4J4ZA

Crystal structure of the improved variant of the evolved serine hydrolase, osh55.4_h1.2, bond with sulfate ion in the active site, northeast structural genomics consortium (nesg) target or301
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
161
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMFEEIKKAPDTLEVTGVHGTEKSAEAYRRALLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the improved variant of the evolved serine hydrolase, OSH55.4_H1.2, bond with sulfate ion in the active site, Northeast Structural Genomics Consortium (NESG) Target OR301
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords Designed serine hydrolase variant OSH55.4_H1.2
total genus 54
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j4zA00
2BFRA 3EW5A 5HOLA 5CBMA 1SPVA 2EEEA 4R6TA 4JCAA 3EKEA 4TU0A 4GVWA 2FAVA 3PEIA 3IJ3A 3KQXA 4X2TA 3V45A 4J4ZA 1LCPA 4ETJA 3GPQA 3JRUA 3IIDA 3EJGA 5AILA 4K3NA 4ZY0A 4IQYA 3ETIA 1HJZA 2BFQA 4UMLA 5DUSA 3KR4A 1BPNA 3T8WA 3GPOA 3JZTA 3V2BA 5HIHA 3KQZA 3KR5A 1ZR5A 4J5QA 1YD9A 5FSYA 4ZX9A 1ZR3A 4ABLA 3Q71A 3H8FA 4ESSA 3SIHA 5FSUA 2VRIA 1LAPA 1VHUA 2FG1A 3EWQA 3VFQA 4ZYQA 4GVVA 4GUAA 2LGRA 4ETKA 3EWOA 2FXKA 3SIGA 2L8RA 3EWPA 4ZY1A 3GQOA 1TXZA 4J5RA 1TY8A 4JGKA 4JVVA 2ACFA 4R76A 3H8GA 3H8EA 1BLLE 4ZI6A 3Q6ZA 5CMSA 2DX6A 3GPGA 5FSVA 2EWBA 5E3BA 3EWRA 4JLLA 1LANA 3KZWA 1GYTA 4D86A 1BPMA 5FSZA 1NJRA 2X47A 5CB5A 2J9AA 3EJFA 4ABKA 5D8NA 3IIFA 2AFCA 1LAMA 4K0CA 4ZX8A 4R7MA 4ZY2A 5FSXA 5CB3A 3SIIA 4KSIA 4J5SA 4KYBA 3SIJA 2XD7A 3GQEA
chains in the Genus database with same CATH superfamily
2BFRA 3EW5A 5HOLA 5CBMA 1SPVA 2EEEA 4R6TA 4JCAA 3EKEA 4TU0A 4GVWA 2FAVA 3PEIA 3IJ3A 3KQXA 4X2TA 3V45A 4J4ZA 1LCPA 4ETJA 3GPQA 3JRUA 3IIDA 3EJGA 5AILA 4K3NA 4ZY0A 4IQYA 3ETIA 1HJZA 2BFQA 4UMLA 5DUSA 3KR4A 1BPNA 3T8WA 3GPOA 3JZTA 3V2BA 5HIHA 3KQZA 3KR5A 1ZR5A 4J5QA 1YD9A 5FSYA 4ZX9A 2RNKA 1ZR3A 4ABLA 3Q71A 3H8FA 4ESSA 3SIHA 5FSUA 2VRIA 1LAPA 1VHUA 2FG1A 2JZEA 3EWQA 3VFQA 4ZYQA 4GVVA 4GUAA 2LGRA 4ETKA 2W2GA 3EWOA 2FXKA 3SIGA 2L8RA 3EWPA 4ZY1A 3GQOA 1TXZA 4J5RA 2JZFA 1TY8A 4JGKA 4JVVA 2ACFA 4R76A 3H8GA 3H8EA 1BLLE 2JZDA 4ZI6A 3Q6ZA 5CMSA 2DX6A 3GPGA 5FSVA 2EWBA 5E3BA 3EWRA 4JLLA 1LANA 3KZWA 1GYTA 4D86A 1BPMA 5FSZA 1NJRA 2X47A 5CB5A 2J9AA 3EJFA 4ABKA 5D8NA 3IIFA 2WCTA 2AFCA 1LAMA 4K0CA 4ZX8A 4R7MA 4ZY2A 5FSXA 5CB3A 3SIIA 4KSIA 4J5SA 2KQVA 4KYBA 3SIJA 2XD7A 3GQEA
