4ETJA

Crystal structure of e6h variant of de novo designed serine hydrolase osh55, northeast structural genomics consortium (nesg) target or185
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
164
structure length
164
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVLRVMLEEIKKAPDTLEVTGVHGTEKSAEAARRALLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords Serine hydrolase
total genus 61
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2012-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4etjA00
3H8EA 3PEIA 5FSXA 3KR5A 3EWQA 3EW5A 5FSZA 3EJFA 5AILA 3V45A 3EKEA 4ABKA 1YD9A 2J9AA 1TXZA 3JZTA 2FXKA 1LAPA 4R6TA 3GPOA 4J5SA 2AFCA 4KYBA 4ETJA 3ETIA 4J5QA 4IQYA 2XD7A 3GPQA 4JCAA 3SIHA 4ZY2A 4GVVA 2FG1A 2FAVA 2EWBA 3JRUA 4D86A 5D8NA 3KZWA 5CBMA 2EEEA 4KSIA 5HIHA 5FSVA 2LGRA 2BFQA 3V2BA 4J5RA 1LAMA 2X47A 4GVWA 3Q6ZA 1ZR5A 3SIIA 1ZR3A 3EJGA 5HOLA 3EWPA 3SIJA 4R76A 3KR4A 4K0CA 4ABLA 5FSUA 5CB3A 3IIDA 4ZYQA 1TY8A 4J4ZA 1LANA 4ESSA 1SPVA 3GPGA 3T8WA 4ETKA 4K3NA 5FSYA 5CB5A 5E3BA 3GQOA 1GYTA 3H8GA 2DX6A 4JVVA 3H8FA 3IIFA 2L8RA 4R7MA 1BPMA 2ACFA 3SIGA 1VHUA 3IJ3A 4ZX9A 4UMLA 1NJRA 3KQXA 3EWOA 4X2TA 2BFRA 4TU0A 3GQEA 1BPNA 2VRIA 4ZY0A 4JGKA 1HJZA 4GUAA 3KQZA 3EWRA 5DUSA 4ZY1A 1LCPA 1BLLE 5CMSA 3Q71A 4JLLA 4ZX8A 4ZI6A 3VFQA
chains in the Genus database with same CATH superfamily
3H8EA 3PEIA 5FSXA 3KR5A 3EWQA 3EW5A 5FSZA 3EJFA 5AILA 3V45A 3EKEA 4ABKA 1YD9A 2J9AA 1TXZA 3JZTA 2FXKA 1LAPA 4R6TA 3GPOA 4J5SA 2AFCA 4KYBA 4ETJA 3ETIA 4J5QA 4IQYA 2XD7A 2JZEA 3GPQA 4JCAA 3SIHA 4ZY2A 2W2GA 4GVVA 2FG1A 2FAVA 2EWBA 3JRUA 4D86A 5D8NA 3KZWA 5CBMA 2EEEA 4KSIA 5HIHA 5FSVA 2LGRA 2BFQA 3V2BA 4J5RA 1LAMA 2WCTA 2X47A 4GVWA 2JZDA 3Q6ZA 1ZR5A 3SIIA 1ZR3A 3EJGA 5HOLA 3EWPA 3SIJA 4R76A 3KR4A 4K0CA 4ABLA 5FSUA 5CB3A 3IIDA 4ZYQA 1TY8A 4J4ZA 1LANA 4ESSA 1SPVA 3GPGA 3T8WA 4ETKA 4K3NA 5FSYA 5CB5A 5E3BA 3GQOA 1GYTA 3H8GA 2DX6A 4JVVA 3H8FA 3IIFA 2L8RA 4R7MA 1BPMA 2ACFA 3SIGA 1VHUA 3IJ3A 4ZX9A 4UMLA 1NJRA 3KQXA 3EWOA 4X2TA 2BFRA 4TU0A 3GQEA 2RNKA 1BPNA 2VRIA 4ZY0A 4JGKA 1HJZA 4GUAA 2JZFA 3KQZA 3EWRA 2KQVA 5DUSA 4ZY1A 1LCPA 1BLLE 5CMSA 3Q71A 4JLLA 4ZX8A 4ZI6A 3VFQA
chains in the Genus database with same CATH topology
