1LAPA

Molecular structure of leucine aminopeptidase at 2.7-angstroms resolution
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
484
structure length
481
Chain Sequence
TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytosol aminopeptidase
publication title Molecular structure of leucine aminopeptidase at 2.7-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 154
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1990-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lapA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lapA02
4G1PA 3SJGA 3B35A 2EK8A 2CIJA 3SI0A 2Q51A 2ZENA 3N5FA 4O23A 5AILA 5K8OA 2PJ0A 2I3CA 2XEFA 3PB8X 3PRTA 3SIGA 4F9VA 2ZEHA 4ZY1A 2PVWA 3KGQA 4ZX8A 4PPZA 1XFOA 2WZNA 1LCPA 4DJLA 5I4MA 1LAMA 1Z2LA 3PFOA 4DUKA 3LWUA 4JLLA 5HIHA 4A94A 3KR5A 3NH4A 4MCRA 4NGMA 1Y0YA 1AYEA 4FAIA 4ESSA 3BHXA 4PXCA 4MHPA 1VIXA 4MRIA 3BXMA 2AFWA 5CBMA 2PJ2A 3S9NA 3S9LA 4YU9A 2CTBA 3JRUA 3SI2A 3MRUA 4CPAA 3SJXA 1DTDA 2VRIA 4UIBA 5HVGA 3SIHA 1R43A 5JH9A 3VARA 5E3BA 3K2KA 3V2BA 4TU0A 2XEGA 2BO9A 1ZR3A 4NGTA 4ETKA 3FVLA 2QYVA 1XMBA 2RFHA 3NA6A 3SIIA 1UWYA 2EEEA 3S9MA 2DX6A 2PJ6A 3DLJA 2ZEGA 3IIBA 3B7IA 1VHOA 4MMOA 3KZWA 2O4HA 2ZELA 3EJGA 4TNUA 2XEJA 3KR4A 4EWTA 3GQEA 4OC3A 1VHUA 3HLPA 3B2YA 4UIAA 1QMUA 3IC1A 5CB5A 4FWUA 1LFWA 4ABLA 4IQYA 1F2PA 2L8RA 4MHZA 4ZYQA 1AMPA 1HDUA 1ARLA 5JGFA 2AFUA 1BAVA 4NGSA 3D7HA 2ZEPA 5D8NA 1FNOA 2C6GA 5LRGA 4OC5A 1YLOA 3LMSA 2BFQA 4ZI6A 2HB6A 4P4JA 1EE3P 4P4IA 4J5QA 3CT9A 4A37A 5DUSA 3FF3A 3TC8A 1ELMP 3WC7A 3BI1A 2JBJA 2PJBA 3VFQA 4Z65A 2ZEOA 1ZLHA 2WYRA 3WC6A 3IWWA 3EWQA 2PJ4A 4DYOA 3KL9A 4R8FA 1HJZA 2GLFA 1Y7EA 2JBKA 4JZ0A 1LANA 5K8PA 3B3CA 1IGBA 3GLJA 4K0CA 3KASA 4MHYA 3Q6ZA 3Q71A 3PB7X 3KHZA 2ZEMA 3KHXA 3NH8A 3GUXA 3IJ3A 2IMOA 4PXDA 4LQGA 3IIDA 2PJ9A 2XEIA 3PB6X 1KWMA 5LYLA 5LRKA 4X8IA 3EWRA 4AXVA 1LOKA 4FUUA 4A39A 4OC0A 3SI1A 4J4ZA 2PJ7A 3SIJA 3V7ZA 5CMSA 1SPVA 3RZAA 4H2KA 4PXBA 4BD9A 2ZEFA 4OIWA 4A38A 2AFMA 5FSVA 1CBXA 7CPAA 1TF8A 3CDXA 3PBEA 1YW4A 1HDQA 2BFRA 1CG2A 4NFRA 4P44A 4JYWA 3GPQA 2Q43A 1Q7LA 1TF9A 4P4DA 3WABA 4OC2A 5J1QA 1Z5RA 3FMCA 3IEHA 3EWOA 3VH9A 4IK2A 4R76A 4NGQA 5CB3A 2PJ5A 3CPAA 3FECA 2CF4A 2PIZA 2PE3A 3V38A 4B6ZA 2POKA 3ISZA 4P4BA 5CPAA 3D66A 3PBBA 1F57A 2OOTA 4OC1A 2C6CA 1RTQA 2PJ1A 4Q7AA 5D29A 3D67A 2G9DA 1ARMA 1ZG8A 1NJRA 4GVWA 1TKFA 5HXDA 3B3WA 3SJFA 3ETIA 4NJQA 4P4EA 2V8VA 5THWA 2NYQA 1CPXA 2AFCA 2ZEEA 2IQ6A 4GVVA 2GREA 1VGYA 5FSZA 5IB9A 1ELLP 3KQXA 2PJCA 1ZG9A 3B3SA 1TY8A 5ELYA 3FEDA 1ZG7A 4GM5A 3CPXA 4ZY2A 5LYFA 3PB4X 3IO1A 3D7GA 2FXKA 4MHNA 3WT4A 5JM6A 3RAMA 3RBUA 4OIDA 3B3TA 3NFZA 2PVVA 4P45A 8CPAA 2RB7A 1IY7A 4RUHA 3I1UA 2X47A 4J5SA 3D4UA 4TWEA 2PJ8A 4WWVA 2F8HA 2C1CA 2FAVA 3B3VA 1YD9A 2EK9A 3EJFA 1ZLIA 2V8DA 4YWYA 4P6YA 2V8HA 2C6PA 4UEZA 3TX8A 3T8WA 1YMEA 3L2NA 3QNVA 3EW5A 4KYBA 1Y0RA 3H8FA 2DEAA 2ABZA 1CPSA 2PJAA 5F09A 3D68A 3BI0A 1YW6A 1GYTA 4ETJA 4JVVA 2QVPA 2PCUA 2VL1A 5K8NA 1TKJA 3ISXA 4MXUA 3EKEA 1LAPA 3IFEA 5FSXA 5LRJA 3EWPA 6CPAA 3V45A 4FBEA 4F9UA 2ANPA 2XD7A 4KSIA 5HOLA 3MN8A 4EFDA 1FT7A 5DS0A 3FX6A 1ZR5A 4D86A 2LGRA 4MCSA 3K9TA 4X3RA 5K8MA 4K3NA 2CTCA 4WJBA 2AFOA 1BPNA 2QJ8A 4P10A 4GUAA 2O53A 3FH4A 2OR4A 3D7FA 2EWBA 3FEEA 3GPOA 2V77A 3DGVA 2AFXA 3H8EA 4UEEA 2BCOA 3KI9A 1F2OA 2ACFA 2V8GA 3FJUA 2GU2A 3HUVA 3D7DA 4R7MA 2HC9A 5LYIA 3GQOA 1NSAA 4OP4A 4NGPA 1BLLE 4ZY0A 4IAVA 4NJRA 2NSMA 1TXZA 4ABKA 1CX8A 1YSJA 2PIYA 3VATA 4JGKA 4PQAA 1M4LA 4UEFA 2JEWA 4ONWA 1JQGA 2PJ3A 3H8GA 3IIFA 1TXRA 1XRYA 2FVGA 4EMEA 1BPMA 3KQZA 1CP7A 2FG1A 4UMLA 4X2TA 2F7VA 3JZTA 1H8LA 5FSUA 4MCPA 2ZEDA 4OKOA 4PXEA 2AFZA 4OMEA 4J5RA 2IJZA 5FSYA 1CP6A 2BOAA 4IHMA 1PCAA 1R3NA 1XBUA 4F8ZA 2ZOFA 4ZX9A 1TKHA 1HEEA 1DE4C 4OC4A 2AFSA 3WC5A 2GLJA 5LYDA 3PFEA 1VHEA 4UF4A 4JCAA 3PEIA 2PRQA 4NGRA 2Q4ZA 4W9YA 4R6TA 1QQ9A 2ZOGA 1XJOA 3GPGA 5HVHA 1OBRA 4MCQA 4P4FA 3GB0A 1PYTB 5HVFA 4NGNA 3SJEA 3PB9X 1Z8LA 3NH5A 2J9AA
chains in the Genus database with same CATH superfamily
