4IQYA

Crystal structure of the human protein-proximal adp-ribosyl-hydrolase macrod2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
221
Chain Sequence
VWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKNTQEKSLTEKVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNLNGCDTGHAKITCGYDLPAKYVIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSVAFPCISTGIYGFPNEPAAVIALNTIKEWLAKNHHEVDRIIFCVFLEVDFKIYKKKMNEFFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords O-acetyl-ADP-ribose deacetylase MACROD2
publication title A family of macrodomain proteins reverses cellular mono-ADP-ribosylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 221
sequence length 232
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4iqyA00
3KQXA 5AILA 3SIGA 2XD7A 2LGRA 4UMLA 4ZY1A 1TXZA 5E3BA 3IJ3A 3VFQA 3IIFA 3EWPA 1SPVA 4J4ZA 2AFCA 3EJFA 1TY8A 1NJRA 4JVVA 3KQZA 4GUAA 4JCAA 2FXKA 4ABKA 3GPQA 1LCPA 1LAPA 5CMSA 3JZTA 3Q6ZA 5CBMA 4R76A 3KR5A 2ACFA 3GQEA 3JRUA 4ZX9A 1GYTA 1ZR3A 3EWRA 3SIJA 1VHUA 3EW5A 4ABLA 3H8FA 2FAVA 5FSYA 1LANA 4TU0A 5CB3A 4R7MA 4D86A 1BLLE 3KZWA 3EWQA 5CB5A 2EWBA 1YD9A 2J9AA 4K3NA 4IQYA 5HIHA 4GVVA 3PEIA 4ZY2A 3SIIA 3EKEA 1BPNA 4KSIA 3Q71A 4JGKA 2L8RA 4J5QA 3SIHA 1BPMA 5HOLA 3GQOA 3GPGA 2BFRA 4ETKA 2X47A 4KYBA 1HJZA 4ZYQA 2EEEA 4JLLA 3V45A 1LAMA 2VRIA 4J5SA 3EWOA 4ESSA 4ETJA 3H8GA 4ZI6A 3T8WA 5FSXA 4ZX8A 2FG1A 5DUSA 3KR4A 3IIDA 5D8NA 3GPOA 1ZR5A 5FSUA 4GVWA 2BFQA 4X2TA 4ZY0A 5FSZA 3H8EA 4K0CA 4R6TA 3ETIA 2DX6A 5FSVA 4J5RA 3V2BA 3EJGA
chains in the Genus database with same CATH superfamily
3KQXA 5AILA 3SIGA 2XD7A 2LGRA 4UMLA 2W2GA 1TXZA 4ZY1A 5E3BA 3IJ3A 3VFQA 3IIFA 3EWPA 1SPVA 4J4ZA 2AFCA 3EJFA 1TY8A 1NJRA 4JVVA 3KQZA 4GUAA 4JCAA 2FXKA 4ABKA 3GPQA 1LCPA 1LAPA 5CMSA 3JZTA 3Q6ZA 5CBMA 4R76A 3KR5A 2ACFA 3GQEA 3JRUA 4ZX9A 1GYTA 1ZR3A 3EWRA 3SIJA 1VHUA 3EW5A 4ABLA 3H8FA 2FAVA 5FSYA 1LANA 4TU0A 5CB3A 4R7MA 4D86A 1BLLE 3KZWA 3EWQA 5CB5A 2EWBA 1YD9A 2J9AA 4K3NA 4IQYA 5HIHA 4GVVA 2WCTA 3PEIA 4ZY2A 3SIIA 3EKEA 2JZFA 1BPNA 4KSIA 3Q71A 4JGKA 2KQVA 2L8RA 4J5QA 3SIHA 1BPMA 5HOLA 3GQOA 3GPGA 2BFRA 4ETKA 2X47A 4KYBA 1HJZA 4ZYQA 2EEEA 2JZEA 4JLLA 3V45A 1LAMA 2VRIA 4J5SA 3EWOA 4ESSA 4ETJA 3H8GA 4ZI6A 3T8WA 5FSXA 4ZX8A 2FG1A 2RNKA 5DUSA 3KR4A 3IIDA 5D8NA 3GPOA 1ZR5A 5FSUA 4GVWA 2BFQA 4X2TA 4ZY0A 5FSZA 3H8EA 4K0CA 4R6TA 3ETIA 2DX6A 2JZDA 5FSVA 4J5RA 3V2BA 3EJGA
