4ETJA

Crystal structure of e6h variant of de novo designed serine hydrolase osh55, northeast structural genomics consortium (nesg) target or185
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
164
structure length
164
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVLRVMLEEIKKAPDTLEVTGVHGTEKSAEAARRALLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords Serine hydrolase
total genus 61
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2012-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4etjA00
1LANA 2BFQA 3EW5A 3KR5A 3Q6ZA 5CB3A 4ETJA 2BFRA 5CB5A 3EJFA 3IJ3A 5HOLA 5FSUA 4ZI6A 3GPOA 4R7MA 3ETIA 2ACFA 3GPQA 4KYBA 1TXZA 4JCAA 2L8RA 3JZTA 4TU0A 2DX6A 1SPVA 4J5RA 4ETKA 3KQXA 4J5SA 4ABKA 3JRUA 3EJGA 3EWRA 3EWOA 1YD9A 4K3NA 4ZYQA 3SIJA 5FSYA 4R76A 3PEIA 2EWBA 4JVVA 5FSZA 3EWPA 1VHUA 4J4ZA 5D8NA 5HIHA 5FSVA 1ZR5A 2J9AA 4ZY1A 3H8FA 1ZR3A 2XD7A 5AILA 3KQZA 3V2BA 4ABLA 3H8GA 3SIHA 2FAVA 1BPMA 1HJZA 1BPNA 5FSXA 1NJRA 4UMLA 4JLLA 1BLLE 3T8WA 5DUSA 3VFQA 3SIIA 4ZY2A 4GVVA 4ZX8A 2AFCA 3EWQA 4K0CA 4ZY0A 4GUAA 1LAPA 2FG1A 5CBMA 3IIFA 5E3BA 4KSIA 3GQOA 2LGRA 4D86A 3V45A 4GVWA 1TY8A 3EKEA 1LAMA 2VRIA 3KR4A 4J5QA 1GYTA 3SIGA 5CMSA 4X2TA 1LCPA 4ESSA 3GPGA 2EEEA 3GQEA 3KZWA 4R6TA 3IIDA 2FXKA 3Q71A 4ZX9A 2X47A 4JGKA 4IQYA 3H8EA
chains in the Genus database with same CATH superfamily
1LANA 2BFQA 3EW5A 3KR5A 3Q6ZA 5CB3A 4ETJA 2BFRA 5CB5A 3EJFA 3IJ3A 5HOLA 5FSUA 4ZI6A 3GPOA 4R7MA 3ETIA 2ACFA 3GPQA 4KYBA 1TXZA 4JCAA 2L8RA 3JZTA 4TU0A 2DX6A 1SPVA 4J5RA 2JZEA 3KQXA 4ETKA 4J5SA 4ABKA 3JRUA 3EJGA 3EWRA 3EWOA 1YD9A 4K3NA 4ZYQA 3SIJA 5FSYA 4R76A 3PEIA 2EWBA 4JVVA 5FSZA 3EWPA 1VHUA 4J4ZA 5D8NA 5HIHA 5FSVA 1ZR5A 2J9AA 4ZY1A 3H8FA 2WCTA 1ZR3A 2KQVA 2XD7A 5AILA 3KQZA 3V2BA 4ABLA 2JZFA 3H8GA 2JZDA 3SIHA 2FAVA 1BPMA 1HJZA 2W2GA 1BPNA 5FSXA 1NJRA 4UMLA 4JLLA 1BLLE 3T8WA 5DUSA 3VFQA 3SIIA 4ZY2A 4GVVA 4ZX8A 2AFCA 3EWQA 4K0CA 4ZY0A 4GUAA 1LAPA 2FG1A 5CBMA 3IIFA 5E3BA 4KSIA 3GQOA 2LGRA 4D86A 3V45A 2RNKA 4GVWA 1TY8A 3EKEA 1LAMA 2VRIA 3KR4A 4J5QA 1GYTA 3SIGA 5CMSA 4X2TA 1LCPA 4ESSA 3GPGA 2EEEA 3GQEA 3KZWA 4R6TA 3IIDA 2FXKA 3Q71A 4ZX9A 2X47A 4JGKA 4IQYA 3H8EA
chains in the Genus database with same CATH topology
