4ETJA

Crystal structure of e6h variant of de novo designed serine hydrolase osh55, northeast structural genomics consortium (nesg) target or185
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
164
structure length
164
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVLRVMLEEIKKAPDTLEVTGVHGTEKSAEAARRALLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Serine hydrolase
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Artificial gene
total genus 61
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2012-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4etjA00
3Q71A 1BPMA 1TXZA 1VHUA 3IIFA 4J4ZA 3T8WA 4KYBA 3KQXA 4R7MA 3EWRA 4X2TA 3KR5A 4JLLA 3V45A 3EW5A 2FXKA 2DX6A 2J9AA 3SIHA 4J5RA 3JZTA 2BFQA 2VRIA 3H8EA 5FSYA 4R76A 4ZY0A 4ZY1A 3GPOA 2ACFA 3GQOA 3PEIA 4K0CA 5CMSA 2FG1A 4R6TA 4UMLA 5HIHA 4ABLA 4JVVA 4GVWA 2AFCA 3EWPA 5DUSA 4ZYQA 3EWOA 5E3BA 4KSIA 1LCPA 2FAVA 1GYTA 5FSVA 4JGKA 3VFQA 4GUAA 3H8GA 1LANA 4ZX9A 3KR4A 1BLLE 1ZR3A 4J5QA 5AILA 3EKEA 3KQZA 5FSUA 4ZI6A 3EJGA 5D8NA 3Q6ZA 5CB3A 3EJFA 2EEEA 4IQYA 5CB5A 4ETJA 3SIIA 2L8RA 3V2BA 4ZX8A 3JRUA 2X47A 3IJ3A 1TY8A 4TU0A 3H8FA 3SIJA 3KZWA 4ESSA 5FSXA 4GVVA 3GPQA 4ZY2A 3GPGA 4D86A 3GQEA 4K3NA 1BPNA 1YD9A 1LAMA 4JCAA 2BFRA 5CBMA 2EWBA 1NJRA 1ZR5A 1HJZA 2XD7A 5FSZA 2LGRA 3ETIA 3SIGA 5HOLA 1SPVA 3EWQA 1LAPA 3IIDA 4J5SA 4ABKA 4ETKA
chains in the Genus database with same CATH superfamily
3Q71A 1BPMA 1TXZA 1VHUA 3IIFA 4J4ZA 3T8WA 4KYBA 3KQXA 4R7MA 3EWRA 4X2TA 3KR5A 4JLLA 3V45A 3EW5A 2FXKA 2DX6A 2J9AA 2JZEA 3SIHA 4J5RA 3JZTA 2BFQA 2VRIA 3H8EA 5FSYA 4R76A 4ZY0A 4ZY1A 3GPOA 2ACFA 3GQOA 3PEIA 4K0CA 5CMSA 2FG1A 4R6TA 4UMLA 5HIHA 4ABLA 2JZFA 4JVVA 4GVWA 2AFCA 3EWPA 5DUSA 4ZYQA 3EWOA 5E3BA 4KSIA 2WCTA 1LCPA 2FAVA 1GYTA 5FSVA 4JGKA 3VFQA 4GUAA 3H8GA 1LANA 4ZX9A 3KR4A 2JZDA 1BLLE 1ZR3A 4J5QA 5AILA 3EKEA 2KQVA 3KQZA 5FSUA 4ZI6A 3EJGA 5D8NA 3Q6ZA 5CB3A 3EJFA 2EEEA 4IQYA 5CB5A 4ETJA 3SIIA 2L8RA 3V2BA 4ZX8A 3JRUA 2X47A 2RNKA 1TY8A 3IJ3A 4TU0A 3H8FA 3SIJA 3KZWA 2W2GA 4ESSA 5FSXA 4GVVA 3GPQA 4ZY2A 3GPGA 4D86A 3GQEA 4K3NA 1BPNA 1YD9A 1LAMA 4JCAA 2BFRA 5CBMA 2EWBA 1NJRA 1ZR5A 1HJZA 2XD7A 5FSZA 2LGRA 3ETIA 3SIGA 5HOLA 1SPVA 3EWQA 1LAPA 3IIDA 4J5SA 4ABKA 4ETKA