3H8EA 3PEIA 5FSXA 3KR5A 3EWQA 3EW5A 5FSZA 3EJFA 5AILA 3V45A 3EKEA 4ABKA 1YD9A 2J9AA 1TXZA 3JZTA 2FXKA 1LAPA 4R6TA 3GPOA 4J5SA 2AFCA 4KYBA 4ETJA 3ETIA 4J5QA 4IQYA 2XD7A 3GPQA 4JCAA 3SIHA 4ZY2A 4GVVA 2FG1A 2FAVA 2EWBA 3JRUA 4D86A 5D8NA 3KZWA 5CBMA 2EEEA 4KSIA 5HIHA 5FSVA 2LGRA 2BFQA 3V2BA 4J5RA 1LAMA 2X47A 4GVWA 3Q6ZA 1ZR5A 3SIIA 1ZR3A 3EJGA 5HOLA 3EWPA 3SIJA 4R76A 3KR4A 4K0CA 4ABLA 5FSUA 5CB3A 3IIDA 4ZYQA 1TY8A 4J4ZA 1LANA 4ESSA 1SPVA 3GPGA 3T8WA 4ETKA 4K3NA 5FSYA 5CB5A 5E3BA 3GQOA 1GYTA 3H8GA 2DX6A 4JVVA 3H8FA 3IIFA 2L8RA 4R7MA 1BPMA 2ACFA 3SIGA 1VHUA 3IJ3A 4ZX9A 4UMLA 1NJRA 3KQXA 3EWOA 4X2TA 2BFRA 4TU0A 3GQEA 1BPNA 2VRIA 4ZY0A 4JGKA 1HJZA 4GUAA 3KQZA 3EWRA 5DUSA 4ZY1A 1LCPA 1BLLE 5CMSA 3Q71A 4JLLA 4ZX8A 4ZI6A 3VFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8E A;  3PEI A;  5FSX A;  3KR5 A;  3EWQ A;  3EW5 A;  5FSZ A;  3EJF A;  5AIL A;  3V45 A;  3EKE A;  4ABK A;  1YD9 A;  2J9A A;  1TXZ A;  3JZT A;  2FXK A;  1LAP A;  4R6T A;  3GPO A;  4J5S A;  2AFC A;  4KYB A;  4ETJ A;  3ETI A;  4J5Q A;  4IQY A;  2XD7 A;  3GPQ A;  4JCA A;  3SIH A;  4ZY2 A;  4GVV A;  2FG1 A;  2FAV A;  2EWB A;  3JRU A;  4D86 A;  5D8N A;  3KZW A;  5CBM A;  2EEE A;  4KSI A;  5HIH A;  5FSV A;  2LGR A;  2BFQ A;  3V2B A;  4J5R A;  1LAM A;  2X47 A;  4GVW A;  3Q6Z A;  1ZR5 A;  3SII A;  1ZR3 A;  3EJG A;  5HOL A;  3EWP A;  3SIJ A;  4R76 A;  3KR4 A;  4K0C A;  4ABL A;  5FSU A;  5CB3 A;  3IID A;  4ZYQ A;  1TY8 A;  4J4Z A;  1LAN A;  4ESS A;  1SPV A;  3GPG A;  3T8W A;  4ETK A;  4K3N A;  5FSY A;  5CB5 A;  5E3B A;  3GQO A;  1GYT A;  3H8G A;  2DX6 A;  4JVV A;  3H8F A;  3IIF A;  2L8R A;  4R7M A;  1BPM A;  2ACF A;  3SIG A;  1VHU A;  3IJ3 A;  4ZX9 A;  4UML A;  1NJR A;  3KQX A;  3EWO A;  4X2T A;  2BFR A;  4TU0 A;  3GQE A;  1BPN A;  2VRI A;  4ZY0 A;  4JGK A;  1HJZ A;  4GUA A;  3KQZ A;  3EWR A;  5DUS A;  4ZY1 A;  1LCP A;  1BLL E;  5CMS A;  3Q71 A;  4JLL A;  4ZX8 A;  4ZI6 A;  3VFQ A; 
#chains in the Genus database with same CATH topology