2FIWA 5HMNA 4G1PA 3SJGA 3B35A 2Q04A 2EK8A 4B5PA 4H6ZA 1SQHA 2CIJA 4C7HA 3SI0A 2Q51A 2ZENA 3N5FA 4O23A 5AILA 5K8OA 5J8CA 3OWCA 3D8PA 4JXQA 4KOVA 2PJ0A 2I3CA 1B87A 2XEFA 3PB8X 3PRTA 3SIGA 4F9VA 2I00A 1IU8A 2ZEHA 4CYPA 4ZY1A 2PVWA 3KGQA 1JWQA 3FYNA 4ZX8A 4PPZA 1XFOA 2WZNA 3R9EA 1LCPA 4DJLA 2KCWA 2QECA 5I4MA 2NMTA 4HPSA 1LAMA 1Z2LA 4MFQA 3PFOA 4DUKA 4HNWB 1XE4A 2R7HA 3LWUA 4JLLA 5HIHA 4A94A 3KR5A 1MJAA 1YVKA 3NH4A 4MCRA 1I1DA 4NGMA 2R98A 4KOTA 1Y0YA 2Q7SA 1AYEA 4YRHA 3BJ7A 4ESSA 3BHXA 3JVNA 4PXCA 4FD7A 4FAIA 2ZW7A 4MHPA 4Q36A 1VIXA 4MRIA 1L0CA 2FCKA 2PQ8A 3BXMA 2AFWA 5CBMA 4GS4A 2PJ2A 4JD6A 3S9NA 3S9LA 2ZW6A 4OLLA 3K9UA 3N7ZA 1QSRA 4YU9A 2CTBA 3JRUA 4KSFA 5F47A 3SI2A 3MRUA 4CPAA 3SJXA 1DTDA 3W6SA 1S3ZA 5J8FA 2VRIA 2X7BA 3F8KA 3SIHA 1R43A 2P6FA 3FIXA 2FE7A 4KOSA 4KOWA 4UBRA 5HVGA 3VARA 5E3BA 3EO4A 4BBHA 5JH9A 4A2ZA 3R95A 1WK4A 5JPHA 4NEXA 3DR8A 3K2KA 1Y9KA 3V2BA 4TU0A 2XEGA 4UWIA 2BO9A 2YNCA 3FRMA 1ZR3A 4CAEA 5KTDA 4NGTA 4ETKA 3FVLA 2QYVA 1XMBA 1ZO0A 2RFHA 3NA6A 3SIIA 1UWYA 1X12A 3RNZA 3GIUA 1YX0A 4RS2A 2EEEA 3S9MA 2DX6A 3DR6A 2PJ6A 1R57A 1M4DA 3DLJA 4UFXA 3V8IA 5EMIA 2ZEGA 3IIBA 3B7IA 4XPLA 2Q0YA 1VHOA 3W91A 4MMOA 4U9YA 3KZWA 2O4HA 3FB3A 1CM0A 2ZELA 3EJGA 1TIQA 4TNUA 1QSTA 2XEJA 3KR4A 4ORFA 2WCTA 1V0CA 4EWTA 3GQEA 2F5IA 5IB0A 1A2ZA 4R3KA 4OC3A 1VHUA 2WPWA 3HLPA 4A32A 2G0BA 3B2YA 4UIAA 3TOAA 2REFA 5H84A 1QMUA 3CXPA 4A33A 3IC1A 5CB5A 4FWUA 4MJ8A 1LFWA 4ABLA 2I79A 4IQYA 4HKFA 1F2PA 2K5TA 5IV0A 2B4DA 2L8RA 4MHZA 1QSOA 4ZYQA 1AMPA 1HDUA 1ARLA 3VWDA 4DNCA 5JGFA 2AFUA 2Z3LA 2FIAA 2J8NA 4UFVA 3FXTA 4A30A 1BAVA 4NGSA 2CNTA 3D7HA 2ZEPA 5D8NA 1FNOA 2C6GA 5LRGA 2P6EA 1YLOA 3LMSA 2BFQA 2BUEA 4ZI6A 2HB6A 4OADA 4OC5A 4P4JA 1MJBA 1IIDA 1EE3P 4P4IA 4J5QA 3CT9A 4B10A 1B6BA 4MFPA 4A37A 5KTAA 2GFQA 4BINA 5DUSA 1AUGA 3FF3A 3LACA 1ELMP 3DSBA 3TC8A 3WC7A 2OZGA 1M4IA 1UFHA 3BI1A 4XNHC 3SXNA 2JBJA 2PJBA 3VFQA 4Z65A 3D2MA 2ZEOA 5F49A 2AJ6A 1PU9A 1ZLHA 4U9ZA 2GIVA 3G8WA 2PSWA 2WYRA 3WC6A 3IWWA 2HUZA 4KVME 3EWQA 2PJ4A 3RO0A 4M6IA 3SHPA 4DYOA 4AVCA 4KOXA 3KL9A 4CGOA 4R8FA 3P2FA 4AVBA 4CS0B 2PDOA 1HJZA 2GLFA 2OH1A 3H4QA 1Y7EA 2JBKA 2ATRA 1QSMA 4KS9A 4JZ0A 5AG4A 1XIXA 4UWJA 3G3SA 1J4JA 1LANA 1IOFA 3CXSA 5K8PA 4CYQA 3B3CA 1IGBA 3GLJA 4K0CA 2PR8A 1I12A 3KASA 4MHYA 3TT2A 4AG7A 2DPTA 3Q6ZA 3Q71A 2GE3A 3PB7X 2EBJA 2ZEMA 3KHXA 3KHZA 3NH8A 5AG5A 3TTHA 3GUXA 3IJ3A 1S7KA 5FVJA 2IMOA 2VXKA 4PXDA 4LQGA 3IIDA 4B12A 2PJ9A 3TO7A 2XEIA 3PB6X 4B5PB 4XNHB 2IL4A 1KWMA 3TO6A 5LYLA 5LRKA 4X8IA 1IB1E 3EWRA 1M4GA 2RC4A 3R9GA 4QC6A 5DWNA 5C82A 4AXVA 1LOKA 4FD5A 4FUUA 4A39A 4OC0A 3ZJ0A 2EVNA 5HH1A 3PZJA 3SI1A 4J4ZA 3MGDA 2PJ7A 2RNKA 3SIJA 3V7ZA 5CMSA 1SPVA 2Z10A 3LD2A 3RZAA 4UCMA 2CNSA 2Z3PA 4H2KA 1YGHA 4XPKA 4PXBA 4KOUA 3JUWA 4M85A 4YGOA 3WR7A 2Z3KA 2ZEFA 4BD9A 1Z4RA 2ZW4A 5IX3A 4OIWA 4A38A 4B14A 2WUUA 2AFMA 5FSVA 2FXFA 1CBXA 4C2ZA 5KTCA 5DWMA 7CPAA 3D2PA 3IWEA 4HNYB 1TF8A 1YLEA 1Z9UA 3CDXA 3LODA 3PBEA 1YW4A 1HDQA 1KZFA 2BFRA 1CG2A 1BOBA 4PK3A 4NFRA 2JZFA 4P44A 4JYWA 3S6GA 3GPQA 2Q43A 1Q7LA 1TF9A 4P4DA 2KQVA 3WABA 1YR0A 4OC2A 5J1QA 4B11A 2C27A 1Q2YA 1Z5RA 3FMCA 3IEHA 4KSAA 3H5ZA 3EWOA 1Z8XA 2FS5A 2JDCA 4KUAA 3VH9A 4IK2A 2J8RA 4R76A 2Q4YA 4NGQA 5CB3A 2AE6A 2W2GA 2PJ5A 3CPAA 1NSLA 1IYKA 1IICA 4KLWA 4NCZA 3FECA 2CF4A 1S7NA 2PIZA 2PE3A 3BLNA 3V38A 2POKA 4B6ZA 4LUAA 4Y49C 4I49A 4C2XA 1KUXA 2JEVA 3ISZA 4P4BA 5CPAA 2ODFA 3D66A 3PBBA 4CAXA 1F57A 2B5GA 2OOTA 4E2AA 4FD6A 2VZZA 2C6CA 4OC1A 4XPDC 5H86A 2GANA 1RTQA 4UCPA 1RXTA 3C26A 2PJ1A 1QSNA 2P0WA 4Q7AA 1RO5A 4NSQA 5EC4A 4A95A 5D29A 5I0CA 3UY5A 2JLMA 3D67A 3TO9A 2G9DA 1ON0A 4ONUA 1ARMA 1ZG8A 1NJRA 4UA3A 1S60A 4GVWA 1TKFA 2YNDA 1Q2CA 2D4OA 3B3WA 5HXDA 1N71A 3SJFA 3R96A 3ETIA 4NJQA 4PV6A 2V8VA 4P4EA 5THWA 2NYQA 2QMLA 4KVXA 2ZW5A 4R9MA 3CZXA 1CPXA 2B4BA 2CXAA 4R3LA 3TOBA 2AFCA 2ZEEA 5A28A 3GKRA 2J8MA 1S7LA 2IQ6A 4GVVA 2GREA 4AB7A 1VGYA 2VEZA 5FSZA 5IB9A 1ELLP 4R57A 3KQXA 2PJCA 1ZG9A 3B3SA 5AG6A 3DDDA 3T9YA 2HV2A 2A4NA 1TY8A 2YNEA 5ELYA 4CAFA 3FEDA 4M6HA 4KVOE 1ZG7A 5G20A 4GM5A 3CPXA 4ZY2A 3S6HA 2O28A 5LYFA 4XPDB 3FBUA 1IOIA 3PB4X 1Z8WA 1OZPA 3IO1A 2REEA 3D7GA 4JWPA 2FXKA 1YREA 4MHNA 3WT4A 5JM6A 4PSWA 3RAMA 2ZPAA 2BSWA 3GYAA 1Z8TA 3RBUA 4OIDA 2VZYA 3B3TA 3NFZA 2PVVA 4P45A 8CPAA 2RB7A 2Q4VA 1U6MA 4QBJA 5AG7A 1IY7A 4RUHA 3I1UA 4E8OA 2X47A 4CRZB 4J5SA 4BMHA 3D4UA 4TWEA 2PJ8A 4WWVA 2F8HA 2C1CA 1KUYA 2FAVA 3B3VA 3S6KA 3TFYA 1YD9A 2EK9A 3EJFA 2G3TA 1ZLIA 2V8DA 4YWYA 4P6YA 2V8HA 2BL1A 2C6PA 3I9SA 4UEZA 3TX8A 1YMEA 2JZDA 3T8WA 1S5KA 5BWAB 1M1DA 4C7IA 3BJ8A 3L2NA 3QNVA 2DPSA 3EW5A 4KYBA 1Y0RA 2DF5A 2Y0MA 3IU2A 3H8FA 1P4NA 2DEAA 4MFKA 2ABZA 1CPSA 2PJAA 2VBQA 5F09A 3D68A 3BI0A 1YW6A 1GYTA 1Z4EA 4MFLA 4CGMA 4ETJA 4U5YA 4JVVA 3ZZIA 2QVPA 3DNSA 4ZGYB 5JQ4A 4KLVA 1KUVA 2PCUA 2VL1A 2D4PA 2FL4A 