chains in the Genus database with same CATH topology
3Q71A 1BPMA 1TXZA 1VHUA 3IIFA 4J4ZA 3T8WA 4KYBA 3KQXA 4R7MA 3EWRA 4X2TA 3KR5A 4JLLA 3V45A 3EW5A 2FXKA 2DX6A 2J9AA 3SIHA 4J5RA 3JZTA 2BFQA 2VRIA 3H8EA 5FSYA 4R76A 4ZY0A 4ZY1A 3GPOA 2ACFA 3GQOA 3PEIA 4K0CA 5CMSA 2FG1A 4R6TA 4UMLA 5HIHA 4ABLA 4JVVA 4GVWA 2AFCA 3EWPA 5DUSA 4ZYQA 3EWOA 5E3BA 4KSIA 1LCPA 2FAVA 1GYTA 5FSVA 4JGKA 3VFQA 4GUAA 3H8GA 1LANA 4ZX9A 3KR4A 1BLLE 1ZR3A 4J5QA 5AILA 3EKEA 3KQZA 5FSUA 4ZI6A 3EJGA 5D8NA 3Q6ZA 5CB3A 3EJFA 2EEEA 4IQYA 5CB5A 4ETJA 3SIIA 2L8RA 3V2BA 4ZX8A 3JRUA 2X47A 3IJ3A 1TY8A 4TU0A 3H8FA 3SIJA 3KZWA 4ESSA 5FSXA 4GVVA 3GPQA 4ZY2A 3GPGA 4D86A 3GQEA 4K3NA 1BPNA 1YD9A 1LAMA 4JCAA 2BFRA 5CBMA 2EWBA 1NJRA 1ZR5A 1HJZA 2XD7A 5FSZA 2LGRA 3ETIA 3SIGA 5HOLA 1SPVA 3EWQA 1LAPA 3IIDA 4J5SA 4ABKA 4ETKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q71 A;  1BPM A;  1TXZ A;  1VHU A;  3IIF A;  4J4Z A;  3T8W A;  4KYB A;  3KQX A;  4R7M A;  3EWR A;  4X2T A;  3KR5 A;  4JLL A;  3V45 A;  3EW5 A;  2FXK A;  2DX6 A;  2J9A A;  3SIH A;  4J5R A;  3JZT A;  2BFQ A;  2VRI A;  3H8E A;  5FSY A;  4R76 A;  4ZY0 A;  4ZY1 A;  3GPO A;  2ACF A;  3GQO A;  3PEI A;  4K0C A;  5CMS A;  2FG1 A;  4R6T A;  4UML A;  5HIH A;  4ABL A;  4JVV A;  4GVW A;  2AFC A;  3EWP A;  5DUS A;  4ZYQ A;  3EWO A;  5E3B A;  4KSI A;  1LCP A;  2FAV A;  1GYT A;  5FSV A;  4JGK A;  3VFQ A;  4GUA A;  3H8G A;  1LAN A;  4ZX9 A;  3KR4 A;  1BLL E;  1ZR3 A;  4J5Q A;  5AIL A;  3EKE A;  3KQZ A;  5FSU A;  4ZI6 A;  3EJG A;  5D8N A;  3Q6Z A;  5CB3 A;  3EJF A;  2EEE A;  4IQY A;  5CB5 A;  4ETJ A;  3SII A;  2L8R A;  3V2B A;  4ZX8 A;  3JRU A;  2X47 A;  3IJ3 A;  1TY8 A;  4TU0 A;  3H8F A;  3SIJ A;  3KZW A;  4ESS A;  5FSX A;  4GVV A;  3GPQ A;  4ZY2 A;  3GPG A;  4D86 A;  3GQE A;  4K3N A;  1BPN A;  1YD9 A;  1LAM A;  4JCA A;  2BFR A;  5CBM A;  2EWB A;  1NJR A;  1ZR5 A;  1HJZ A;  2XD7 A;  5FSZ A;  2LGR A;  3ETI A;  3SIG A;  5HOL A;  1SPV A;  3EWQ A;  1LAP A;  3IID A;  4J5S A;  4ABK A;  4ETK A; 
#chains in the Genus database with same CATH topology
