3IIFA

Crystal structure of the macro domain of human histone macroh2a1.1 in complex with adp-ribose (form b)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
183
structure length
183
Chain Sequence
DGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Core histone macro-H2A.1, Isoform 1
publication title A macrodomain-containing histone rearranges chromatin upon sensing PARP1 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 63
structure length 183
sequence length 183
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3iifA00
2DX6A 3EJGA 2FXKA 4IQYA 3H8EA 2X47A 5AILA 3H8GA 3T8WA 1LAMA 5HOLA 4ZX8A 4R6TA 3GQEA 4J5SA 3KR4A 1GYTA 1LANA 5FSYA 1BLLE 3EJFA 4R7MA 2LGRA 4GUAA 3Q71A 3IIDA 3KR5A 1NJRA 3KZWA 1TY8A 4TU0A 3VFQA 4ZI6A 5FSUA 2AFCA 4ZYQA 3SIIA 1LCPA 1HJZA 4ETKA 5CB3A 4ETJA 3EWOA 2EEEA 3PEIA 3GPQA 4R76A 3ETIA 3EW5A 2VRIA 4ZY0A 1BPMA 2BFRA 1ZR5A 5HIHA 3SIGA 3V2BA 5CMSA 4JVVA 4K0CA 2BFQA 3IJ3A 3EWRA 3IIFA 3JRUA 4X2TA 4J4ZA 3KQZA 4GVWA 1VHUA 3SIHA 3GPOA 1SPVA 2FG1A 3SIJA 4D86A 3V45A 5D8NA 3EKEA 4ZY1A 2J9AA 3EWPA 5DUSA 4UMLA 4ABLA 2EWBA 4K3NA 5E3BA 1TXZA 4JCAA 5CBMA 2XD7A 2L8RA 3GQOA 5FSXA 2ACFA 4JGKA 4JLLA 4KYBA 4ZX9A 1YD9A 1ZR3A 3EWQA 3GPGA 3H8FA 5FSZA 4KSIA 4ESSA 4ABKA 1BPNA 1LAPA 2FAVA 5FSVA 4ZY2A 4J5QA 4J5RA 3Q6ZA 5CB5A 3JZTA 3KQXA 4GVVA
chains in the Genus database with same CATH superfamily
2DX6A 3EJGA 2FXKA 4IQYA 3H8EA 2X47A 5AILA 3H8GA 3T8WA 1LAMA 5HOLA 4ZX8A 4R6TA 3GQEA 4J5SA 3KR4A 1GYTA 1LANA 5FSYA 2W2GA 1BLLE 3EJFA 2WCTA 4R7MA 2LGRA 4GUAA 3Q71A 3IIDA 3KR5A 1NJRA 3KZWA 1TY8A 4TU0A 3VFQA 4ZI6A 5FSUA 2AFCA 4ZYQA 3SIIA 1LCPA 1HJZA 4ETKA 5CB3A 4ETJA 3EWOA 2EEEA 3PEIA 3GPQA 4R76A 3ETIA 3EW5A 2VRIA 2JZDA 4ZY0A 2RNKA 1BPMA 2BFRA 2JZEA 1ZR5A 5HIHA 3SIGA 3V2BA 5CMSA 4JVVA 4K0CA 2BFQA 3IJ3A 3EWRA 3IIFA 3JRUA 4X2TA 4J4ZA 3KQZA 4GVWA 1VHUA 3SIHA 3GPOA 1SPVA 2FG1A 3SIJA 4D86A 3V45A 5D8NA 3EKEA 4ZY1A 2J9AA 3EWPA 5DUSA 4UMLA 4ABLA 2EWBA 4K3NA 5E3BA 1TXZA 4JCAA 5CBMA 2XD7A 2L8RA 3GQOA 5FSXA 2ACFA 2KQVA 4JGKA 4JLLA 4KYBA 4ZX9A 1YD9A 2JZFA 1ZR3A 3EWQA 3GPGA 3H8FA 5FSZA 4KSIA 4ESSA 4ABKA 1BPNA 1LAPA 2FAVA 5FSVA 4ZY2A 4J5QA 4J5RA 3Q6ZA 5CB5A 3JZTA 3KQXA 4GVVA
chains in the Genus database with same CATH topology