2FSRA 3F0AA 2R1IA 4YFJA 5K8NA 1TKJA 2CNMA 3JTKA 3T90A 1K4JA 3ISXA 4L89A 4MXUA 3EKEA 3EXNA 4CGLA 1LAPA 1M44A 4NF1A 4CAWA 3QB8A 2YNCC 2PC1A 3R9FA 3IFEA 5FSXA 2ZXVA 5LRJA 3EC4A 1BO4A 3R1KA 1IYLA 4H6UA 3EWPA 4K30A 4R87A 3V45A 6CPAA 2HQYA 5A27A 2EUIA 3EY5A 3NE7A 4J3GA 1XF8A 2Z11A 4A31A 4FBEA 3IU1A 2ANPA 2XD7A 1P0HA 4KSIA 1NMTA 2H5MA 4F9UA 3P2HA 5HOLA 4MHDA 3RYOA 3MN8A 5F48A 4OAEA 1FT7A 4EFDA 4II9A 5DS0A 3FX6A 4KOYA 1Y9WA 1ZR5A 3SXOA 2ARHA 4D86A 2LGRA 2Q44A 4F6AA 4MCSA 3K9TA 2OZHA 4X3RA 4B13A 4K3NA 2CTCA 4QB9A 4CGPA 1XEBA 4WJBA 5K8MA 2AFOA 1FY7A 4JLYA 5CNPA 3KKWA 1BPNA 2QJ8A 4P10A 4GUAA 2O53A 4EVYA 3FH4A 2OR4A 3A9LA 3D7FA 2EWBA 2OZUA 3FEEA 5C88A 4H89A 4E0AA 4MY3A 3GPOA 2P6GA 2V77A 3DGVA 2AFXA 4JXRA 3H8EA 4UEEA 4LX9A 1Q2DA 1YQEA 2BCOA 3I3GA 1F2OA 2ACFA 2V8GA 3FJUA 3KI9A 3TCVA 3FNCA 3IGRA 3W6XA 2VQYA 2GU2A 3HUVA 2PR1A 4MFZA 4JJXA 3D7DA 2Z3OA 4IF5A 4M6GA 4R7MA 2HC9A 2WSAA 5LYIA 3GQOA 1S7FA 5G21A 1NSAA 2CY2A 1GHEA 3GY9A 4OP4A 4NGPA 4RI1A 2VI7A 1I21A 1BLLE 5GCNA 3NE8A 4UFWA 4ZY0A 4IAVA 4NJRA 2B5GB 2NSMA 1TXZA 4ABKA 1CX8A 4UIBA 1YSJA 2PIYA 4PSXA 3PP9A 3VATA 4CYOA 5E96A 4JGKA 2OB0A 2JZEA 4KZTA 1MK4A 4PQAA 4HNXB 4MFJA 2Z0ZA 4QVTA 1M4LA 2DXQA 4KUBA 4LQ6A 4NXYA 4UEFA 2JEWA 4ONWA 4CGNA 1JQGA 2OU2A 2PJ3A 3H8GA 3QAHA 4IUSA 4MI4A 3IIFA 1MJ9A 1NE9A 1TXRA 1XRYA 3PGPA 2FVGA 4EMEA 1BPMA 4CAVA 3KQZA 2B3UA 2EO8A 1CP7A 2FG1A 4UMLA 4X2TA 2B4DB 2F7VA 3D3SA 3JZTA 1H8LA 4MBUA 4MY0A 4PK2A 5G1ZA 4Y49B 4B5OA 5FSUA 2Z3MA 4MCPA 2QIRA 4CYNA 2ZEDA 3VWEA 4OKOA 4C2YA 2WPXA 4PXEA 2AFZA 4OMEA 1XOVA 3E0KA 2R8VA 4J5RA 1YK3A 2FT0A 2IJZA 4M3SA 5FSYA 1CP6A 2BOAA 4IHMA 1PCAA 4AG9A 5F46A 5EBVA 1R3NA 2BEIA 4FD4A 1XBUA 4RN7A 4F8ZA 2ZOFA 4KORA 4ZX9A 1TKHA 1HEEA 4UCNA 2JDDA 1DE4C 1VKCA 2B58A 4OC4A 2AFSA 3WC5A 2GLJA 3EFAA 5LYDA 5ISVA 2Z3NA 3PFEA 1VHEA 1PUAA 5AGEA 4UF4A 4F0YA 2G3AA 4JCAA 3S6FA 3PEIA 2PRQA 1CJWA 3B8GA 4NGRA 4C68A 1XMTA 1YVOA 2Q4ZA 4Q38A 3CXQA 4W9YA 4R6TA 1QQ9A 4ZBGA 4F0XA 2ZOGA 1XJOA 4L8AA 2PRBA 3GPGA 3QAYA 4QUSA 1OBRA 1WWZA 5HVHA 3F5BA 4GXHA 4MCQA 2YGWA 4P4FA 1VHSA 3GB0A 1X10A 4X5KA 4CRYB 2Q7BA 1PYTB 5HVFA 4NGNA 3SJEA 4AVAA 3IWGA 1LRZA 3PB9X 1Y7RA 2B3VA 3TE4A 1Z8LA 3NH5A 2J9AA 5G22A
chains in the Genus database with same CATH topology
4G1PA 3SJGA 3B35A 2EK8A 2CIJA 3SI0A 2Q51A 2ZENA 3N5FA 4O23A 5AILA 5K8OA 2PJ0A 2I3CA 2XEFA 3PB8X 3PRTA 3SIGA 4F9VA 2ZEHA 4ZY1A 2PVWA 3KGQA 4ZX8A 4PPZA 1XFOA 2WZNA 1LCPA 4DJLA 5I4MA 1LAMA 1Z2LA 3PFOA 4DUKA 3LWUA 4JLLA 5HIHA 4A94A 3KR5A 3NH4A 4MCRA 4NGMA 1Y0YA 1AYEA 4FAIA 4ESSA 3BHXA 4PXCA 4MHPA 1VIXA 4MRIA 3BXMA 2AFWA 5CBMA 2PJ2A 3S9NA 3S9LA 4YU9A 2CTBA 3JRUA 3SI2A 3MRUA 4CPAA 3SJXA 1DTDA 2VRIA 4UIBA 5HVGA 3SIHA 1R43A 5JH9A 3VARA 5E3BA 3K2KA 3V2BA 4TU0A 2XEGA 2BO9A 1ZR3A 4NGTA 4ETKA 3FVLA 2QYVA 1XMBA 2RFHA 3NA6A 3SIIA 1UWYA 2EEEA 3S9MA 2DX6A 2PJ6A 3DLJA 2ZEGA 3IIBA 3B7IA 1VHOA 4MMOA 3KZWA 2O4HA 2ZELA 3EJGA 4TNUA 2XEJA 3KR4A 4EWTA 3GQEA 4OC3A 1VHUA 3HLPA 3B2YA 4UIAA 1QMUA 3IC1A 5CB5A 4FWUA 1LFWA 4ABLA 4IQYA 1F2PA 2L8RA 4MHZA 4ZYQA 1AMPA 1HDUA 1ARLA 5JGFA 2AFUA 1BAVA 4NGSA 3D7HA 2ZEPA 5D8NA 1FNOA 2C6GA 5LRGA 4OC5A 1YLOA 3LMSA 2BFQA 4ZI6A 2HB6A 4P4JA 1EE3P 4P4IA 4J5QA 3CT9A 4A37A 5DUSA 3FF3A 3TC8A 1ELMP 3WC7A 3BI1A 2JBJA 2PJBA 3VFQA 4Z65A 2ZEOA 1ZLHA 2WYRA 3WC6A 3IWWA 3EWQA 2PJ4A 4DYOA 3KL9A 4R8FA 1HJZA 2GLFA 1Y7EA 2JBKA 4JZ0A 1LANA 5K8PA 3B3CA 1IGBA 3GLJA 4K0CA 3KASA 4MHYA 3Q6ZA 3Q71A 3PB7X 3KHZA 2ZEMA 3KHXA 3NH8A 3GUXA 3IJ3A 2IMOA 4PXDA 4LQGA 3IIDA 2PJ9A 2XEIA 3PB6X 1KWMA 5LYLA 5LRKA 4X8IA 3EWRA 4AXVA 1LOKA 4FUUA 4A39A 4OC0A 3SI1A 4J4ZA 2PJ7A 3SIJA 3V7ZA 5CMSA 1SPVA 3RZAA 4H2KA 4PXBA 4BD9A 2ZEFA 4OIWA 4A38A 2AFMA 5FSVA 1CBXA 7CPAA 1TF8A 3CDXA 3PBEA 1YW4A 1HDQA 2BFRA 1CG2A 4NFRA 4P44A 4JYWA 3GPQA 2Q43A 1Q7LA 1TF9A 4P4DA 3WABA 4OC2A 5J1QA 1Z5RA 3FMCA 3IEHA 3EWOA 3VH9A 4IK2A 4R76A 4NGQA 5CB3A 2PJ5A 3CPAA 3FECA 2CF4A 2PIZA 2PE3A 3V38A 4B6ZA 2POKA 3ISZA 4P4BA 5CPAA 3D66A 3PBBA 1F57A 2OOTA 4OC1A 2C6CA 1RTQA 2PJ1A 4Q7AA 5D29A 3D67A 2G9DA 1ARMA 1ZG8A 1NJRA 4GVWA 1TKFA 5HXDA 3B3WA 3SJFA 3ETIA 4NJQA 4P4EA 2V8VA 5THWA 2NYQA 1CPXA 2AFCA 2ZEEA 2IQ6A 4GVVA 2GREA 1VGYA 5FSZA 5IB9A 1ELLP 3KQXA 2PJCA 1ZG9A 3B3SA 1TY8A 5ELYA 3FEDA 1ZG7A 4GM5A 3CPXA 4ZY2A 5LYFA 3PB4X 3IO1A 3D7GA 2FXKA 4MHNA 3WT4A 5JM6A 3RAMA 3RBUA 4OIDA 3B3TA 3NFZA 2PVVA 4P45A 8CPAA 2RB7A 1IY7A 4RUHA 3I1UA 2X47A 4J5SA 3D4UA 4TWEA 2PJ8A 4WWVA 