4J4ZA

Crystal structure of the improved variant of the evolved serine hydrolase, osh55.4_h1.2, bond with sulfate ion in the active site, northeast structural genomics consortium (nesg) target or301
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
161
structure length
161
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMFEEIKKAPDTLEVTGVHGTEKSAEAYRRALLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed serine hydrolase variant OSH55.4_H1.2
publication title Crystal structure of the improved variant of the evolved serine hydrolase, OSH55.4_H1.2, bond with sulfate ion in the active site, Northeast Structural Genomics Consortium (NESG) Target OR301
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
total genus 54
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j4zA00
2EEEA 5FSYA 4JLLA 3EWPA 3EW5A 4ZYQA 1YD9A 3SIIA 3T8WA 1GYTA 4JCAA 3ETIA 2LGRA 1BPMA 4ABLA 4IQYA 1LAMA 3SIJA 5DUSA 3IIFA 3JRUA 2XD7A 3SIHA 4UMLA 5D8NA 1BLLE 3SIGA 3GPQA 5FSUA 3V2BA 3PEIA 4R76A 3VFQA 3GPGA 1TY8A 5FSXA 1BPNA 2L8RA 4K3NA 2VRIA 3GQEA 1LAPA 4GVWA 4J4ZA 3KZWA 3GQOA 2BFQA 2FG1A 4JGKA 3V45A 3JZTA 4ETKA 1HJZA 4ZX8A 3KR4A 3KQZA 4R7MA 5CMSA 5E3BA 4J5QA 4JVVA 1NJRA 1LANA 2BFRA 3EJFA 4J5SA 5FSVA 3EWRA 4X2TA 1LCPA 5CB5A 1TXZA 2J9AA 3EKEA 4K0CA 5AILA 2AFCA 1SPVA 3KQXA 4ZY2A 3H8EA 2FXKA 2FAVA 4KSIA 3EJGA 4TU0A 3Q6ZA 5FSZA 4ZI6A 5CB3A 3EWOA 3EWQA 4KYBA 4GVVA 4ZY1A 4ABKA 4GUAA 3GPOA 3Q71A 4J5RA 3H8FA 5HIHA 4R6TA 3H8GA 2DX6A 1ZR5A 1ZR3A 4ETJA 4ZX9A 4ESSA 3IIDA 3KR5A 5HOLA 1VHUA 2EWBA 2ACFA 4D86A 4ZY0A 2X47A 3IJ3A 5CBMA
chains in the Genus database with same CATH superfamily
2EEEA 5FSYA 4JLLA 3EWPA 3EW5A 4ZYQA 1YD9A 3SIIA 3T8WA 1GYTA 4JCAA 3ETIA 2LGRA 2JZEA 1BPMA 4ABLA 4IQYA 1LAMA 3SIJA 5DUSA 3IIFA 3JRUA 2XD7A 3SIHA 4UMLA 5D8NA 1BLLE 3SIGA 3GPQA 5FSUA 3V2BA 3PEIA 4R76A 3VFQA 3GPGA 1TY8A 5FSXA 1BPNA 2L8RA 2VRIA 2JZFA 3GQEA 4K3NA 1LAPA 4GVWA 2JZDA 4J4ZA 3KZWA 3GQOA 2BFQA 2FG1A 4JGKA 3V45A 3JZTA 4ETKA 1HJZA 4ZX8A 3KR4A 3KQZA 4R7MA 5CMSA 5E3BA 4J5QA 4JVVA 1NJRA 1LANA 2BFRA 3EJFA 4J5SA 5FSVA 3EWRA 4X2TA 1LCPA 5CB5A 1TXZA 2WCTA 2J9AA 3EKEA 4K0CA 5AILA 2AFCA 1SPVA 3KQXA 4ZY2A 3H8EA 2FXKA 2FAVA 4KSIA 3EJGA 4TU0A 3Q6ZA 2KQVA 5FSZA 4ZI6A 5CB3A 3EWOA 3EWQA 4KYBA 4GVVA 4ZY1A 4ABKA 4GUAA 3GPOA 2RNKA 3Q71A 4J5RA 3H8FA 5HIHA 4R6TA 3H8GA 2DX6A 1ZR5A 1ZR3A 4ETJA 4ZX9A 4ESSA 3IIDA 3KR5A 5HOLA 1VHUA 2EWBA 2ACFA 4D86A 4ZY0A 2X47A 3IJ3A 5CBMA 2W2GA