chains in the Genus database with same CATH topology
3KQXA 5AILA 3SIGA 2XD7A 2LGRA 4UMLA 4ZY1A 1TXZA 5E3BA 3IJ3A 3VFQA 3IIFA 3EWPA 1SPVA 4J4ZA 2AFCA 3EJFA 1TY8A 1NJRA 4JVVA 3KQZA 4GUAA 4JCAA 2FXKA 4ABKA 3GPQA 1LCPA 1LAPA 5CMSA 3JZTA 3Q6ZA 5CBMA 4R76A 3KR5A 2ACFA 3GQEA 3JRUA 4ZX9A 1GYTA 1ZR3A 3EWRA 3SIJA 1VHUA 3EW5A 4ABLA 3H8FA 2FAVA 5FSYA 1LANA 4TU0A 5CB3A 4R7MA 4D86A 1BLLE 3KZWA 3EWQA 5CB5A 2EWBA 1YD9A 2J9AA 4K3NA 4IQYA 5HIHA 4GVVA 3PEIA 4ZY2A 3SIIA 3EKEA 1BPNA 4KSIA 3Q71A 4JGKA 2L8RA 4J5QA 3SIHA 1BPMA 5HOLA 3GQOA 3GPGA 2BFRA 4ETKA 2X47A 4KYBA 1HJZA 4ZYQA 2EEEA 4JLLA 3V45A 1LAMA 2VRIA 4J5SA 3EWOA 4ESSA 4ETJA 3H8GA 4ZI6A 3T8WA 5FSXA 4ZX8A 2FG1A 5DUSA 3KR4A 3IIDA 5D8NA 3GPOA 1ZR5A 5FSUA 4GVWA 2BFQA 4X2TA 4ZY0A 5FSZA 3H8EA 4K0CA 4R6TA 3ETIA 2DX6A 5FSVA 4J5RA 3V2BA 3EJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQX A;  5AIL A;  3SIG A;  2XD7 A;  2LGR A;  4UML A;  4ZY1 A;  1TXZ A;  5E3B A;  3IJ3 A;  3VFQ A;  3IIF A;  3EWP A;  1SPV A;  4J4Z A;  2AFC A;  3EJF A;  1TY8 A;  1NJR A;  4JVV A;  3KQZ A;  4GUA A;  4JCA A;  2FXK A;  4ABK A;  3GPQ A;  1LCP A;  1LAP A;  5CMS A;  3JZT A;  3Q6Z A;  5CBM A;  4R76 A;  3KR5 A;  2ACF A;  3GQE A;  3JRU A;  4ZX9 A;  1GYT A;  1ZR3 A;  3EWR A;  3SIJ A;  1VHU A;  3EW5 A;  4ABL A;  3H8F A;  2FAV A;  5FSY A;  1LAN A;  4TU0 A;  5CB3 A;  4R7M A;  4D86 A;  1BLL E;  3KZW A;  3EWQ A;  5CB5 A;  2EWB A;  1YD9 A;  2J9A A;  4K3N A;  4IQY A;  5HIH A;  4GVV A;  3PEI A;  4ZY2 A;  3SII A;  3EKE A;  1BPN A;  4KSI A;  3Q71 A;  4JGK A;  2L8R A;  4J5Q A;  3SIH A;  1BPM A;  5HOL A;  3GQO A;  3GPG A;  2BFR A;  4ETK A;  2X47 A;  4KYB A;  1HJZ A;  4ZYQ A;  2EEE A;  4JLL A;  3V45 A;  1LAM A;  2VRI A;  4J5S A;  3EWO A;  4ESS A;  4ETJ A;  3H8G A;  4ZI6 A;  3T8W A;  5FSX A;  4ZX8 A;  2FG1 A;  5DUS A;  3KR4 A;  3IID A;  5D8N A;  3GPO A;  1ZR5 A;  5FSU A;  4GVW A;  2BFQ A;  4X2T A;  4ZY0 A;  5FSZ A;  3H8E A;  4K0C A;  4R6T A;  3ETI A;  2DX6 A;  5FSV A;  4J5R A;  3V2B A;  3EJG A; 
#chains in the Genus database with same CATH topology