2F8HA 2C1CA 2FAVA 3B3VA 1YD9A 2EK9A 3EJFA 1ZLIA 2V8DA 4YWYA 4P6YA 2V8HA 2C6PA 4UEZA 3TX8A 3T8WA 1YMEA 3L2NA 3QNVA 3EW5A 4KYBA 1Y0RA 3H8FA 2DEAA 2ABZA 1CPSA 2PJAA 5F09A 3D68A 3BI0A 1YW6A 1GYTA 4ETJA 4JVVA 2QVPA 2PCUA 2VL1A 5K8NA 1TKJA 3ISXA 4MXUA 3EKEA 1LAPA 3IFEA 5FSXA 5LRJA 3EWPA 6CPAA 3V45A 4FBEA 4F9UA 2ANPA 2XD7A 4KSIA 5HOLA 3MN8A 4EFDA 1FT7A 5DS0A 3FX6A 1ZR5A 4D86A 2LGRA 4MCSA 3K9TA 4X3RA 5K8MA 4K3NA 2CTCA 4WJBA 2AFOA 1BPNA 2QJ8A 4P10A 4GUAA 2O53A 3FH4A 2OR4A 3D7FA 2EWBA 3FEEA 3GPOA 2V77A 3DGVA 2AFXA 3H8EA 4UEEA 2BCOA 3KI9A 1F2OA 2ACFA 2V8GA 3FJUA 2GU2A 3HUVA 3D7DA 4R7MA 2HC9A 5LYIA 3GQOA 1NSAA 4OP4A 4NGPA 1BLLE 4ZY0A 4IAVA 4NJRA 2NSMA 1TXZA 4ABKA 1CX8A 1YSJA 2PIYA 3VATA 4JGKA 4PQAA 1M4LA 4UEFA 2JEWA 4ONWA 1JQGA 2PJ3A 3H8GA 3IIFA 1TXRA 1XRYA 2FVGA 4EMEA 1BPMA 3KQZA 1CP7A 2FG1A 4UMLA 4X2TA 2F7VA 3JZTA 1H8LA 5FSUA 4MCPA 2ZEDA 4OKOA 4PXEA 2AFZA 4OMEA 4J5RA 2IJZA 5FSYA 1CP6A 2BOAA 4IHMA 1PCAA 1R3NA 1XBUA 4F8ZA 2ZOFA 4ZX9A 1TKHA 1HEEA 1DE4C 4OC4A 2AFSA 3WC5A 2GLJA 5LYDA 3PFEA 1VHEA 4UF4A 4JCAA 3PEIA 2PRQA 4NGRA 2Q4ZA 4W9YA 4R6TA 1QQ9A 2ZOGA 1XJOA 3GPGA 5HVHA 1OBRA 4MCQA 4P4FA 3GB0A 1PYTB 5HVFA 4NGNA 3SJEA 3PB9X 1Z8LA 3NH5A 2J9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G1P A;  3SJG A;  3B35 A;  2EK8 A;  2CIJ A;  3SI0 A;  2Q51 A;  2ZEN A;  3N5F A;  4O23 A;  5AIL A;  5K8O A;  2PJ0 A;  2I3C A;  2XEF A;  3PB8 X;  3PRT A;  3SIG A;  4F9V A;  2ZEH A;  4ZY1 A;  2PVW A;  3KGQ A;  4ZX8 A;  4PPZ A;  1XFO A;  2WZN A;  1LCP A;  4DJL A;  5I4M A;  1LAM A;  1Z2L A;  3PFO A;  4DUK A;  3LWU A;  4JLL A;  5HIH A;  4A94 A;  3KR5 A;  3NH4 A;  4MCR A;  4NGM A;  1Y0Y A;  1AYE A;  4FAI A;  4ESS A;  3BHX A;  4PXC A;  4MHP A;  1VIX A;  4MRI A;  3BXM A;  2AFW A;  5CBM A;  2PJ2 A;  3S9N A;  3S9L A;  4YU9 A;  2CTB A;  3JRU A;  3SI2 A;  3MRU A;  4CPA A;  3SJX A;  1DTD A;  2VRI A;  4UIB A;  5HVG A;  3SIH A;  1R43 A;  5JH9 A;  3VAR A;  5E3B A;  3K2K A;  3V2B A;  4TU0 A;  2XEG A;  2BO9 A;  1ZR3 A;  4NGT A;  4ETK A;  3FVL A;  2QYV A;  1XMB A;  2RFH A;  3NA6 A;  3SII A;  1UWY A;  2EEE A;  3S9M A;  2DX6 A;  2PJ6 A;  3DLJ A;  2ZEG A;  3IIB A;  3B7I A;  1VHO A;  4MMO A;  3KZW A;  2O4H A;  2ZEL A;  3EJG A;  4TNU A;  2XEJ A;  3KR4 A;  4EWT A;  3GQE A;  4OC3 A;  1VHU A;  3HLP A;  3B2Y A;  4UIA A;  1QMU A;  3IC1 A;  5CB5 A;  4FWU A;  1LFW A;  4ABL A;  4IQY A;  1F2P A;  2L8R A;  4MHZ A;  4ZYQ A;  1AMP A;  1HDU A;  1ARL A;  5JGF A;  2AFU A;  1BAV A;  4NGS A;  3D7H A;  2ZEP A;  5D8N A;  1FNO A;  2C6G A;  5LRG A;  4OC5 A;  1YLO A;  3LMS A;  2BFQ A;  4ZI6 A;  2HB6 A;  4P4J A;  1EE3 P;  4P4I A;  4J5Q A;  3CT9 A;  4A37 A;  5DUS A;  3FF3 A;  3TC8 A;  1ELM P;  3WC7 A;  3BI1 A;  2JBJ A;  2PJB A;  3VFQ A;  4Z65 A;  2ZEO A;  1ZLH A;  2WYR A;  3WC6 A;  3IWW A;  3EWQ A;  2PJ4 A;  4DYO A;  3KL9 A;  4R8F A;  1HJZ A;  2GLF A;  1Y7E A;  2JBK A;  4JZ0 A;  1LAN A;  5K8P A;  3B3C A;  1IGB A;  3GLJ A;  4K0C A;  3KAS A;  4MHY A;  3Q6Z A;  3Q71 A;  3PB7 X;  3KHZ A;  2ZEM A;  3KHX A;  3NH8 A;  3GUX A;  3IJ3 A;  2IMO A;  4PXD A;  4LQG A;  3IID A;  2PJ9 A;  2XEI A;  3PB6 X;  1KWM A;  5LYL A;  5LRK A;  4X8I A;  3EWR A;  4AXV A;  1LOK A;  4FUU A;  4A39 A;  4OC0 A;  3SI1 A;  4J4Z A;  2PJ7 A;  3SIJ A;  3V7Z A;  5CMS A;  1SPV A;  3RZA A;  4H2K A;  4PXB A;  4BD9 A;  2ZEF A;  4OIW A;  4A38 A;  2AFM A;  5FSV A;  1CBX A;  7CPA A;  1TF8 A;  3CDX A;  3PBE A;  1YW4 A;  1HDQ A;  2BFR A;  1CG2 A;  4NFR A;  4P44 A;  4JYW A;  3GPQ A;  2Q43 A;  1Q7L A;  1TF9 A;  4P4D A;  3WAB A;  4OC2 A;  5J1Q A;  1Z5R A;  3FMC A;  3IEH A;  3EWO A;  3VH9 A;  4IK2 A;  4R76 A;  4NGQ A;  5CB3 A;  2PJ5 A;  3CPA A;  3FEC A;  2CF4 A;  2PIZ A;  2PE3 A;  3V38 A;  4B6Z A;  2POK A;  3ISZ A;  4P4B A;  5CPA A;  3D66 A;  3PBB A;  1F57 A;  2OOT A;  4OC1 A;  2C6C A;  1RTQ A;  2PJ1 A;  4Q7A A;  5D29 A;  3D67 A;  2G9D A;  1ARM A;  1ZG8 A;  1NJR A;  4GVW A;  1TKF A;  5HXD A;  3B3W A;  3SJF A;  3ETI A;  4NJQ A;  4P4E A;  2V8V A;  5THW A;  2NYQ A;  1CPX A;  2AFC A;  2ZEE A;  2IQ6 A;  4GVV A;  2GRE A;  1VGY A;  5FSZ A;  5IB9 A;  1ELL P;  3KQX A;  2PJC A;  1ZG9 A;  3B3S A;  1TY8 A;  5ELY A;  3FED A;  1ZG7 A;  4GM5 A;  3CPX A;  4ZY2 A;  5LYF A;  3PB4 X;  3IO1 A;  3D7G A;  2FXK A;  4MHN A;  3WT4 A;  5JM6 A;  3RAM A;  3RBU A;  4OID A;  3B3T A;  3NFZ A;  2PVV A;  4P45 A;  8CPA A;  2RB7 A;  1IY7 A;  