4J4ZA

Crystal structure of the improved variant of the evolved serine hydrolase, osh55.4_h1.2, bond with sulfate ion in the active site, northeast structural genomics consortium (nesg) target or301
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
161
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMFEEIKKAPDTLEVTGVHGTEKSAEAYRRALLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the improved variant of the evolved serine hydrolase, OSH55.4_H1.2, bond with sulfate ion in the active site, Northeast Structural Genomics Consortium (NESG) Target OR301
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords Designed serine hydrolase variant OSH55.4_H1.2
total genus 54
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j4zA00
4K0CA 4TU0A 3IJ3A 3EWOA 1TY8A 3JRUA 4X2TA 4ESSA 4K3NA 3VFQA 2L8RA 3GQEA 5AILA 3EKEA 1TXZA 3H8GA 3SIJA 3EWPA 3ETIA 4KYBA 3V2BA 3SIHA 3Q71A 3IIDA 3EWQA 3GPQA 1LAMA 4D86A 3V45A 2FXKA 3SIIA 4ETJA 3Q6ZA 4J5QA 3GPOA 2BFQA 5HIHA 5FSYA 4JGKA 2VRIA 1LAPA 2FG1A 1NJRA 5FSVA 1BPMA 3EJGA 3GPGA 5FSXA 1HJZA 5DUSA 4GVWA 5HOLA 1VHUA 2ACFA 4JCAA 3KQZA 4ZY0A 4J4ZA 4KSIA 4UMLA 4J5RA 2AFCA 3EJFA 5D8NA 1YD9A 5FSZA 4R76A 4GUAA 3EW5A 5CBMA 3T8WA 2BFRA 2XD7A 4ZI6A 3KQXA 2EEEA 4JLLA 5CB5A 4ZY1A 4ABKA 3IIFA 5CMSA 3KR4A 4ETKA 4JVVA 5E3BA 3GQOA 5FSUA 1SPVA 5CB3A 2LGRA 1GYTA 1LANA 3H8EA 4R6TA 1ZR3A 1LCPA 2J9AA 1ZR5A 1BLLE 2FAVA 4ZX8A 4ZY2A 3JZTA 4ABLA 4ZYQA 2EWBA 3KZWA 4ZX9A 4GVVA 3PEIA 3SIGA 4J5SA 3EWRA 4R7MA 2DX6A 3H8FA 4IQYA 1BPNA 3KR5A 2X47A
chains in the Genus database with same CATH superfamily
4K0CA 4TU0A 3IJ3A 3EWOA 1TY8A 3JRUA 4X2TA 4ESSA 4K3NA 3VFQA 2L8RA 3GQEA 5AILA 3EKEA 1TXZA 3H8GA 3SIJA 3EWPA 2JZEA 3ETIA 4KYBA 3V2BA 3SIHA 3Q71A 3IIDA 3EWQA 3GPQA 1LAMA 4D86A 3V45A 2FXKA 3SIIA 4ETJA 3Q6ZA 4J5QA 3GPOA 2BFQA 5HIHA 5FSYA 2RNKA 4JGKA 2VRIA 1LAPA 2FG1A 1NJRA 5FSVA 1BPMA 3EJGA 3GPGA 5FSXA 1HJZA 5DUSA 2KQVA 4GVWA 5HOLA 1VHUA 2ACFA 4JCAA 3KQZA 4ZY0A 4J4ZA 2JZDA 4KSIA 4UMLA 4J5RA 2AFCA 3EJFA 5D8NA 1YD9A 5FSZA 4R76A 4GUAA 3EW5A 5CBMA 3T8WA 2BFRA 2XD7A 4ZI6A 3KQXA 2EEEA 4JLLA 5CB5A 4ZY1A 4ABKA 3IIFA 5CMSA 3KR4A 4ETKA 4JVVA 5E3BA 3GQOA 5FSUA 1SPVA 2JZFA 5CB3A 2LGRA 1GYTA 1LANA 3H8EA 4R6TA 1ZR3A 1LCPA 2J9AA 1ZR5A 2WCTA 1BLLE 2FAVA 4ZX8A 4ZY2A 3JZTA 4ABLA 4ZYQA 2EWBA 3KZWA 4ZX9A 4GVVA 2W2GA 3PEIA 3SIGA 4J5SA 3EWRA 4R7MA 2DX6A 3H8FA 4IQYA 1BPNA 3KR5A 2X47A