chains in the Genus database with same CATH topology
2EEEA 5FSYA 4JLLA 3EWPA 3EW5A 4ZYQA 1YD9A 3SIIA 3T8WA 1GYTA 4JCAA 3ETIA 2LGRA 1BPMA 4ABLA 4IQYA 1LAMA 3SIJA 5DUSA 3IIFA 3JRUA 2XD7A 3SIHA 4UMLA 5D8NA 1BLLE 3SIGA 3GPQA 5FSUA 3V2BA 3PEIA 4R76A 3VFQA 3GPGA 1TY8A 5FSXA 1BPNA 2L8RA 4K3NA 2VRIA 3GQEA 1LAPA 4GVWA 4J4ZA 3KZWA 3GQOA 2BFQA 2FG1A 4JGKA 3V45A 3JZTA 4ETKA 1HJZA 4ZX8A 3KR4A 3KQZA 4R7MA 5CMSA 5E3BA 4J5QA 4JVVA 1NJRA 1LANA 2BFRA 3EJFA 4J5SA 5FSVA 3EWRA 4X2TA 1LCPA 5CB5A 1TXZA 2J9AA 3EKEA 4K0CA 5AILA 2AFCA 1SPVA 3KQXA 4ZY2A 3H8EA 2FXKA 2FAVA 4KSIA 3EJGA 4TU0A 3Q6ZA 5FSZA 4ZI6A 5CB3A 3EWOA 3EWQA 4KYBA 4GVVA 4ZY1A 4ABKA 4GUAA 3GPOA 3Q71A 4J5RA 3H8FA 5HIHA 4R6TA 3H8GA 2DX6A 1ZR5A 1ZR3A 4ETJA 4ZX9A 4ESSA 3IIDA 3KR5A 5HOLA 1VHUA 2EWBA 2ACFA 4D86A 4ZY0A 2X47A 3IJ3A 5CBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EEE A;  5FSY A;  4JLL A;  3EWP A;  3EW5 A;  4ZYQ A;  1YD9 A;  3SII A;  3T8W A;  1GYT A;  4JCA A;  3ETI A;  2LGR A;  1BPM A;  4ABL A;  4IQY A;  1LAM A;  3SIJ A;  5DUS A;  3IIF A;  3JRU A;  2XD7 A;  3SIH A;  4UML A;  5D8N A;  1BLL E;  3SIG A;  3GPQ A;  5FSU A;  3V2B A;  3PEI A;  4R76 A;  3VFQ A;  3GPG A;  1TY8 A;  5FSX A;  1BPN A;  2L8R A;  4K3N A;  2VRI A;  3GQE A;  1LAP A;  4GVW A;  4J4Z A;  3KZW A;  3GQO A;  2BFQ A;  2FG1 A;  4JGK A;  3V45 A;  3JZT A;  4ETK A;  1HJZ A;  4ZX8 A;  3KR4 A;  3KQZ A;  4R7M A;  5CMS A;  5E3B A;  4J5Q A;  4JVV A;  1NJR A;  1LAN A;  2BFR A;  3EJF A;  4J5S A;  5FSV A;  3EWR A;  4X2T A;  1LCP A;  5CB5 A;  1TXZ A;  2J9A A;  3EKE A;  4K0C A;  5AIL A;  2AFC A;  1SPV A;  3KQX A;  4ZY2 A;  3H8E A;  2FXK A;  2FAV A;  4KSI A;  3EJG A;  4TU0 A;  3Q6Z A;  5FSZ A;  4ZI6 A;  5CB3 A;  3EWO A;  3EWQ A;  4KYB A;  4GVV A;  4ZY1 A;  4ABK A;  4GUA A;  3GPO A;  3Q71 A;  4J5R A;  3H8F A;  5HIH A;  4R6T A;  3H8G A;  2DX6 A;  1ZR5 A;  1ZR3 A;  4ETJ A;  4ZX9 A;  4ESS A;  3IID A;  3KR5 A;  5HOL A;  1VHU A;  2EWB A;  2ACF A;  4D86 A;  4ZY0 A;  2X47 A;  3IJ3 A;  5CBM A; 
#chains in the Genus database with same CATH topology