4RUH A;  3I1U A;  2X47 A;  4J5S A;  3D4U A;  4TWE A;  2PJ8 A;  4WWV A;  2F8H A;  2C1C A;  2FAV A;  3B3V A;  1YD9 A;  2EK9 A;  3EJF A;  1ZLI A;  2V8D A;  4YWY A;  4P6Y A;  2V8H A;  2C6P A;  4UEZ A;  3TX8 A;  3T8W A;  1YME A;  3L2N A;  3QNV A;  3EW5 A;  4KYB A;  1Y0R A;  3H8F A;  2DEA A;  2ABZ A;  1CPS A;  2PJA A;  5F09 A;  3D68 A;  3BI0 A;  1YW6 A;  1GYT A;  4ETJ A;  4JVV A;  2QVP A;  2PCU A;  2VL1 A;  5K8N A;  1TKJ A;  3ISX A;  4MXU A;  3EKE A;  1LAP A;  3IFE A;  5FSX A;  5LRJ A;  3EWP A;  6CPA A;  3V45 A;  4FBE A;  4F9U A;  2ANP A;  2XD7 A;  4KSI A;  5HOL A;  3MN8 A;  4EFD A;  1FT7 A;  5DS0 A;  3FX6 A;  1ZR5 A;  4D86 A;  2LGR A;  4MCS A;  3K9T A;  4X3R A;  5K8M A;  4K3N A;  2CTC A;  4WJB A;  2AFO A;  1BPN A;  2QJ8 A;  4P10 A;  4GUA A;  2O53 A;  3FH4 A;  2OR4 A;  3D7F A;  2EWB A;  3FEE A;  3GPO A;  2V77 A;  3DGV A;  2AFX A;  3H8E A;  4UEE A;  2BCO A;  3KI9 A;  1F2O A;  2ACF A;  2V8G A;  3FJU A;  2GU2 A;  3HUV A;  3D7D A;  4R7M A;  2HC9 A;  5LYI A;  3GQO A;  1NSA A;  4OP4 A;  4NGP A;  1BLL E;  4ZY0 A;  4IAV A;  4NJR A;  2NSM A;  1TXZ A;  4ABK A;  1CX8 A;  1YSJ A;  2PIY A;  3VAT A;  4JGK A;  4PQA A;  1M4L A;  4UEF A;  2JEW A;  4ONW A;  1JQG A;  2PJ3 A;  3H8G A;  3IIF A;  1TXR A;  1XRY A;  2FVG A;  4EME A;  1BPM A;  3KQZ A;  1CP7 A;  2FG1 A;  4UML A;  4X2T A;  2F7V A;  3JZT A;  1H8L A;  5FSU A;  4MCP A;  2ZED A;  4OKO A;  4PXE A;  2AFZ A;  4OME A;  4J5R A;  2IJZ A;  5FSY A;  1CP6 A;  2BOA A;  4IHM A;  1PCA A;  1R3N A;  1XBU A;  4F8Z A;  2ZOF A;  4ZX9 A;  1TKH A;  1HEE A;  1DE4 C;  4OC4 A;  2AFS A;  3WC5 A;  2GLJ A;  5LYD A;  3PFE A;  1VHE A;  4UF4 A;  4JCA A;  3PEI A;  2PRQ A;  4NGR A;  2Q4Z A;  4W9Y A;  4R6T A;  1QQ9 A;  2ZOG A;  1XJO A;  3GPG A;  5HVH A;  1OBR A;  4MCQ A;  4P4F A;  3GB0 A;  1PYT B;  5HVF A;  4NGN A;  3SJE A;  3PB9 X;  1Z8L A;  3NH5 A;  2J9A A; 
#chains in the Genus database with same CATH topology
 2FIW A;  5HMN A;  4G1P A;  3SJG A;  3B35 A;  2Q04 A;  2EK8 A;  4B5P A;  4H6Z A;  1SQH A;  2CIJ A;  4C7H A;  3SI0 A;  2Q51 A;  2ZEN A;  3N5F A;  4O23 A;  5AIL A;  5K8O A;  5J8C A;  3OWC A;  3D8P A;  4JXQ A;  4KOV A;  2PJ0 A;  2I3C A;  1B87 A;  2XEF A;  3PB8 X;  3PRT A;  3SIG A;  4F9V A;  2I00 A;  1IU8 A;  2ZEH A;  4CYP A;  4ZY1 A;  2PVW A;  3KGQ A;  1JWQ A;  3FYN A;  4ZX8 A;  4PPZ A;  1XFO A;  2WZN A;  3R9E A;  1LCP A;  4DJL A;  2KCW A;  2QEC A;  5I4M A;  2NMT A;  4HPS A;  1LAM A;  1Z2L A;  4MFQ A;  3PFO A;  4DUK A;  4HNW B;  1XE4 A;  2R7H A;  3LWU A;  4JLL A;  5HIH A;  4A94 A;  3KR5 A;  1MJA A;  1YVK A;  3NH4 A;  4MCR A;  1I1D A;  4NGM A;  2R98 A;  4KOT A;  1Y0Y A;  2Q7S A;  1AYE A;  4YRH A;  3BJ7 A;  4ESS A;  3BHX A;  3JVN A;  4PXC A;  4FD7 A;  4FAI A;  2ZW7 A;  4MHP A;  4Q36 A;  1VIX A;  4MRI A;  1L0C A;  2FCK A;  2PQ8 A;  3BXM A;  2AFW A;  5CBM A;  4GS4 A;  2PJ2 A;  4JD6 A;  3S9N A;  3S9L A;  2ZW6 A;  4OLL A;  3K9U A;  3N7Z A;  1QSR A;  4YU9 A;  2CTB A;  3JRU A;  4KSF A;  5F47 A;  3SI2 A;  3MRU A;  4CPA A;  3SJX A;  1DTD A;  3W6S A;  1S3Z A;  5J8F A;  2VRI A;  2X7B A;  3F8K A;  3SIH A;  1R43 A;  2P6F A;  3FIX A;  2FE7 A;  4KOS A;  4KOW A;  4UBR A;  5HVG A;  3VAR A;  5E3B A;  3EO4 A;  4BBH A;  5JH9 A;  4A2Z A;  3R95 A;  1WK4 A;  5JPH A;  4NEX A;  3DR8 A;  3K2K A;  1Y9K A;  3V2B A;  4TU0 A;  2XEG A;  4UWI A;  2BO9 A;  2YNC A;  3FRM A;  1ZR3 A;  4CAE A;  5KTD A;  4NGT A;  4ETK A;  3FVL A;  2QYV A;  1XMB A;  1ZO0 A;  2RFH A;  3NA6 A;  3SII A;  1UWY A;  1X12 A;  3RNZ A;  3GIU A;  1YX0 A;  4RS2 A;  2EEE A;  3S9M A;  2DX6 A;  3DR6 A;  2PJ6 A;  1R57 A;  1M4D A;  3DLJ A;  4UFX A;  3V8I A;  5EMI A;  2ZEG A;  3IIB A;  3B7I A;  4XPL A;  2Q0Y A;  1VHO A;  3W91 A;  4MMO A;  4U9Y A;  3KZW A;  2O4H A;  3FB3 A;  1CM0 A;  2ZEL A;  3EJG A;  1TIQ A;  4TNU A;  1QST A;  2XEJ A;  3KR4 A;  4ORF A;  2WCT A;  1V0C A;  4EWT A;  3GQE A;  2F5I A;  5IB0 A;  1A2Z A;  4R3K A;  4OC3 A;  1VHU A;  2WPW A;  3HLP A;  4A32 A;  2G0B A;  3B2Y A;  4UIA A;  3TOA A;  2REF A;  5H84 A;  1QMU A;  3CXP A;  4A33 A;  3IC1 A;  5CB5 A;  4FWU A;  4MJ8 A;  1LFW A;  4ABL A;  2I79 A;  4IQY A;  4HKF A;  1F2P A;  2K5T A;  5IV0 A;  2B4D A;  2L8R A;  4MHZ A;  1QSO A;  4ZYQ A;  1AMP A;  1HDU A;  1ARL A;  3VWD A;  4DNC A;  5JGF A;  2AFU A;  2Z3L A;  2FIA A;  2J8N A;  4UFV A;  3FXT A;  4A30 A;  1BAV A;  4NGS A;  2CNT A;  3D7H A;  2ZEP