1LANA 2BFQA 3EW5A 3KR5A 3Q6ZA 5CB3A 4ETJA 2BFRA 5CB5A 3EJFA 3IJ3A 5HOLA 5FSUA 4ZI6A 3GPOA 4R7MA 3ETIA 2ACFA 3GPQA 4KYBA 1TXZA 4JCAA 2L8RA 3JZTA 4TU0A 2DX6A 1SPVA 4J5RA 4ETKA 3KQXA 4J5SA 4ABKA 3JRUA 3EJGA 3EWRA 3EWOA 1YD9A 4K3NA 4ZYQA 3SIJA 5FSYA 4R76A 3PEIA 2EWBA 4JVVA 5FSZA 3EWPA 1VHUA 4J4ZA 5D8NA 5HIHA 5FSVA 1ZR5A 2J9AA 4ZY1A 3H8FA 1ZR3A 2XD7A 5AILA 3KQZA 3V2BA 4ABLA 3H8GA 3SIHA 2FAVA 1BPMA 1HJZA 1BPNA 5FSXA 1NJRA 4UMLA 4JLLA 1BLLE 3T8WA 5DUSA 3VFQA 3SIIA 4ZY2A 4GVVA 4ZX8A 2AFCA 3EWQA 4K0CA 4ZY0A 4GUAA 1LAPA 2FG1A 5CBMA 3IIFA 5E3BA 4KSIA 3GQOA 2LGRA 4D86A 3V45A 4GVWA 1TY8A 3EKEA 1LAMA 2VRIA 3KR4A 4J5QA 1GYTA 3SIGA 5CMSA 4X2TA 1LCPA 4ESSA 3GPGA 2EEEA 3GQEA 3KZWA 4R6TA 3IIDA 2FXKA 3Q71A 4ZX9A 2X47A 4JGKA 4IQYA 3H8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAN A;  2BFQ A;  3EW5 A;  3KR5 A;  3Q6Z A;  5CB3 A;  4ETJ A;  2BFR A;  5CB5 A;  3EJF A;  3IJ3 A;  5HOL A;  5FSU A;  4ZI6 A;  3GPO A;  4R7M A;  3ETI A;  2ACF A;  3GPQ A;  4KYB A;  1TXZ A;  4JCA A;  2L8R A;  3JZT A;  4TU0 A;  2DX6 A;  1SPV A;  4J5R A;  4ETK A;  3KQX A;  4J5S A;  4ABK A;  3JRU A;  3EJG A;  3EWR A;  3EWO A;  1YD9 A;  4K3N A;  4ZYQ A;  3SIJ A;  5FSY A;  4R76 A;  3PEI A;  2EWB A;  4JVV A;  5FSZ A;  3EWP A;  1VHU A;  4J4Z A;  5D8N A;  5HIH A;  5FSV A;  1ZR5 A;  2J9A A;  4ZY1 A;  3H8F A;  1ZR3 A;  2XD7 A;  5AIL A;  3KQZ A;  3V2B A;  4ABL A;  3H8G A;  3SIH A;  2FAV A;  1BPM A;  1HJZ A;  1BPN A;  5FSX A;  1NJR A;  4UML A;  4JLL A;  1BLL E;  3T8W A;  5DUS A;  3VFQ A;  3SII A;  4ZY2 A;  4GVV A;  4ZX8 A;  2AFC A;  3EWQ A;  4K0C A;  4ZY0 A;  4GUA A;  1LAP A;  2FG1 A;  5CBM A;  3IIF A;  5E3B A;  4KSI A;  3GQO A;  2LGR A;  4D86 A;  3V45 A;  4GVW A;  1TY8 A;  3EKE A;  1LAM A;  2VRI A;  3KR4 A;  4J5Q A;  1GYT A;  3SIG A;  5CMS A;  4X2T A;  1LCP A;  4ESS A;  3GPG A;  2EEE A;  3GQE A;  3KZW A;  4R6T A;  3IID A;  2FXK A;  3Q71 A;  4ZX9 A;  2X47 A;  4JGK A;  4IQY A;  3H8E A; 
#chains in the Genus database with same CATH topology