chains in the Genus database with same CATH topology
4K0CA 4TU0A 3IJ3A 3EWOA 1TY8A 3JRUA 4X2TA 4ESSA 4K3NA 3VFQA 2L8RA 3GQEA 5AILA 3EKEA 1TXZA 3H8GA 3SIJA 3EWPA 3ETIA 4KYBA 3V2BA 3SIHA 3Q71A 3IIDA 3EWQA 3GPQA 1LAMA 4D86A 3V45A 2FXKA 3SIIA 4ETJA 3Q6ZA 4J5QA 3GPOA 2BFQA 5HIHA 5FSYA 4JGKA 2VRIA 1LAPA 2FG1A 1NJRA 5FSVA 1BPMA 3EJGA 3GPGA 5FSXA 1HJZA 5DUSA 4GVWA 5HOLA 1VHUA 2ACFA 4JCAA 3KQZA 4ZY0A 4J4ZA 4KSIA 4UMLA 4J5RA 2AFCA 3EJFA 5D8NA 1YD9A 5FSZA 4R76A 4GUAA 3EW5A 5CBMA 3T8WA 2BFRA 2XD7A 4ZI6A 3KQXA 2EEEA 4JLLA 5CB5A 4ZY1A 4ABKA 3IIFA 5CMSA 3KR4A 4ETKA 4JVVA 5E3BA 3GQOA 5FSUA 1SPVA 5CB3A 2LGRA 1GYTA 1LANA 3H8EA 4R6TA 1ZR3A 1LCPA 2J9AA 1ZR5A 1BLLE 2FAVA 4ZX8A 4ZY2A 3JZTA 4ABLA 4ZYQA 2EWBA 3KZWA 4ZX9A 4GVVA 3PEIA 3SIGA 4J5SA 3EWRA 4R7MA 2DX6A 3H8FA 4IQYA 1BPNA 3KR5A 2X47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0C A;  4TU0 A;  3IJ3 A;  3EWO A;  1TY8 A;  3JRU A;  4X2T A;  4ESS A;  4K3N A;  3VFQ A;  2L8R A;  3GQE A;  5AIL A;  3EKE A;  1TXZ A;  3H8G A;  3SIJ A;  3EWP A;  3ETI A;  4KYB A;  3V2B A;  3SIH A;  3Q71 A;  3IID A;  3EWQ A;  3GPQ A;  1LAM A;  4D86 A;  3V45 A;  2FXK A;  3SII A;  4ETJ A;  3Q6Z A;  4J5Q A;  3GPO A;  2BFQ A;  5HIH A;  5FSY A;  4JGK A;  2VRI A;  1LAP A;  2FG1 A;  1NJR A;  5FSV A;  1BPM A;  3EJG A;  3GPG A;  5FSX A;  1HJZ A;  5DUS A;  4GVW A;  5HOL A;  1VHU A;  2ACF A;  4JCA A;  3KQZ A;  4ZY0 A;  4J4Z A;  4KSI A;  4UML A;  4J5R A;  2AFC A;  3EJF A;  5D8N A;  1YD9 A;  5FSZ A;  4R76 A;  4GUA A;  3EW5 A;  5CBM A;  3T8W A;  2BFR A;  2XD7 A;  4ZI6 A;  3KQX A;  2EEE A;  4JLL A;  5CB5 A;  4ZY1 A;  4ABK A;  3IIF A;  5CMS A;  3KR4 A;  4ETK A;  4JVV A;  5E3B A;  3GQO A;  5FSU A;  1SPV A;  5CB3 A;  2LGR A;  1GYT A;  1LAN A;  3H8E A;  4R6T A;  1ZR3 A;  1LCP A;  2J9A A;  1ZR5 A;  1BLL E;  2FAV A;  4ZX8 A;  4ZY2 A;  3JZT A;  4ABL A;  4ZYQ A;  2EWB A;  3KZW A;  4ZX9 A;  4GVV A;  3PEI A;  3SIG A;  4J5S A;  3EWR A;  4R7M A;  2DX6 A;  3H8F A;  4IQY A;  1BPN A;  3KR5 A;  2X47 A; 
#chains in the Genus database with same CATH topology