 3KQX A;  5AIL A;  3SIG A;  2XD7 A;  2LGR A;  4UML A;  2W2G A;  1TXZ A;  4ZY1 A;  5E3B A;  3IJ3 A;  3VFQ A;  3IIF A;  3EWP A;  1SPV A;  4J4Z A;  2AFC A;  3EJF A;  1TY8 A;  1NJR A;  4JVV A;  3KQZ A;  4GUA A;  4JCA A;  2FXK A;  4ABK A;  3GPQ A;  1LCP A;  1LAP A;  5CMS A;  3JZT A;  3Q6Z A;  5CBM A;  4R76 A;  3KR5 A;  2ACF A;  3GQE A;  3JRU A;  4ZX9 A;  1GYT A;  1ZR3 A;  3EWR A;  3SIJ A;  1VHU A;  3EW5 A;  4ABL A;  3H8F A;  2FAV A;  5FSY A;  1LAN A;  4TU0 A;  5CB3 A;  4R7M A;  4D86 A;  1BLL E;  3KZW A;  3EWQ A;  5CB5 A;  2EWB A;  1YD9 A;  2J9A A;  4K3N A;  4IQY A;  5HIH A;  4GVV A;  2WCT A;  3PEI A;  4ZY2 A;  3SII A;  3EKE A;  2JZF A;  1BPN A;  4KSI A;  3Q71 A;  4JGK A;  2KQV A;  2L8R A;  4J5Q A;  3SIH A;  1BPM A;  5HOL A;  3GQO A;  3GPG A;  2BFR A;  4ETK A;  2X47 A;  4KYB A;  1HJZ A;  4ZYQ A;  2EEE A;  2JZE A;  4JLL A;  3V45 A;  1LAM A;  2VRI A;  4J5S A;  3EWO A;  4ESS A;  4ETJ A;  3H8G A;  4ZI6 A;  3T8W A;  5FSX A;  4ZX8 A;  2FG1 A;  2RNK A;  5DUS A;  3KR4 A;  3IID A;  5D8N A;  3GPO A;  1ZR5 A;  5FSU A;  4GVW A;  2BFQ A;  4X2T A;  4ZY0 A;  5FSZ A;  3H8E A;  4K0C A;  4R6T A;  3ETI A;  2DX6 A;  2JZD A;  5FSV A;  4J5R A;  3V2B A;  3EJG A; 
#chains in the Genus database with same CATH homology
 3KQX A;  5AIL A;  3SIG A;  2XD7 A;  2LGR A;  4UML A;  4ZY1 A;  1TXZ A;  5E3B A;  3IJ3 A;  3VFQ A;  3IIF A;  3EWP A;  1SPV A;  4J4Z A;  2AFC A;  3EJF A;  1TY8 A;  1NJR A;  4JVV A;  3KQZ A;  4GUA A;  4JCA A;  2FXK A;  4ABK A;  3GPQ A;  1LCP A;  1LAP A;  5CMS A;  3JZT A;  3Q6Z A;  5CBM A;  4R76 A;  3KR5 A;  2ACF A;  3GQE A;  3JRU A;  4ZX9 A;  1GYT A;  1ZR3 A;  3EWR A;  3SIJ A;  1VHU A;  3EW5 A;  4ABL A;  3H8F A;  2FAV A;  5FSY A;  1LAN A;  4TU0 A;  5CB3 A;  4R7M A;  4D86 A;  1BLL E;  3KZW A;  3EWQ A;  5CB5 A;  2EWB A;  1YD9 A;  2J9A A;  4K3N A;  4IQY A;  5HIH A;  4GVV A;  3PEI A;  4ZY2 A;  3SII A;  3EKE A;  1BPN A;  4KSI A;  3Q71 A;  4JGK A;  2L8R A;  4J5Q A;  3SIH A;  1BPM A;  5HOL A;  3GQO A;  3GPG A;  2BFR A;  4ETK A;  2X47 A;  4KYB A;  1HJZ A;  4ZYQ A;  2EEE A;  4JLL A;  3V45 A;  1LAM A;  2VRI A;  4J5S A;  3EWO A;  4ESS A;  4ETJ A;  3H8G A;  4ZI6 A;  3T8W A;  5FSX A;  4ZX8 A;  2FG1 A;  5DUS A;  3KR4 A;  3IID A;  5D8N A;  3GPO A;  1ZR5 A;  5FSU A;  4GVW A;  2BFQ A;  4X2T A;  4ZY0 A;  5FSZ A;  3H8E A;  4K0C A;  4R6T A;  3ETI A;  2DX6 A;  5FSV A;  4J5R A;  3V2B A;  3EJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...