 3Q71 A;  1BPM A;  1TXZ A;  1VHU A;  3IIF A;  4J4Z A;  3T8W A;  4KYB A;  3KQX A;  4R7M A;  3EWR A;  4X2T A;  3KR5 A;  4JLL A;  3V45 A;  3EW5 A;  2FXK A;  2DX6 A;  2J9A A;  2JZE A;  3SIH A;  4J5R A;  3JZT A;  2BFQ A;  2VRI A;  3H8E A;  5FSY A;  4R76 A;  4ZY0 A;  4ZY1 A;  3GPO A;  2ACF A;  3GQO A;  3PEI A;  4K0C A;  5CMS A;  2FG1 A;  4R6T A;  4UML A;  5HIH A;  4ABL A;  2JZF A;  4JVV A;  4GVW A;  2AFC A;  3EWP A;  5DUS A;  4ZYQ A;  3EWO A;  5E3B A;  4KSI A;  2WCT A;  1LCP A;  2FAV A;  1GYT A;  5FSV A;  4JGK A;  3VFQ A;  4GUA A;  3H8G A;  1LAN A;  4ZX9 A;  3KR4 A;  2JZD A;  1BLL E;  1ZR3 A;  4J5Q A;  5AIL A;  3EKE A;  2KQV A;  3KQZ A;  5FSU A;  4ZI6 A;  3EJG A;  5D8N A;  3Q6Z A;  5CB3 A;  3EJF A;  2EEE A;  4IQY A;  5CB5 A;  4ETJ A;  3SII A;  2L8R A;  3V2B A;  4ZX8 A;  3JRU A;  2X47 A;  2RNK A;  1TY8 A;  3IJ3 A;  4TU0 A;  3H8F A;  3SIJ A;  3KZW A;  2W2G A;  4ESS A;  5FSX A;  4GVV A;  3GPQ A;  4ZY2 A;  3GPG A;  4D86 A;  3GQE A;  4K3N A;  1BPN A;  1YD9 A;  1LAM A;  4JCA A;  2BFR A;  5CBM A;  2EWB A;  1NJR A;  1ZR5 A;  1HJZ A;  2XD7 A;  5FSZ A;  2LGR A;  3ETI A;  3SIG A;  5HOL A;  1SPV A;  3EWQ A;  1LAP A;  3IID A;  4J5S A;  4ABK A;  4ETK A; 
#chains in the Genus database with same CATH homology
 3Q71 A;  1BPM A;  1TXZ A;  1VHU A;  3IIF A;  4J4Z A;  3T8W A;  4KYB A;  3KQX A;  4R7M A;  3EWR A;  4X2T A;  3KR5 A;  4JLL A;  3V45 A;  3EW5 A;  2FXK A;  2DX6 A;  2J9A A;  3SIH A;  4J5R A;  3JZT A;  2BFQ A;  2VRI A;  3H8E A;  5FSY A;  4R76 A;  4ZY0 A;  4ZY1 A;  3GPO A;  2ACF A;  3GQO A;  3PEI A;  4K0C A;  5CMS A;  2FG1 A;  4R6T A;  4UML A;  5HIH A;  4ABL A;  4JVV A;  4GVW A;  2AFC A;  3EWP A;  5DUS A;  4ZYQ A;  3EWO A;  5E3B A;  4KSI A;  1LCP A;  2FAV A;  1GYT A;  5FSV A;  4JGK A;  3VFQ A;  4GUA A;  3H8G A;  1LAN A;  4ZX9 A;  3KR4 A;  1BLL E;  1ZR3 A;  4J5Q A;  5AIL A;  3EKE A;  3KQZ A;  5FSU A;  4ZI6 A;  3EJG A;  5D8N A;  3Q6Z A;  5CB3 A;  3EJF A;  2EEE A;  4IQY A;  5CB5 A;  4ETJ A;  3SII A;  2L8R A;  3V2B A;  4ZX8 A;  3JRU A;  2X47 A;  3IJ3 A;  1TY8 A;  4TU0 A;  3H8F A;  3SIJ A;  3KZW A;  4ESS A;  5FSX A;  4GVV A;  3GPQ A;  4ZY2 A;  3GPG A;  4D86 A;  3GQE A;  4K3N A;  1BPN A;  1YD9 A;  1LAM A;  4JCA A;  2BFR A;  5CBM A;  2EWB A;  1NJR A;  1ZR5 A;  1HJZ A;  2XD7 A;  5FSZ A;  2LGR A;  3ETI A;  3SIG A;  5HOL A;  1SPV A;  3EWQ A;  1LAP A;  3IID A;  4J5S A;  4ABK A;  4ETK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...