 2EEE A;  5FSY A;  4JLL A;  3EWP A;  3EW5 A;  4ZYQ A;  1YD9 A;  3SII A;  3T8W A;  1GYT A;  4JCA A;  3ETI A;  2LGR A;  2JZE A;  1BPM A;  4ABL A;  4IQY A;  1LAM A;  3SIJ A;  5DUS A;  3IIF A;  3JRU A;  2XD7 A;  3SIH A;  4UML A;  5D8N A;  1BLL E;  3SIG A;  3GPQ A;  5FSU A;  3V2B A;  3PEI A;  4R76 A;  3VFQ A;  3GPG A;  1TY8 A;  5FSX A;  1BPN A;  2L8R A;  2VRI A;  2JZF A;  3GQE A;  4K3N A;  1LAP A;  4GVW A;  2JZD A;  4J4Z A;  3KZW A;  3GQO A;  2BFQ A;  2FG1 A;  4JGK A;  3V45 A;  3JZT A;  4ETK A;  1HJZ A;  4ZX8 A;  3KR4 A;  3KQZ A;  4R7M A;  5CMS A;  5E3B A;  4J5Q A;  4JVV A;  1NJR A;  1LAN A;  2BFR A;  3EJF A;  4J5S A;  5FSV A;  3EWR A;  4X2T A;  1LCP A;  5CB5 A;  1TXZ A;  2WCT A;  2J9A A;  3EKE A;  4K0C A;  5AIL A;  2AFC A;  1SPV A;  3KQX A;  4ZY2 A;  3H8E A;  2FXK A;  2FAV A;  4KSI A;  3EJG A;  4TU0 A;  3Q6Z A;  2KQV A;  5FSZ A;  4ZI6 A;  5CB3 A;  3EWO A;  3EWQ A;  4KYB A;  4GVV A;  4ZY1 A;  4ABK A;  4GUA A;  3GPO A;  2RNK A;  3Q71 A;  4J5R A;  3H8F A;  5HIH A;  4R6T A;  3H8G A;  2DX6 A;  1ZR5 A;  1ZR3 A;  4ETJ A;  4ZX9 A;  4ESS A;  3IID A;  3KR5 A;  5HOL A;  1VHU A;  2EWB A;  2ACF A;  4D86 A;  4ZY0 A;  2X47 A;  3IJ3 A;  5CBM A;  2W2G A; 
#chains in the Genus database with same CATH homology
 2EEE A;  5FSY A;  4JLL A;  3EWP A;  3EW5 A;  4ZYQ A;  1YD9 A;  3SII A;  3T8W A;  1GYT A;  4JCA A;  3ETI A;  2LGR A;  1BPM A;  4ABL A;  4IQY A;  1LAM A;  3SIJ A;  5DUS A;  3IIF A;  3JRU A;  2XD7 A;  3SIH A;  4UML A;  5D8N A;  1BLL E;  3SIG A;  3GPQ A;  5FSU A;  3V2B A;  3PEI A;  4R76 A;  3VFQ A;  3GPG A;  1TY8 A;  5FSX A;  1BPN A;  2L8R A;  4K3N A;  2VRI A;  3GQE A;  1LAP A;  4GVW A;  4J4Z A;  3KZW A;  3GQO A;  2BFQ A;  2FG1 A;  4JGK A;  3V45 A;  3JZT A;  4ETK A;  1HJZ A;  4ZX8 A;  3KR4 A;  3KQZ A;  4R7M A;  5CMS A;  5E3B A;  4J5Q A;  4JVV A;  1NJR A;  1LAN A;  2BFR A;  3EJF A;  4J5S A;  5FSV A;  3EWR A;  4X2T A;  1LCP A;  5CB5 A;  1TXZ A;  2J9A A;  3EKE A;  4K0C A;  5AIL A;  2AFC A;  1SPV A;  3KQX A;  4ZY2 A;  3H8E A;  2FXK A;  2FAV A;  4KSI A;  3EJG A;  4TU0 A;  3Q6Z A;  5FSZ A;  4ZI6 A;  5CB3 A;  3EWO A;  3EWQ A;  4KYB A;  4GVV A;  4ZY1 A;  4ABK A;  4GUA A;  3GPO A;  3Q71 A;  4J5R A;  3H8F A;  5HIH A;  4R6T A;  3H8G A;  2DX6 A;  1ZR5 A;  1ZR3 A;  4ETJ A;  4ZX9 A;  4ESS A;  3IID A;  3KR5 A;  5HOL A;  1VHU A;  2EWB A;  2ACF A;  4D86 A;  4ZY0 A;  2X47 A;  3IJ3 A;  5CBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...