4J4ZA

Crystal structure of the improved variant of the evolved serine hydrolase, osh55.4_h1.2, bond with sulfate ion in the active site, northeast structural genomics consortium (nesg) target or301
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
161
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMFEEIKKAPDTLEVTGVHGTEKSAEAYRRALLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Designed serine hydrolase variant OSH55.4_H1.2
publication title Crystal structure of the improved variant of the evolved serine hydrolase, OSH55.4_H1.2, bond with sulfate ion in the active site, Northeast Structural Genomics Consortium (NESG) Target OR301
rcsb
source organism Synthetic construct
total genus 54
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j4zA00
5FSXA 3KQZA 3V2BA 3PEIA 5HIHA 3EWRA 4JGKA 3GQEA 4R6TA 3KQXA 3V45A 4D86A 1LANA 3EJGA 4K0CA 3IIFA 1TY8A 4ETKA 5CMSA 3Q6ZA 3GQOA 4R76A 4J4ZA 4ZX9A 3GPOA 2J9AA 4JLLA 3KR5A 1BLLE 2EEEA 1TXZA 4JVVA 3GPQA 1NJRA 4GVWA 3EWPA 1ZR5A 3EW5A 4ETJA 1HJZA 5D8NA 3EWOA 4ZX8A 4ZY2A 5HOLA 2XD7A 4JCAA 5FSYA 2BFQA 3SIIA 4ABLA 5CB3A 3JRUA 3EJFA 4R7MA 3H8FA 2DX6A 4GVVA 4J5RA 5AILA 3SIHA 2ACFA 3KR4A 3T8WA 2X47A 2FG1A 2AFCA 1LAMA 3ETIA 5CB5A 3VFQA 3H8GA 4ZY1A 3IIDA 2LGRA 3JZTA 4KYBA 4J5QA 1GYTA 5DUSA 4TU0A 1BPMA 5E3BA 3EWQA 4ZYQA 1LCPA 2FAVA 4J5SA 5CBMA 2BFRA 2FXKA 5FSVA 4ZI6A 5FSUA 1VHUA 1BPNA 1YD9A 3H8EA 4K3NA 2L8RA 3GPGA 4KSIA 2VRIA 1LAPA 3IJ3A 4ABKA 3EKEA 5FSZA 4ESSA 4GUAA 4ZY0A 3Q71A 1ZR3A 4IQYA 3SIJA 4UMLA 3SIGA 3KZWA 2EWBA 4X2TA 1SPVA
chains in the Genus database with same CATH superfamily
5FSXA 3KQZA 3V2BA 3PEIA 5HIHA 3EWRA 4JGKA 3GQEA 4R6TA 3KQXA 3V45A 2KQVA 4D86A 1LANA 3EJGA 4K0CA 3IIFA 1TY8A 2RNKA 4ETKA 5CMSA 3Q6ZA 3GQOA 4R76A 2WCTA 4J4ZA 4ZX9A 3GPOA 2J9AA 4JLLA 3KR5A 1BLLE 2EEEA 1TXZA 4JVVA 3GPQA 1NJRA 4GVWA 3EWPA 1ZR5A 3EW5A 4ETJA 1HJZA 5D8NA 3EWOA 4ZX8A 4ZY2A 5HOLA 2XD7A 4JCAA 5FSYA 2BFQA 3SIIA 4ABLA 5CB3A 3JRUA 3EJFA 4R7MA 3H8FA 2DX6A 4GVVA 4J5RA 5AILA 3SIHA 2ACFA 3KR4A 3T8WA 2X47A 2FG1A 2AFCA 1LAMA 3ETIA 5CB5A 3VFQA 3H8GA 4ZY1A 3IIDA 2LGRA 3JZTA 4KYBA 4J5QA 1GYTA 5DUSA 4TU0A 1BPMA 5E3BA 3EWQA 4ZYQA 1LCPA 2FAVA 2JZFA 2W2GA 4J5SA 5CBMA 2BFRA 2FXKA 5FSVA 4ZI6A 5FSUA 1VHUA 1BPNA 1YD9A 3H8EA 4K3NA 2L8RA 3GPGA 4KSIA 2VRIA 1LAPA 2JZEA 3IJ3A 4ABKA 3EKEA 5FSZA 4ESSA 4GUAA 4ZY0A 3Q71A 1ZR3A 2JZDA 4IQYA 3SIJA 4UMLA 3SIGA 3KZWA 2EWBA 4X2TA 1SPVA