A;  5D8N A;  1FNO A;  2C6G A;  5LRG A;  2P6E A;  1YLO A;  3LMS A;  2BFQ A;  2BUE A;  4ZI6 A;  2HB6 A;  4OAD A;  4OC5 A;  4P4J A;  1MJB A;  1IID A;  1EE3 P;  4P4I A;  4J5Q A;  3CT9 A;  4B10 A;  1B6B A;  4MFP A;  4A37 A;  5KTA A;  2GFQ A;  4BIN A;  5DUS A;  1AUG A;  3FF3 A;  3LAC A;  1ELM P;  3DSB A;  3TC8 A;  3WC7 A;  2OZG A;  1M4I A;  1UFH A;  3BI1 A;  4XNH C;  3SXN A;  2JBJ A;  2PJB A;  3VFQ A;  4Z65 A;  3D2M A;  2ZEO A;  5F49 A;  2AJ6 A;  1PU9 A;  1ZLH A;  4U9Z A;  2GIV A;  3G8W A;  2PSW A;  2WYR A;  3WC6 A;  3IWW A;  2HUZ A;  4KVM E;  3EWQ A;  2PJ4 A;  3RO0 A;  4M6I A;  3SHP A;  4DYO A;  4AVC A;  4KOX A;  3KL9 A;  4CGO A;  4R8F A;  3P2F A;  4AVB A;  4CS0 B;  2PDO A;  1HJZ A;  2GLF A;  2OH1 A;  3H4Q A;  1Y7E A;  2JBK A;  2ATR A;  1QSM A;  4KS9 A;  4JZ0 A;  5AG4 A;  1XIX A;  4UWJ A;  3G3S A;  1J4J A;  1LAN A;  1IOF A;  3CXS A;  5K8P A;  4CYQ A;  3B3C A;  1IGB A;  3GLJ A;  4K0C A;  2PR8 A;  1I12 A;  3KAS A;  4MHY A;  3TT2 A;  4AG7 A;  2DPT A;  3Q6Z A;  3Q71 A;  2GE3 A;  3PB7 X;  2EBJ A;  2ZEM A;  3KHX A;  3KHZ A;  3NH8 A;  5AG5 A;  3TTH A;  3GUX A;  3IJ3 A;  1S7K A;  5FVJ A;  2IMO A;  2VXK A;  4PXD A;  4LQG A;  3IID A;  4B12 A;  2PJ9 A;  3TO7 A;  2XEI A;  3PB6 X;  4B5P B;  4XNH B;  2IL4 A;  1KWM A;  3TO6 A;  5LYL A;  5LRK A;  4X8I A;  1IB1 E;  3EWR A;  1M4G A;  2RC4 A;  3R9G A;  4QC6 A;  5DWN A;  5C82 A;  4AXV A;  1LOK A;  4FD5 A;  4FUU A;  4A39 A;  4OC0 A;  3ZJ0 A;  2EVN A;  5HH1 A;  3PZJ A;  3SI1 A;  4J4Z A;  3MGD A;  2PJ7 A;  2RNK A;  3SIJ A;  3V7Z A;  5CMS A;  1SPV A;  2Z10 A;  3LD2 A;  3RZA A;  4UCM A;  2CNS A;  2Z3P A;  4H2K A;  1YGH A;  4XPK A;  4PXB A;  4KOU A;  3JUW A;  4M85 A;  4YGO A;  3WR7 A;  2Z3K A;  2ZEF A;  4BD9 A;  1Z4R A;  2ZW4 A;  5IX3 A;  4OIW A;  4A38 A;  4B14 A;  2WUU A;  2AFM A;  5FSV A;  2FXF A;  1CBX A;  4C2Z A;  5KTC A;  5DWM A;  7CPA A;  3D2P A;  3IWE A;  4HNY B;  1TF8 A;  1YLE A;  1Z9U A;  3CDX A;  3LOD A;  3PBE A;  1YW4 A;  1HDQ A;  1KZF A;  2BFR A;  1CG2 A;  1BOB A;  4PK3 A;  4NFR A;  2JZF A;  4P44 A;  4JYW A;  3S6G A;  3GPQ A;  2Q43 A;  1Q7L A;  1TF9 A;  4P4D A;  2KQV A;  3WAB A;  1YR0 A;  4OC2 A;  5J1Q A;  4B11 A;  2C27 A;  1Q2Y A;  1Z5R A;  3FMC A;  3IEH A;  4KSA A;  3H5Z A;  3EWO A;  1Z8X A;  2FS5 A;  2JDC A;  4KUA A;  3VH9 A;  4IK2 A;  2J8R A;  4R76 A;  2Q4Y A;  4NGQ A;  5CB3 A;  2AE6 A;  2W2G A;  2PJ5 A;  3CPA A;  1NSL A;  1IYK A;  1IIC A;  4KLW A;  4NCZ A;  3FEC A;  2CF4 A;  1S7N A;  2PIZ A;  2PE3 A;  3BLN A;  3V38 A;  2POK A;  4B6Z A;  4LUA A;  4Y49 C;  4I49 A;  4C2X A;  1KUX A;  2JEV A;  3ISZ A;  4P4B A;  5CPA A;  2ODF A;  3D66 A;  3PBB A;  4CAX A;  1F57 A;  2B5G A;  2OOT A;  4E2A A;  4FD6 A;  2VZZ A;  2C6C A;  4OC1 A;  4XPD C;  5H86 A;  2GAN A;  1RTQ A;  4UCP A;  1RXT A;  3C26 A;  2PJ1 A;  1QSN A;  2P0W A;  4Q7A A;  1RO5 A;  4NSQ A;  5EC4 A;  4A95 A;  5D29 A;  5I0C A;  3UY5 A;  2JLM A;  3D67 A;  3TO9 A;  2G9D A;  1ON0 A;  4ONU A;  1ARM A;  1ZG8 A;  1NJR A;  4UA3 A;  1S60 A;  4GVW A;  1TKF A;  2YND A;  1Q2C A;  2D4O A;  3B3W A;  5HXD A;  1N71 A;  3SJF A;  3R96 A;  3ETI A;  4NJQ A;  4PV6 A;  2V8V A;  4P4E A;  5THW A;  2NYQ A;  2QML A;  4KVX A;  2ZW5 A;  4R9M A;  3CZX A;  1CPX A;  2B4B A;  2CXA A;  4R3L A;  3TOB A;  2AFC A;  2ZEE A;  5A28 A;  3GKR A;  2J8M A;  1S7L A;  2IQ6 A;  4GVV A;  2GRE A;  4AB7 A;  1VGY A;  2VEZ A;  5FSZ A;  5IB9 A;  1ELL P;  4R57 A;  3KQX A;  2PJC A;  1ZG9 A;  3B3S A;  5AG6 A;  3DDD A;  3T9Y A;  2HV2 A;  2A4N A;  1TY8 A;  2YNE A;  5ELY A;  4CAF A;  3FED A;  4M6H A;  4KVO E;  1ZG7 A;  5G20 A;  4GM5 A;  3CPX A;  4ZY2 A;  3S6H A;  2O28 A;  5LYF A;  4XPD B;  3FBU A;  1IOI A;  3PB4 X;  1Z8W A;  1OZP A;  3IO1 A;  2REE A;  3D7G A;  4JWP A;  2FXK A;  1YRE A;  4MHN A;  3WT4 A;  5JM6 A;  4PSW A;  3RAM A;  2ZPA A;  2BSW A;  3GYA A;  1Z8T A;  3RBU A;  4OID A;  2VZY A;  3B3T A;  3NFZ A;  2PVV A;  4P45 A;  8CPA A;  2RB7 A;  2Q4V A;  1U6M A;  4QBJ A;  5AG7 A;  1IY7 A;  4RUH A;  3I1U A;  4E8O A;  2X47 A;  4CRZ B;  4J5S A;  4BMH A;  3D4U A;  4TWE A;  2PJ8 A;  4WWV A;  2F8H A;  2C1C A;  1KUY A;  2FAV A;  3B3V A;  3S6K A;  3TFY A;  1YD9 A;  2EK9 A;  3EJF A;  2G3T A;  1ZLI A;  2V8D A;  4YWY A;  4P6Y A;  2V8H A;  2BL1 A;  2C6P A;  3I9S A;  4UEZ A;  3TX8 A;  1YME A;  2JZD A;  3T8W A;  1S5K A;  5BWA B;  1M1D A;  4C7I A;  3BJ8 A;  3L2N A;  3QNV