chains in the Genus database with same CATH topology
2BFRA 3EW5A 5HOLA 5CBMA 1SPVA 2EEEA 4R6TA 4JCAA 3EKEA 4TU0A 4GVWA 2FAVA 3PEIA 3IJ3A 3KQXA 4X2TA 3V45A 4J4ZA 1LCPA 4ETJA 3GPQA 3JRUA 3IIDA 3EJGA 5AILA 4K3NA 4ZY0A 4IQYA 3ETIA 1HJZA 2BFQA 4UMLA 5DUSA 3KR4A 1BPNA 3T8WA 3GPOA 3JZTA 3V2BA 5HIHA 3KQZA 3KR5A 1ZR5A 4J5QA 1YD9A 5FSYA 4ZX9A 1ZR3A 4ABLA 3Q71A 3H8FA 4ESSA 3SIHA 5FSUA 2VRIA 1LAPA 1VHUA 2FG1A 3EWQA 3VFQA 4ZYQA 4GVVA 4GUAA 2LGRA 4ETKA 3EWOA 2FXKA 3SIGA 2L8RA 3EWPA 4ZY1A 3GQOA 1TXZA 4J5RA 1TY8A 4JGKA 4JVVA 2ACFA 4R76A 3H8GA 3H8EA 1BLLE 4ZI6A 3Q6ZA 5CMSA 2DX6A 3GPGA 5FSVA 2EWBA 5E3BA 3EWRA 4JLLA 1LANA 3KZWA 1GYTA 4D86A 1BPMA 5FSZA 1NJRA 2X47A 5CB5A 2J9AA 3EJFA 4ABKA 5D8NA 3IIFA 2AFCA 1LAMA 4K0CA 4ZX8A 4R7MA 4ZY2A 5FSXA 5CB3A 3SIIA 4KSIA 4J5SA 4KYBA 3SIJA 2XD7A 3GQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BFR A;  3EW5 A;  5HOL A;  5CBM A;  1SPV A;  2EEE A;  4R6T A;  4JCA A;  3EKE A;  4TU0 A;  4GVW A;  2FAV A;  3PEI A;  3IJ3 A;  3KQX A;  4X2T A;  3V45 A;  4J4Z A;  1LCP A;  4ETJ A;  3GPQ A;  3JRU A;  3IID A;  3EJG A;  5AIL A;  4K3N A;  4ZY0 A;  4IQY A;  3ETI A;  1HJZ A;  2BFQ A;  4UML A;  5DUS A;  3KR4 A;  1BPN A;  3T8W A;  3GPO A;  3JZT A;  3V2B A;  5HIH A;  3KQZ A;  3KR5 A;  1ZR5 A;  4J5Q A;  1YD9 A;  5FSY A;  4ZX9 A;  1ZR3 A;  4ABL A;  3Q71 A;  3H8F A;  4ESS A;  3SIH A;  5FSU A;  2VRI A;  1LAP A;  1VHU A;  2FG1 A;  3EWQ A;  3VFQ A;  4ZYQ A;  4GVV A;  4GUA A;  2LGR A;  4ETK A;  3EWO A;  2FXK A;  3SIG A;  2L8R A;  3EWP A;  4ZY1 A;  3GQO A;  1TXZ A;  4J5R A;  1TY8 A;  4JGK A;  4JVV A;  2ACF A;  4R76 A;  3H8G A;  3H8E A;  1BLL E;  4ZI6 A;  3Q6Z A;  5CMS A;  2DX6 A;  3GPG A;  5FSV A;  2EWB A;  5E3B A;  3EWR A;  4JLL A;  1LAN A;  3KZW A;  1GYT A;  4D86 A;  1BPM A;  5FSZ A;  1NJR A;  2X47 A;  5CB5 A;  2J9A A;  3EJF A;  4ABK A;  5D8N A;  3IIF A;  2AFC A;  1LAM A;  4K0C A;  4ZX8 A;  4R7M A;  4ZY2 A;  5FSX A;  5CB3 A;  3SII A;  4KSI A;  4J5S A;  4KYB A;  3SIJ A;  2XD7 A;  3GQE A; 
#chains in the Genus database with same CATH topology