chains in the Genus database with same CATH topology
5FSXA 3KQZA 3V2BA 3PEIA 5HIHA 3EWRA 4JGKA 3GQEA 4R6TA 3KQXA 3V45A 4D86A 1LANA 3EJGA 4K0CA 3IIFA 1TY8A 4ETKA 5CMSA 3Q6ZA 3GQOA 4R76A 4J4ZA 4ZX9A 3GPOA 2J9AA 4JLLA 3KR5A 1BLLE 2EEEA 1TXZA 4JVVA 3GPQA 1NJRA 4GVWA 3EWPA 1ZR5A 3EW5A 4ETJA 1HJZA 5D8NA 3EWOA 4ZX8A 4ZY2A 5HOLA 2XD7A 4JCAA 5FSYA 2BFQA 3SIIA 4ABLA 5CB3A 3JRUA 3EJFA 4R7MA 3H8FA 2DX6A 4GVVA 4J5RA 5AILA 3SIHA 2ACFA 3KR4A 3T8WA 2X47A 2FG1A 2AFCA 1LAMA 3ETIA 5CB5A 3VFQA 3H8GA 4ZY1A 3IIDA 2LGRA 3JZTA 4KYBA 4J5QA 1GYTA 5DUSA 4TU0A 1BPMA 5E3BA 3EWQA 4ZYQA 1LCPA 2FAVA 4J5SA 5CBMA 2BFRA 2FXKA 5FSVA 4ZI6A 5FSUA 1VHUA 1BPNA 1YD9A 3H8EA 4K3NA 2L8RA 3GPGA 4KSIA 2VRIA 1LAPA 3IJ3A 4ABKA 3EKEA 5FSZA 4ESSA 4GUAA 4ZY0A 3Q71A 1ZR3A 4IQYA 3SIJA 4UMLA 3SIGA 3KZWA 2EWBA 4X2TA 1SPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSX A;  3KQZ A;  3V2B A;  3PEI A;  5HIH A;  3EWR A;  4JGK A;  3GQE A;  4R6T A;  3KQX A;  3V45 A;  4D86 A;  1LAN A;  3EJG A;  4K0C A;  3IIF A;  1TY8 A;  4ETK A;  5CMS A;  3Q6Z A;  3GQO A;  4R76 A;  4J4Z A;  4ZX9 A;  3GPO A;  2J9A A;  4JLL A;  3KR5 A;  1BLL E;  2EEE A;  1TXZ A;  4JVV A;  3GPQ A;  1NJR A;  4GVW A;  3EWP A;  1ZR5 A;  3EW5 A;  4ETJ A;  1HJZ A;  5D8N A;  3EWO A;  4ZX8 A;  4ZY2 A;  5HOL A;  2XD7 A;  4JCA A;  5FSY A;  2BFQ A;  3SII A;  4ABL A;  5CB3 A;  3JRU A;  3EJF A;  4R7M A;  3H8F A;  2DX6 A;  4GVV A;  4J5R A;  5AIL A;  3SIH A;  2ACF A;  3KR4 A;  3T8W A;  2X47 A;  2FG1 A;  2AFC A;  1LAM A;  3ETI A;  5CB5 A;  3VFQ A;  3H8G A;  4ZY1 A;  3IID A;  2LGR A;  3JZT A;  4KYB A;  4J5Q A;  1GYT A;  5DUS A;  4TU0 A;  1BPM A;  5E3B A;  3EWQ A;  4ZYQ A;  1LCP A;  2FAV A;  4J5S A;  5CBM A;  2BFR A;  2FXK A;  5FSV A;  4ZI6 A;  5FSU A;  1VHU A;  1BPN A;  1YD9 A;  3H8E A;  4K3N A;  2L8R A;  3GPG A;  4KSI A;  2VRI A;  1LAP A;  3IJ3 A;  4ABK A;  3EKE A;  5FSZ A;  4ESS A;  4GUA A;  4ZY0 A;  3Q71 A;  1ZR3 A;  4IQY A;  3SIJ A;  4UML A;  3SIG A;  3KZW A;  2EWB A;  4X2T A;  1SPV A; 
#chains in the Genus database with same CATH topology