A;  2DPS A;  3EW5 A;  4KYB A;  1Y0R A;  2DF5 A;  2Y0M A;  3IU2 A;  3H8F A;  1P4N A;  2DEA A;  4MFK A;  2ABZ A;  1CPS A;  2PJA A;  2VBQ A;  5F09 A;  3D68 A;  3BI0 A;  1YW6 A;  1GYT A;  1Z4E A;  4MFL A;  4CGM A;  4ETJ A;  4U5Y A;  4JVV A;  3ZZI A;  2QVP A;  3DNS A;  4ZGY B;  5JQ4 A;  4KLV A;  1KUV A;  2PCU A;  2VL1 A;  2D4P A;  2FL4 A;  2FSR A;  3F0A A;  2R1I A;  4YFJ A;  5K8N A;  1TKJ A;  2CNM A;  3JTK A;  3T90 A;  1K4J A;  3ISX A;  4L89 A;  4MXU A;  3EKE A;  3EXN A;  4CGL A;  1LAP A;  1M44 A;  4NF1 A;  4CAW A;  3QB8 A;  2YNC C;  2PC1 A;  3R9F A;  3IFE A;  5FSX A;  2ZXV A;  5LRJ A;  3EC4 A;  1BO4 A;  3R1K A;  1IYL A;  4H6U A;  3EWP A;  4K30 A;  4R87 A;  3V45 A;  6CPA A;  2HQY A;  5A27 A;  2EUI A;  3EY5 A;  3NE7 A;  4J3G A;  1XF8 A;  2Z11 A;  4A31 A;  4FBE A;  3IU1 A;  2ANP A;  2XD7 A;  1P0H A;  4KSI A;  1NMT A;  2H5M A;  4F9U A;  3P2H A;  5HOL A;  4MHD A;  3RYO A;  3MN8 A;  5F48 A;  4OAE A;  1FT7 A;  4EFD A;  4II9 A;  5DS0 A;  3FX6 A;  4KOY A;  1Y9W A;  1ZR5 A;  3SXO A;  2ARH A;  4D86 A;  2LGR A;  2Q44 A;  4F6A A;  4MCS A;  3K9T A;  2OZH A;  4X3R A;  4B13 A;  4K3N A;  2CTC A;  4QB9 A;  4CGP A;  1XEB A;  4WJB A;  5K8M A;  2AFO A;  1FY7 A;  4JLY A;  5CNP A;  3KKW A;  1BPN A;  2QJ8 A;  4P10 A;  4GUA A;  2O53 A;  4EVY A;  3FH4 A;  2OR4 A;  3A9L A;  3D7F A;  2EWB A;  2OZU A;  3FEE A;  5C88 A;  4H89 A;  4E0A A;  4MY3 A;  3GPO A;  2P6G A;  2V77 A;  3DGV A;  2AFX A;  4JXR A;  3H8E A;  4UEE A;  4LX9 A;  1Q2D A;  1YQE A;  2BCO A;  3I3G A;  1F2O A;  2ACF A;  2V8G A;  3FJU A;  3KI9 A;  3TCV A;  3FNC A;  3IGR A;  3W6X A;  2VQY A;  2GU2 A;  3HUV A;  2PR1 A;  4MFZ A;  4JJX A;  3D7D A;  2Z3O A;  4IF5 A;  4M6G A;  4R7M A;  2HC9 A;  2WSA A;  5LYI A;  3GQO A;  1S7F A;  5G21 A;  1NSA A;  2CY2 A;  1GHE A;  3GY9 A;  4OP4 A;  4NGP A;  4RI1 A;  2VI7 A;  1I21 A;  1BLL E;  5GCN A;  3NE8 A;  4UFW A;  4ZY0 A;  4IAV A;  4NJR A;  2B5G B;  2NSM A;  1TXZ A;  4ABK A;  1CX8 A;  4UIB A;  1YSJ A;  2PIY A;  4PSX A;  3PP9 A;  3VAT A;  4CYO A;  5E96 A;  4JGK A;  2OB0 A;  2JZE A;  4KZT A;  1MK4 A;  4PQA A;  4HNX B;  4MFJ A;  2Z0Z A;  4QVT A;  1M4L A;  2DXQ A;  4KUB A;  4LQ6 A;  4NXY A;  4UEF A;  2JEW A;  4ONW A;  4CGN A;  1JQG A;  2OU2 A;  2PJ3 A;  3H8G A;  3QAH A;  4IUS A;  4MI4 A;  3IIF A;  1MJ9 A;  1NE9 A;  1TXR A;  1XRY A;  3PGP A;  2FVG A;  4EME A;  1BPM A;  4CAV A;  3KQZ A;  2B3U A;  2EO8 A;  1CP7 A;  2FG1 A;  4UML A;  4X2T A;  2B4D B;  2F7V A;  3D3S A;  3JZT A;  1H8L A;  4MBU A;  4MY0 A;  4PK2 A;  5G1Z A;  4Y49 B;  4B5O A;  5FSU A;  2Z3M A;  4MCP A;  2QIR A;  4CYN A;  2ZED A;  3VWE A;  4OKO A;  4C2Y A;  2WPX A;  4PXE A;  2AFZ A;  4OME A;  1XOV A;  3E0K A;  2R8V A;  4J5R A;  1YK3 A;  2FT0 A;  2IJZ A;  4M3S A;  5FSY A;  1CP6 A;  2BOA A;  4IHM A;  1PCA A;  4AG9 A;  5F46 A;  5EBV A;  1R3N A;  2BEI A;  4FD4 A;  1XBU A;  4RN7 A;  4F8Z A;  2ZOF A;  4KOR A;  4ZX9 A;  1TKH A;  1HEE A;  4UCN A;  2JDD A;  1DE4 C;  1VKC A;  2B58 A;  4OC4 A;  2AFS A;  3WC5 A;  2GLJ A;  3EFA A;  5LYD A;  5ISV A;  2Z3N A;  3PFE A;  1VHE A;  1PUA A;  5AGE A;  4UF4 A;  4F0Y A;  2G3A A;  4JCA A;  3S6F A;  3PEI A;  2PRQ A;  1CJW A;  3B8G A;  4NGR A;  4C68 A;  1XMT A;  1YVO A;  2Q4Z A;  4Q38 A;  3CXQ A;  4W9Y A;  4R6T A;  1QQ9 A;  4ZBG A;  4F0X A;  2ZOG A;  1XJO A;  4L8A A;  2PRB A;  3GPG A;  3QAY A;  4QUS A;  1OBR A;  1WWZ A;  5HVH A;  3F5B A;  4GXH A;  4MCQ A;  2YGW A;  4P4F A;  1VHS A;  3GB0 A;  1X10 A;  4X5K A;  4CRY B;  2Q7B A;  1PYT B;  5HVF A;  4NGN A;  3SJE A;  4AVA A;  3IWG A;  1LRZ A;  3PB9 X;  1Y7R A;  2B3V A;  3TE4 A;  1Z8L A;  3NH5 A;  2J9A A;  5G22 A; 
#chains in the Genus database with same CATH homology
 4G1P A;  3SJG A;  3B35 A;  2EK8 A;  2CIJ A;  3SI0 A;  2Q51 A;  2ZEN A;  3N5F A;  4O23 A;  5AIL A;  5K8O A;  2PJ0 A;  2I3C A;  2XEF A;  3PB8 X;  3PRT A;  3SIG A;  4F9V A;  2ZEH A;  4ZY1 A;  2PVW A;  3KGQ A;  4ZX8 A;  4PPZ A;  1XFO A;  2WZN A;  1LCP A;  4DJL A;  5I4M A;  1LAM A;  1Z2L A;  3PFO A;  4DUK A;  3LWU A;  4JLL A;  5HIH A;  4A94 A;  3KR5 A;  3NH4 A;  4MCR A;  4NGM A;  1Y0Y A;  1AYE A;  4FAI A;  4ESS A;  3BHX A;  4PXC A;  4MHP A;  1VIX A;  4MRI A;  3BXM A;  2AFW A;  5CBM A;  2PJ2 A;  3S9N A;  3S9L A;  4YU9 A;  2CTB A;  3JRU A;  3SI2 A;  3MRU A;  4CPA A;  3SJX A;  1DTD A;  2VRI A;  4UIB A;  5HVG A;  3SIH A;  1R43 A;  5JH9 A;  3VAR