 3H8E A;  3PEI A;  5FSX A;  3KR5 A;  3EWQ A;  3EW5 A;  5FSZ A;  3EJF A;  5AIL A;  3V45 A;  3EKE A;  4ABK A;  1YD9 A;  2J9A A;  1TXZ A;  3JZT A;  2FXK A;  1LAP A;  4R6T A;  3GPO A;  4J5S A;  2AFC A;  4KYB A;  4ETJ A;  3ETI A;  4J5Q A;  4IQY A;  2XD7 A;  2JZE A;  3GPQ A;  4JCA A;  3SIH A;  4ZY2 A;  2W2G A;  4GVV A;  2FG1 A;  2FAV A;  2EWB A;  3JRU A;  4D86 A;  5D8N A;  3KZW A;  5CBM A;  2EEE A;  4KSI A;  5HIH A;  5FSV A;  2LGR A;  2BFQ A;  3V2B A;  4J5R A;  1LAM A;  2WCT A;  2X47 A;  4GVW A;  2JZD A;  3Q6Z A;  1ZR5 A;  3SII A;  1ZR3 A;  3EJG A;  5HOL A;  3EWP A;  3SIJ A;  4R76 A;  3KR4 A;  4K0C A;  4ABL A;  5FSU A;  5CB3 A;  3IID A;  4ZYQ A;  1TY8 A;  4J4Z A;  1LAN A;  4ESS A;  1SPV A;  3GPG A;  3T8W A;  4ETK A;  4K3N A;  5FSY A;  5CB5 A;  5E3B A;  3GQO A;  1GYT A;  3H8G A;  2DX6 A;  4JVV A;  3H8F A;  3IIF A;  2L8R A;  4R7M A;  1BPM A;  2ACF A;  3SIG A;  1VHU A;  3IJ3 A;  4ZX9 A;  4UML A;  1NJR A;  3KQX A;  3EWO A;  4X2T A;  2BFR A;  4TU0 A;  3GQE A;  2RNK A;  1BPN A;  2VRI A;  4ZY0 A;  4JGK A;  1HJZ A;  4GUA A;  2JZF A;  3KQZ A;  3EWR A;  2KQV A;  5DUS A;  4ZY1 A;  1LCP A;  1BLL E;  5CMS A;  3Q71 A;  4JLL A;  4ZX8 A;  4ZI6 A;  3VFQ A; 
#chains in the Genus database with same CATH homology
 3H8E A;  3PEI A;  5FSX A;  3KR5 A;  3EWQ A;  3EW5 A;  5FSZ A;  3EJF A;  5AIL A;  3V45 A;  3EKE A;  4ABK A;  1YD9 A;  2J9A A;  1TXZ A;  3JZT A;  2FXK A;  1LAP A;  4R6T A;  3GPO A;  4J5S A;  2AFC A;  4KYB A;  4ETJ A;  3ETI A;  4J5Q A;  4IQY A;  2XD7 A;  3GPQ A;  4JCA A;  3SIH A;  4ZY2 A;  4GVV A;  2FG1 A;  2FAV A;  2EWB A;  3JRU A;  4D86 A;  5D8N A;  3KZW A;  5CBM A;  2EEE A;  4KSI A;  5HIH A;  5FSV A;  2LGR A;  2BFQ A;  3V2B A;  4J5R A;  1LAM A;  2X47 A;  4GVW A;  3Q6Z A;  1ZR5 A;  3SII A;  1ZR3 A;  3EJG A;  5HOL A;  3EWP A;  3SIJ A;  4R76 A;  3KR4 A;  4K0C A;  4ABL A;  5FSU A;  5CB3 A;  3IID A;  4ZYQ A;  1TY8 A;  4J4Z A;  1LAN A;  4ESS A;  1SPV A;  3GPG A;  3T8W A;  4ETK A;  4K3N A;  5FSY A;  5CB5 A;  5E3B A;  3GQO A;  1GYT A;  3H8G A;  2DX6 A;  4JVV A;  3H8F A;  3IIF A;  2L8R A;  4R7M A;  1BPM A;  2ACF A;  3SIG A;  1VHU A;  3IJ3 A;  4ZX9 A;  4UML A;  1NJR A;  3KQX A;  3EWO A;  4X2T A;  2BFR A;  4TU0 A;  3GQE A;  1BPN A;  2VRI A;  4ZY0 A;  4JGK A;  1HJZ A;  4GUA A;  3KQZ A;  3EWR A;  5DUS A;  4ZY1 A;  1LCP A;  1BLL E;  5CMS A;  3Q71 A;  4JLL A;  4ZX8 A;  4ZI6 A;  3VFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...