2DX6A 3EJGA 2FXKA 4IQYA 3H8EA 2X47A 5AILA 3H8GA 3T8WA 1LAMA 5HOLA 4ZX8A 4R6TA 3GQEA 4J5SA 3KR4A 1GYTA 1LANA 5FSYA 1BLLE 3EJFA 4R7MA 2LGRA 4GUAA 3Q71A 3IIDA 3KR5A 1NJRA 3KZWA 1TY8A 4TU0A 3VFQA 4ZI6A 5FSUA 2AFCA 4ZYQA 3SIIA 1LCPA 1HJZA 4ETKA 5CB3A 4ETJA 3EWOA 2EEEA 3PEIA 3GPQA 4R76A 3ETIA 3EW5A 2VRIA 4ZY0A 1BPMA 2BFRA 1ZR5A 5HIHA 3SIGA 3V2BA 5CMSA 4JVVA 4K0CA 2BFQA 3IJ3A 3EWRA 3IIFA 3JRUA 4X2TA 4J4ZA 3KQZA 4GVWA 1VHUA 3SIHA 3GPOA 1SPVA 2FG1A 3SIJA 4D86A 3V45A 5D8NA 3EKEA 4ZY1A 2J9AA 3EWPA 5DUSA 4UMLA 4ABLA 2EWBA 4K3NA 5E3BA 1TXZA 4JCAA 5CBMA 2XD7A 2L8RA 3GQOA 5FSXA 2ACFA 4JGKA 4JLLA 4KYBA 4ZX9A 1YD9A 1ZR3A 3EWQA 3GPGA 3H8FA 5FSZA 4KSIA 4ESSA 4ABKA 1BPNA 1LAPA 2FAVA 5FSVA 4ZY2A 4J5QA 4J5RA 3Q6ZA 5CB5A 3JZTA 3KQXA 4GVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX6 A;  3EJG A;  2FXK A;  4IQY A;  3H8E A;  2X47 A;  5AIL A;  3H8G A;  3T8W A;  1LAM A;  5HOL A;  4ZX8 A;  4R6T A;  3GQE A;  4J5S A;  3KR4 A;  1GYT A;  1LAN A;  5FSY A;  1BLL E;  3EJF A;  4R7M A;  2LGR A;  4GUA A;  3Q71 A;  3IID A;  3KR5 A;  1NJR A;  3KZW A;  1TY8 A;  4TU0 A;  3VFQ A;  4ZI6 A;  5FSU A;  2AFC A;  4ZYQ A;  3SII A;  1LCP A;  1HJZ A;  4ETK A;  5CB3 A;  4ETJ A;  3EWO A;  2EEE A;  3PEI A;  3GPQ A;  4R76 A;  3ETI A;  3EW5 A;  2VRI A;  4ZY0 A;  1BPM A;  2BFR A;  1ZR5 A;  5HIH A;  3SIG A;  3V2B A;  5CMS A;  4JVV A;  4K0C A;  2BFQ A;  3IJ3 A;  3EWR A;  3IIF A;  3JRU A;  4X2T A;  4J4Z A;  3KQZ A;  4GVW A;  1VHU A;  3SIH A;  3GPO A;  1SPV A;  2FG1 A;  3SIJ A;  4D86 A;  3V45 A;  5D8N A;  3EKE A;  4ZY1 A;  2J9A A;  3EWP A;  5DUS A;  4UML A;  4ABL A;  2EWB A;  4K3N A;  5E3B A;  1TXZ A;  4JCA A;  5CBM A;  2XD7 A;  2L8R A;  3GQO A;  5FSX A;  2ACF A;  4JGK A;  4JLL A;  4KYB A;  4ZX9 A;  1YD9 A;  1ZR3 A;  3EWQ A;  3GPG A;  3H8F A;  5FSZ A;  4KSI A;  4ESS A;  4ABK A;  1BPN A;  1LAP A;  2FAV A;  5FSV A;  4ZY2 A;  4J5Q A;  4J5R A;  3Q6Z A;  5CB5 A;  3JZT A;  3KQX A;  4GVV A; 
#chains in the Genus database with same CATH topology
