM A;  2JZF A;  2FXK A;  2JZE A;  2X47 A;  2L8R A;  4ETK A;  4ZYQ A;  4UML A;  4GVV A;  4J4Z A;  2BFQ A;  4JGK A;  3IIF A;  4R76 A;  1NJR A;  3SII A;  4J5S A;  2XD7 A;  3EWP A;  1GYT A;  4ESS A;  4ZX8 A;  2EWB A;  2WCT A;  1BLL E;  4J5R A;  4R6T A;  4ZY2 A;  4ABK A;  3GPG A;  3KZW A;  3GPQ A;  2FG1 A;  3KR5 A;  1LAP A;  3H8F A;  5CB3 A;  2JZD A;  1YD9 A;  3EWO A;  5CMS A;  3IJ3 A;  4ZY1 A;  3PEI A;  2LGR A;  4KYB A;  3EWR A;  3KR4 A;  4J5Q A;  2DX6 A;  2W2G A;  3JZT A;  3EKE A;  2J9A A;  5FSV A;  1BPN A;  4R7M A;  4ETJ A;  5DUS A;  3ETI A;  3Q6Z A;  2BFR A;  3SIG A;  3V45 A;  4ABL A;  3H8G A;  1ZR5 A;  4X2T A;  4KSI A; 
#chains in the Genus database with same CATH homology
 2EEE A;  4JCA A;  5CB5 A;  1LAN A;  3EW5 A;  1LAM A;  1SPV A;  1TY8 A;  4JLL A;  4K0C A;  5HIH A;  4ZI6 A;  3GPO A;  3EJG A;  3T8W A;  1ZR3 A;  3VFQ A;  4GVW A;  1TXZ A;  3KQX A;  5FSU A;  3EWQ A;  2AFC A;  5FSY A;  3EJF A;  3SIJ A;  3GQE A;  3Q71 A;  2FAV A;  3JRU A;  3KQZ A;  1LCP A;  4GUA A;  1BPM A;  2VRI A;  1VHU A;  3V2B A;  3GQO A;  5D8N A;  3IID A;  4D86 A;  3H8E A;  4TU0 A;  2ACF A;  3SIH A;  4IQY A;  4ZX9 A;  4JVV A;  5E3B A;  5FSX A;  5HOL A;  5FSZ A;  1HJZ A;  5AIL A;  4K3N A;  4ZY0 A;  5CBM A;  2FXK A;  2X47 A;  2L8R A;  4ETK A;  4ZYQ A;  4UML A;  4GVV A;  4J4Z A;  2BFQ A;  4JGK A;  3IIF A;  4R76 A;  1NJR A;  3SII A;  4J5S A;  2XD7 A;  3EWP A;  1GYT A;  4ESS A;  4ZX8 A;  2EWB A;  1BLL E;  4J5R A;  4R6T A;  4ZY2 A;  4ABK A;  3GPG A;  3KZW A;  3GPQ A;  2FG1 A;  3KR5 A;  1LAP A;  3H8F A;  5CB3 A;  1YD9 A;  3EWO A;  5CMS A;  3IJ3 A;  4ZY1 A;  3PEI A;  2LGR A;  4KYB A;  3EWR A;  3KR4 A;  4J5Q A;  2DX6 A;  3JZT A;  3EKE A;  2J9A A;  5FSV A;  1BPN A;  4R7M A;  4ETJ A;  5DUS A;  3ETI A;  3Q6Z A;  2BFR A;  3SIG A;  3V45 A;  4ABL A;  3H8G A;  1ZR5 A;  4X2T A;  4KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...