 2BFR A;  3EW5 A;  5HOL A;  5CBM A;  1SPV A;  2EEE A;  4R6T A;  4JCA A;  3EKE A;  4TU0 A;  4GVW A;  2FAV A;  3PEI A;  3IJ3 A;  3KQX A;  4X2T A;  3V45 A;  4J4Z A;  1LCP A;  4ETJ A;  3GPQ A;  3JRU A;  3IID A;  3EJG A;  5AIL A;  4K3N A;  4ZY0 A;  4IQY A;  3ETI A;  1HJZ A;  2BFQ A;  4UML A;  5DUS A;  3KR4 A;  1BPN A;  3T8W A;  3GPO A;  3JZT A;  3V2B A;  5HIH A;  3KQZ A;  3KR5 A;  1ZR5 A;  4J5Q A;  1YD9 A;  5FSY A;  4ZX9 A;  2RNK A;  1ZR3 A;  4ABL A;  3Q71 A;  3H8F A;  4ESS A;  3SIH A;  5FSU A;  2VRI A;  1LAP A;  1VHU A;  2FG1 A;  2JZE A;  3EWQ A;  3VFQ A;  4ZYQ A;  4GVV A;  4GUA A;  2LGR A;  4ETK A;  2W2G A;  3EWO A;  2FXK A;  3SIG A;  2L8R A;  3EWP A;  4ZY1 A;  3GQO A;  1TXZ A;  4J5R A;  2JZF A;  1TY8 A;  4JGK A;  4JVV A;  2ACF A;  4R76 A;  3H8G A;  3H8E A;  1BLL E;  2JZD A;  4ZI6 A;  3Q6Z A;  5CMS A;  2DX6 A;  3GPG A;  5FSV A;  2EWB A;  5E3B A;  3EWR A;  4JLL A;  1LAN A;  3KZW A;  1GYT A;  4D86 A;  1BPM A;  5FSZ A;  1NJR A;  2X47 A;  5CB5 A;  2J9A A;  3EJF A;  4ABK A;  5D8N A;  3IIF A;  2WCT A;  2AFC A;  1LAM A;  4K0C A;  4ZX8 A;  4R7M A;  4ZY2 A;  5FSX A;  5CB3 A;  3SII A;  4KSI A;  4J5S A;  2KQV A;  4KYB A;  3SIJ A;  2XD7 A;  3GQE A; 
#chains in the Genus database with same CATH homology
 2BFR A;  3EW5 A;  5HOL A;  5CBM A;  1SPV A;  2EEE A;  4R6T A;  4JCA A;  3EKE A;  4TU0 A;  4GVW A;  2FAV A;  3PEI A;  3IJ3 A;  3KQX A;  4X2T A;  3V45 A;  4J4Z A;  1LCP A;  4ETJ A;  3GPQ A;  3JRU A;  3IID A;  3EJG A;  5AIL A;  4K3N A;  4ZY0 A;  4IQY A;  3ETI A;  1HJZ A;  2BFQ A;  4UML A;  5DUS A;  3KR4 A;  1BPN A;  3T8W A;  3GPO A;  3JZT A;  3V2B A;  5HIH A;  3KQZ A;  3KR5 A;  1ZR5 A;  4J5Q A;  1YD9 A;  5FSY A;  4ZX9 A;  1ZR3 A;  4ABL A;  3Q71 A;  3H8F A;  4ESS A;  3SIH A;  5FSU A;  2VRI A;  1LAP A;  1VHU A;  2FG1 A;  3EWQ A;  3VFQ A;  4ZYQ A;  4GVV A;  4GUA A;  2LGR A;  4ETK A;  3EWO A;  2FXK A;  3SIG A;  2L8R A;  3EWP A;  4ZY1 A;  3GQO A;  1TXZ A;  4J5R A;  1TY8 A;  4JGK A;  4JVV A;  2ACF A;  4R76 A;  3H8G A;  3H8E A;  1BLL E;  4ZI6 A;  3Q6Z A;  5CMS A;  2DX6 A;  3GPG A;  5FSV A;  2EWB A;  5E3B A;  3EWR A;  4JLL A;  1LAN A;  3KZW A;  1GYT A;  4D86 A;  1BPM A;  5FSZ A;  1NJR A;  2X47 A;  5CB5 A;  2J9A A;  3EJF A;  4ABK A;  5D8N A;  3IIF A;  2AFC A;  1LAM A;  4K0C A;  4ZX8 A;  4R7M A;  4ZY2 A;  5FSX A;  5CB3 A;  3SII A;  4KSI A;  4J5S A;  4KYB A;  3SIJ A;  2XD7 A;  3GQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...