 2DX6 A;  3EJG A;  2FXK A;  4IQY A;  3H8E A;  2X47 A;  5AIL A;  3H8G A;  3T8W A;  1LAM A;  5HOL A;  4ZX8 A;  4R6T A;  3GQE A;  4J5S A;  3KR4 A;  1GYT A;  1LAN A;  5FSY A;  2W2G A;  1BLL E;  3EJF A;  2WCT A;  4R7M A;  2LGR A;  4GUA A;  3Q71 A;  3IID A;  3KR5 A;  1NJR A;  3KZW A;  1TY8 A;  4TU0 A;  3VFQ A;  4ZI6 A;  5FSU A;  2AFC A;  4ZYQ A;  3SII A;  1LCP A;  1HJZ A;  4ETK A;  5CB3 A;  4ETJ A;  3EWO A;  2EEE A;  3PEI A;  3GPQ A;  4R76 A;  3ETI A;  3EW5 A;  2VRI A;  2JZD A;  4ZY0 A;  2RNK A;  1BPM A;  2BFR A;  2JZE A;  1ZR5 A;  5HIH A;  3SIG A;  3V2B A;  5CMS A;  4JVV A;  4K0C A;  2BFQ A;  3IJ3 A;  3EWR A;  3IIF A;  3JRU A;  4X2T A;  4J4Z A;  3KQZ A;  4GVW A;  1VHU A;  3SIH A;  3GPO A;  1SPV A;  2FG1 A;  3SIJ A;  4D86 A;  3V45 A;  5D8N A;  3EKE A;  4ZY1 A;  2J9A A;  3EWP A;  5DUS A;  4UML A;  4ABL A;  2EWB A;  4K3N A;  5E3B A;  1TXZ A;  4JCA A;  5CBM A;  2XD7 A;  2L8R A;  3GQO A;  5FSX A;  2ACF A;  2KQV A;  4JGK A;  4JLL A;  4KYB A;  4ZX9 A;  1YD9 A;  2JZF A;  1ZR3 A;  3EWQ A;  3GPG A;  3H8F A;  5FSZ A;  4KSI A;  4ESS A;  4ABK A;  1BPN A;  1LAP A;  2FAV A;  5FSV A;  4ZY2 A;  4J5Q A;  4J5R A;  3Q6Z A;  5CB5 A;  3JZT A;  3KQX A;  4GVV A; 
#chains in the Genus database with same CATH homology
 2DX6 A;  3EJG A;  2FXK A;  4IQY A;  3H8E A;  2X47 A;  5AIL A;  3H8G A;  3T8W A;  1LAM A;  5HOL A;  4ZX8 A;  4R6T A;  3GQE A;  4J5S A;  3KR4 A;  1GYT A;  1LAN A;  5FSY A;  1BLL E;  3EJF A;  4R7M A;  2LGR A;  4GUA A;  3Q71 A;  3IID A;  3KR5 A;  1NJR A;  3KZW A;  1TY8 A;  4TU0 A;  3VFQ A;  4ZI6 A;  5FSU A;  2AFC A;  4ZYQ A;  3SII A;  1LCP A;  1HJZ A;  4ETK A;  5CB3 A;  4ETJ A;  3EWO A;  2EEE A;  3PEI A;  3GPQ A;  4R76 A;  3ETI A;  3EW5 A;  2VRI A;  4ZY0 A;  1BPM A;  2BFR A;  1ZR5 A;  5HIH A;  3SIG A;  3V2B A;  5CMS A;  4JVV A;  4K0C A;  2BFQ A;  3IJ3 A;  3EWR A;  3IIF A;  3JRU A;  4X2T A;  4J4Z A;  3KQZ A;  4GVW A;  1VHU A;  3SIH A;  3GPO A;  1SPV A;  2FG1 A;  3SIJ A;  4D86 A;  3V45 A;  5D8N A;  3EKE A;  4ZY1 A;  2J9A A;  3EWP A;  5DUS A;  4UML A;  4ABL A;  2EWB A;  4K3N A;  5E3B A;  1TXZ A;  4JCA A;  5CBM A;  2XD7 A;  2L8R A;  3GQO A;  5FSX A;  2ACF A;  4JGK A;  4JLL A;  4KYB A;  4ZX9 A;  1YD9 A;  1ZR3 A;  3EWQ A;  3GPG A;  3H8F A;  5FSZ A;  4KSI A;  4ESS A;  4ABK A;  1BPN A;  1LAP A;  2FAV A;  5FSV A;  4ZY2 A;  4J5Q A;  4J5R A;  3Q6Z A;  5CB5 A;  3JZT A;  3KQX A;  4GVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...