 5FSX A;  3KQZ A;  3V2B A;  3PEI A;  5HIH A;  3EWR A;  4JGK A;  3GQE A;  4R6T A;  3KQX A;  3V45 A;  2KQV A;  4D86 A;  1LAN A;  3EJG A;  4K0C A;  3IIF A;  1TY8 A;  2RNK A;  4ETK A;  5CMS A;  3Q6Z A;  3GQO A;  4R76 A;  2WCT A;  4J4Z A;  4ZX9 A;  3GPO A;  2J9A A;  4JLL A;  3KR5 A;  1BLL E;  2EEE A;  1TXZ A;  4JVV A;  3GPQ A;  1NJR A;  4GVW A;  3EWP A;  1ZR5 A;  3EW5 A;  4ETJ A;  1HJZ A;  5D8N A;  3EWO A;  4ZX8 A;  4ZY2 A;  5HOL A;  2XD7 A;  4JCA A;  5FSY A;  2BFQ A;  3SII A;  4ABL A;  5CB3 A;  3JRU A;  3EJF A;  4R7M A;  3H8F A;  2DX6 A;  4GVV A;  4J5R A;  5AIL A;  3SIH A;  2ACF A;  3KR4 A;  3T8W A;  2X47 A;  2FG1 A;  2AFC A;  1LAM A;  3ETI A;  5CB5 A;  3VFQ A;  3H8G A;  4ZY1 A;  3IID A;  2LGR A;  3JZT A;  4KYB A;  4J5Q A;  1GYT A;  5DUS A;  4TU0 A;  1BPM A;  5E3B A;  3EWQ A;  4ZYQ A;  1LCP A;  2FAV A;  2JZF A;  2W2G A;  4J5S A;  5CBM A;  2BFR A;  2FXK A;  5FSV A;  4ZI6 A;  5FSU A;  1VHU A;  1BPN A;  1YD9 A;  3H8E A;  4K3N A;  2L8R A;  3GPG A;  4KSI A;  2VRI A;  1LAP A;  2JZE A;  3IJ3 A;  4ABK A;  3EKE A;  5FSZ A;  4ESS A;  4GUA A;  4ZY0 A;  3Q71 A;  1ZR3 A;  2JZD A;  4IQY A;  3SIJ A;  4UML A;  3SIG A;  3KZW A;  2EWB A;  4X2T A;  1SPV A; 
#chains in the Genus database with same CATH homology
 5FSX A;  3KQZ A;  3V2B A;  3PEI A;  5HIH A;  3EWR A;  4JGK A;  3GQE A;  4R6T A;  3KQX A;  3V45 A;  4D86 A;  1LAN A;  3EJG A;  4K0C A;  3IIF A;  1TY8 A;  4ETK A;  5CMS A;  3Q6Z A;  3GQO A;  4R76 A;  4J4Z A;  4ZX9 A;  3GPO A;  2J9A A;  4JLL A;  3KR5 A;  1BLL E;  2EEE A;  1TXZ A;  4JVV A;  3GPQ A;  1NJR A;  4GVW A;  3EWP A;  1ZR5 A;  3EW5 A;  4ETJ A;  1HJZ A;  5D8N A;  3EWO A;  4ZX8 A;  4ZY2 A;  5HOL A;  2XD7 A;  4JCA A;  5FSY A;  2BFQ A;  3SII A;  4ABL A;  5CB3 A;  3JRU A;  3EJF A;  4R7M A;  3H8F A;  2DX6 A;  4GVV A;  4J5R A;  5AIL A;  3SIH A;  2ACF A;  3KR4 A;  3T8W A;  2X47 A;  2FG1 A;  2AFC A;  1LAM A;  3ETI A;  5CB5 A;  3VFQ A;  3H8G A;  4ZY1 A;  3IID A;  2LGR A;  3JZT A;  4KYB A;  4J5Q A;  1GYT A;  5DUS A;  4TU0 A;  1BPM A;  5E3B A;  3EWQ A;  4ZYQ A;  1LCP A;  2FAV A;  4J5S A;  5CBM A;  2BFR A;  2FXK A;  5FSV A;  4ZI6 A;  5FSU A;  1VHU A;  1BPN A;  1YD9 A;  3H8E A;  4K3N A;  2L8R A;  3GPG A;  4KSI A;  2VRI A;  1LAP A;  3IJ3 A;  4ABK A;  3EKE A;  5FSZ A;  4ESS A;  4GUA A;  4ZY0 A;  3Q71 A;  1ZR3 A;  4IQY A;  3SIJ A;  4UML A;  3SIG A;  3KZW A;  2EWB A;  4X2T A;  1SPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...