 4K0C A;  4TU0 A;  3IJ3 A;  3EWO A;  1TY8 A;  3JRU A;  4X2T A;  4ESS A;  4K3N A;  3VFQ A;  2L8R A;  3GQE A;  5AIL A;  3EKE A;  1TXZ A;  3H8G A;  3SIJ A;  3EWP A;  2JZE A;  3ETI A;  4KYB A;  3V2B A;  3SIH A;  3Q71 A;  3IID A;  3EWQ A;  3GPQ A;  1LAM A;  4D86 A;  3V45 A;  2FXK A;  3SII A;  4ETJ A;  3Q6Z A;  4J5Q A;  3GPO A;  2BFQ A;  5HIH A;  5FSY A;  2RNK A;  4JGK A;  2VRI A;  1LAP A;  2FG1 A;  1NJR A;  5FSV A;  1BPM A;  3EJG A;  3GPG A;  5FSX A;  1HJZ A;  5DUS A;  2KQV A;  4GVW A;  5HOL A;  1VHU A;  2ACF A;  4JCA A;  3KQZ A;  4ZY0 A;  4J4Z A;  2JZD A;  4KSI A;  4UML A;  4J5R A;  2AFC A;  3EJF A;  5D8N A;  1YD9 A;  5FSZ A;  4R76 A;  4GUA A;  3EW5 A;  5CBM A;  3T8W A;  2BFR A;  2XD7 A;  4ZI6 A;  3KQX A;  2EEE A;  4JLL A;  5CB5 A;  4ZY1 A;  4ABK A;  3IIF A;  5CMS A;  3KR4 A;  4ETK A;  4JVV A;  5E3B A;  3GQO A;  5FSU A;  1SPV A;  2JZF A;  5CB3 A;  2LGR A;  1GYT A;  1LAN A;  3H8E A;  4R6T A;  1ZR3 A;  1LCP A;  2J9A A;  1ZR5 A;  2WCT A;  1BLL E;  2FAV A;  4ZX8 A;  4ZY2 A;  3JZT A;  4ABL A;  4ZYQ A;  2EWB A;  3KZW A;  4ZX9 A;  4GVV A;  2W2G A;  3PEI A;  3SIG A;  4J5S A;  3EWR A;  4R7M A;  2DX6 A;  3H8F A;  4IQY A;  1BPN A;  3KR5 A;  2X47 A; 
#chains in the Genus database with same CATH homology
 4K0C A;  4TU0 A;  3IJ3 A;  3EWO A;  1TY8 A;  3JRU A;  4X2T A;  4ESS A;  4K3N A;  3VFQ A;  2L8R A;  3GQE A;  5AIL A;  3EKE A;  1TXZ A;  3H8G A;  3SIJ A;  3EWP A;  3ETI A;  4KYB A;  3V2B A;  3SIH A;  3Q71 A;  3IID A;  3EWQ A;  3GPQ A;  1LAM A;  4D86 A;  3V45 A;  2FXK A;  3SII A;  4ETJ A;  3Q6Z A;  4J5Q A;  3GPO A;  2BFQ A;  5HIH A;  5FSY A;  4JGK A;  2VRI A;  1LAP A;  2FG1 A;  1NJR A;  5FSV A;  1BPM A;  3EJG A;  3GPG A;  5FSX A;  1HJZ A;  5DUS A;  4GVW A;  5HOL A;  1VHU A;  2ACF A;  4JCA A;  3KQZ A;  4ZY0 A;  4J4Z A;  4KSI A;  4UML A;  4J5R A;  2AFC A;  3EJF A;  5D8N A;  1YD9 A;  5FSZ A;  4R76 A;  4GUA A;  3EW5 A;  5CBM A;  3T8W A;  2BFR A;  2XD7 A;  4ZI6 A;  3KQX A;  2EEE A;  4JLL A;  5CB5 A;  4ZY1 A;  4ABK A;  3IIF A;  5CMS A;  3KR4 A;  4ETK A;  4JVV A;  5E3B A;  3GQO A;  5FSU A;  1SPV A;  5CB3 A;  2LGR A;  1GYT A;  1LAN A;  3H8E A;  4R6T A;  1ZR3 A;  1LCP A;  2J9A A;  1ZR5 A;  1BLL E;  2FAV A;  4ZX8 A;  4ZY2 A;  3JZT A;  4ABL A;  4ZYQ A;  2EWB A;  3KZW A;  4ZX9 A;  4GVV A;  3PEI A;  3SIG A;  4J5S A;  3EWR A;  4R7M A;  2DX6 A;  3H8F A;  4IQY A;  1BPN A;  3KR5 A;  2X47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...