A;  5E3B A;  3K2K A;  3V2B A;  4TU0 A;  2XEG A;  2BO9 A;  1ZR3 A;  4NGT A;  4ETK A;  3FVL A;  2QYV A;  1XMB A;  2RFH A;  3NA6 A;  3SII A;  1UWY A;  2EEE A;  3S9M A;  2DX6 A;  2PJ6 A;  3DLJ A;  2ZEG A;  3IIB A;  3B7I A;  1VHO A;  4MMO A;  3KZW A;  2O4H A;  2ZEL A;  3EJG A;  4TNU A;  2XEJ A;  3KR4 A;  4EWT A;  3GQE A;  4OC3 A;  1VHU A;  3HLP A;  3B2Y A;  4UIA A;  1QMU A;  3IC1 A;  5CB5 A;  4FWU A;  1LFW A;  4ABL A;  4IQY A;  1F2P A;  2L8R A;  4MHZ A;  4ZYQ A;  1AMP A;  1HDU A;  1ARL A;  5JGF A;  2AFU A;  1BAV A;  4NGS A;  3D7H A;  2ZEP A;  5D8N A;  1FNO A;  2C6G A;  5LRG A;  4OC5 A;  1YLO A;  3LMS A;  2BFQ A;  4ZI6 A;  2HB6 A;  4P4J A;  1EE3 P;  4P4I A;  4J5Q A;  3CT9 A;  4A37 A;  5DUS A;  3FF3 A;  3TC8 A;  1ELM P;  3WC7 A;  3BI1 A;  2JBJ A;  2PJB A;  3VFQ A;  4Z65 A;  2ZEO A;  1ZLH A;  2WYR A;  3WC6 A;  3IWW A;  3EWQ A;  2PJ4 A;  4DYO A;  3KL9 A;  4R8F A;  1HJZ A;  2GLF A;  1Y7E A;  2JBK A;  4JZ0 A;  1LAN A;  5K8P A;  3B3C A;  1IGB A;  3GLJ A;  4K0C A;  3KAS A;  4MHY A;  3Q6Z A;  3Q71 A;  3PB7 X;  3KHZ A;  2ZEM A;  3KHX A;  3NH8 A;  3GUX A;  3IJ3 A;  2IMO A;  4PXD A;  4LQG A;  3IID A;  2PJ9 A;  2XEI A;  3PB6 X;  1KWM A;  5LYL A;  5LRK A;  4X8I A;  3EWR A;  4AXV A;  1LOK A;  4FUU A;  4A39 A;  4OC0 A;  3SI1 A;  4J4Z A;  2PJ7 A;  3SIJ A;  3V7Z A;  5CMS A;  1SPV A;  3RZA A;  4H2K A;  4PXB A;  4BD9 A;  2ZEF A;  4OIW A;  4A38 A;  2AFM A;  5FSV A;  1CBX A;  7CPA A;  1TF8 A;  3CDX A;  3PBE A;  1YW4 A;  1HDQ A;  2BFR A;  1CG2 A;  4NFR A;  4P44 A;  4JYW A;  3GPQ A;  2Q43 A;  1Q7L A;  1TF9 A;  4P4D A;  3WAB A;  4OC2 A;  5J1Q A;  1Z5R A;  3FMC A;  3IEH A;  3EWO A;  3VH9 A;  4IK2 A;  4R76 A;  4NGQ A;  5CB3 A;  2PJ5 A;  3CPA A;  3FEC A;  2CF4 A;  2PIZ A;  2PE3 A;  3V38 A;  4B6Z A;  2POK A;  3ISZ A;  4P4B A;  5CPA A;  3D66 A;  3PBB A;  1F57 A;  2OOT A;  4OC1 A;  2C6C A;  1RTQ A;  2PJ1 A;  4Q7A A;  5D29 A;  3D67 A;  2G9D A;  1ARM A;  1ZG8 A;  1NJR A;  4GVW A;  1TKF A;  5HXD A;  3B3W A;  3SJF A;  3ETI A;  4NJQ A;  4P4E A;  2V8V A;  5THW A;  2NYQ A;  1CPX A;  2AFC A;  2ZEE A;  2IQ6 A;  4GVV A;  2GRE A;  1VGY A;  5FSZ A;  5IB9 A;  1ELL P;  3KQX A;  2PJC A;  1ZG9 A;  3B3S A;  1TY8 A;  5ELY A;  3FED A;  1ZG7 A;  4GM5 A;  3CPX A;  4ZY2 A;  5LYF A;  3PB4 X;  3IO1 A;  3D7G A;  2FXK A;  4MHN A;  3WT4 A;  5JM6 A;  3RAM A;  3RBU A;  4OID A;  3B3T A;  3NFZ A;  2PVV A;  4P45 A;  8CPA A;  2RB7 A;  1IY7 A;  4RUH A;  3I1U A;  2X47 A;  4J5S A;  3D4U A;  4TWE A;  2PJ8 A;  4WWV A;  2F8H A;  2C1C A;  2FAV A;  3B3V A;  1YD9 A;  2EK9 A;  3EJF A;  1ZLI A;  2V8D A;  4YWY A;  4P6Y A;  2V8H A;  2C6P A;  4UEZ A;  3TX8 A;  3T8W A;  1YME A;  3L2N A;  3QNV A;  3EW5 A;  4KYB A;  1Y0R A;  3H8F A;  2DEA A;  2ABZ A;  1CPS A;  2PJA A;  5F09 A;  3D68 A;  3BI0 A;  1YW6 A;  1GYT A;  4ETJ A;  4JVV A;  2QVP A;  2PCU A;  2VL1 A;  5K8N A;  1TKJ A;  3ISX A;  4MXU A;  3EKE A;  1LAP A;  3IFE A;  5FSX A;  5LRJ A;  3EWP A;  6CPA A;  3V45 A;  4FBE A;  4F9U A;  2ANP A;  2XD7 A;  4KSI A;  5HOL A;  3MN8 A;  4EFD A;  1FT7 A;  5DS0 A;  3FX6 A;  1ZR5 A;  4D86 A;  2LGR A;  4MCS A;  3K9T A;  4X3R A;  5K8M A;  4K3N A;  2CTC A;  4WJB A;  2AFO A;  1BPN A;  2QJ8 A;  4P10 A;  4GUA A;  2O53 A;  3FH4 A;  2OR4 A;  3D7F A;  2EWB A;  3FEE A;  3GPO A;  2V77 A;  3DGV A;  2AFX A;  3H8E A;  4UEE A;  2BCO A;  3KI9 A;  1F2O A;  2ACF A;  2V8G A;  3FJU A;  2GU2 A;  3HUV A;  3D7D A;  4R7M A;  2HC9 A;  5LYI A;  3GQO A;  1NSA A;  4OP4 A;  4NGP A;  1BLL E;  4ZY0 A;  4IAV A;  4NJR A;  2NSM A;  1TXZ A;  4ABK A;  1CX8 A;  1YSJ A;  2PIY A;  3VAT A;  4JGK A;  4PQA A;  1M4L A;  4UEF A;  2JEW A;  4ONW A;  1JQG A;  2PJ3 A;  3H8G A;  3IIF A;  1TXR A;  1XRY A;  2FVG A;  4EME A;  1BPM A;  3KQZ A;  1CP7 A;  2FG1 A;  4UML A;  4X2T A;  2F7V A;  3JZT A;  1H8L A;  5FSU A;  4MCP A;  2ZED A;  4OKO A;  4PXE A;  2AFZ A;  4OME A;  4J5R A;  2IJZ A;  5FSY A;  1CP6 A;  2BOA A;  4IHM A;  1PCA A;  1R3N A;  1XBU A;  4F8Z A;  2ZOF A;  4ZX9 A;  1TKH A;  1HEE A;  1DE4 C;  4OC4 A;  2AFS A;  3WC5 A;  2GLJ A;  5LYD A;  3PFE A;  1VHE A;  4UF4 A;  4JCA A;  3PEI A;  2PRQ A;  4NGR A;  2Q4Z A;  4W9Y A;  4R6T A;  1QQ9 A;  2ZOG A;  1XJO A;  3GPG A;  5HVH A;  1OBR A;  4MCQ A;  4P4F A;  3GB0 A;  1PYT B;  5HVF A;  4NGN A;  3SJE A;  3PB9 X;  1Z8L A;  3NH5 A;  2J9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...