 1LAN A;  2BFQ A;  3EW5 A;  3KR5 A;  3Q6Z A;  5CB3 A;  4ETJ A;  2BFR A;  5CB5 A;  3EJF A;  3IJ3 A;  5HOL A;  5FSU A;  4ZI6 A;  3GPO A;  4R7M A;  3ETI A;  2ACF A;  3GPQ A;  4KYB A;  1TXZ A;  4JCA A;  2L8R A;  3JZT A;  4TU0 A;  2DX6 A;  1SPV A;  4J5R A;  2JZE A;  3KQX A;  4ETK A;  4J5S A;  4ABK A;  3JRU A;  3EJG A;  3EWR A;  3EWO A;  1YD9 A;  4K3N A;  4ZYQ A;  3SIJ A;  5FSY A;  4R76 A;  3PEI A;  2EWB A;  4JVV A;  5FSZ A;  3EWP A;  1VHU A;  4J4Z A;  5D8N A;  5HIH A;  5FSV A;  1ZR5 A;  2J9A A;  4ZY1 A;  3H8F A;  2WCT A;  1ZR3 A;  2KQV A;  2XD7 A;  5AIL A;  3KQZ A;  3V2B A;  4ABL A;  2JZF A;  3H8G A;  2JZD A;  3SIH A;  2FAV A;  1BPM A;  1HJZ A;  2W2G A;  1BPN A;  5FSX A;  1NJR A;  4UML A;  4JLL A;  1BLL E;  3T8W A;  5DUS A;  3VFQ A;  3SII A;  4ZY2 A;  4GVV A;  4ZX8 A;  2AFC A;  3EWQ A;  4K0C A;  4ZY0 A;  4GUA A;  1LAP A;  2FG1 A;  5CBM A;  3IIF A;  5E3B A;  4KSI A;  3GQO A;  2LGR A;  4D86 A;  3V45 A;  2RNK A;  4GVW A;  1TY8 A;  3EKE A;  1LAM A;  2VRI A;  3KR4 A;  4J5Q A;  1GYT A;  3SIG A;  5CMS A;  4X2T A;  1LCP A;  4ESS A;  3GPG A;  2EEE A;  3GQE A;  3KZW A;  4R6T A;  3IID A;  2FXK A;  3Q71 A;  4ZX9 A;  2X47 A;  4JGK A;  4IQY A;  3H8E A; 
#chains in the Genus database with same CATH homology
 1LAN A;  2BFQ A;  3EW5 A;  3KR5 A;  3Q6Z A;  5CB3 A;  4ETJ A;  2BFR A;  5CB5 A;  3EJF A;  3IJ3 A;  5HOL A;  5FSU A;  4ZI6 A;  3GPO A;  4R7M A;  3ETI A;  2ACF A;  3GPQ A;  4KYB A;  1TXZ A;  4JCA A;  2L8R A;  3JZT A;  4TU0 A;  2DX6 A;  1SPV A;  4J5R A;  4ETK A;  3KQX A;  4J5S A;  4ABK A;  3JRU A;  3EJG A;  3EWR A;  3EWO A;  1YD9 A;  4K3N A;  4ZYQ A;  3SIJ A;  5FSY A;  4R76 A;  3PEI A;  2EWB A;  4JVV A;  5FSZ A;  3EWP A;  1VHU A;  4J4Z A;  5D8N A;  5HIH A;  5FSV A;  1ZR5 A;  2J9A A;  4ZY1 A;  3H8F A;  1ZR3 A;  2XD7 A;  5AIL A;  3KQZ A;  3V2B A;  4ABL A;  3H8G A;  3SIH A;  2FAV A;  1BPM A;  1HJZ A;  1BPN A;  5FSX A;  1NJR A;  4UML A;  4JLL A;  1BLL E;  3T8W A;  5DUS A;  3VFQ A;  3SII A;  4ZY2 A;  4GVV A;  4ZX8 A;  2AFC A;  3EWQ A;  4K0C A;  4ZY0 A;  4GUA A;  1LAP A;  2FG1 A;  5CBM A;  3IIF A;  5E3B A;  4KSI A;  3GQO A;  2LGR A;  4D86 A;  3V45 A;  4GVW A;  1TY8 A;  3EKE A;  1LAM A;  2VRI A;  3KR4 A;  4J5Q A;  1GYT A;  3SIG A;  5CMS A;  4X2T A;  1LCP A;  4ESS A;  3GPG A;  2EEE A;  3GQE A;  3KZW A;  4R6T A;  3IID A;  2FXK A;  3Q71 A;  4ZX9 A;  2X47 A;  4JGK A;  4IQY A;  3H8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...