1LAPA

Molecular structure of leucine aminopeptidase at 2.7-angstroms resolution
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
484
structure length
481
Chain Sequence
TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytosol aminopeptidase
publication title Molecular structure of leucine aminopeptidase at 2.7-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 154
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1990-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lapA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lapA02
3EKEA 1Y7EA 1LCPA 5K8NA 4WJBA 5CB5A 1CG2A 2NYQA 4NGSA 5DUSA 2CIJA 4MXUA 2PJ2A 3IIFA 4PXEA 2ZEPA 3WT4A 4RUHA 3MRUA 1HEEA 1LOKA 5FSZA 3IIDA 3SI2A 3S9MA 2PE3A 1RTQA 2WZNA 1BAVA 4MCRA 4D86A 4ABKA 4MHNA 1FT7A 4ETJA 4A38A 3SIJA 1Y0YA 1TY8A 2PJAA 4JVVA 5CB3A 2ZEMA 1HDUA 3S9LA 4MCSA 4OC5A 3KGQA 4PQAA 4P45A 2AFWA 3BXMA 4X2TA 5HXDA 1R43A 4UF4A 2AFCA 3KHXA 3FMCA 4P4DA 2RB7A 2ZOFA 5FSXA 3GLJA 3EJFA 4JYWA 3NFZA 2V8VA 4IAVA 2GLJA 4YWYA 3IC1A 3DLJA 3WC5A 8CPAA 3KR5A 4MMOA 5JH9A 2ZEEA 1TF8A 1VGYA 1ZLIA 4MCQA 1IY7A 4ABLA 1HJZA 3BI1A 1ELMP 3KL9A 1NSAA 4X3RA 4R7MA 3LMSA 5HVHA 5JGFA 1CP6A 4IQYA 2ANPA 1M4LA 2Q51A 2FAVA 4ETKA 3FX6A 4P6YA 4ZY1A 3VH9A 4P4FA 3VARA 4GUAA 4P44A 2XEJA 1Z8LA 2V8HA 2ZEGA 4O23A 5LYLA 4MHPA 3S9NA 3JRUA 4X8IA 1YMEA 4A39A 4Q7AA 3RZAA 2ZEHA 5LYFA 3K9TA 1TXZA 1ARLA 5K8MA 1VHOA 2L8RA 3N5FA 1CP7A 2PJ7A 2JEWA 4LQGA 1TKHA 5LYIA 5IB9A 4R6TA 4AXVA 3HLPA 3V7ZA 3D7DA 3PB9X 3PFEA 2FG1A 2ACFA 2EK9A 3KI9A 3PB8X 3PRTA 2PJCA 3HUVA 1F57A 1XBUA 2PJ8A 4P4JA 1YD9A 1TKFA 2IMOA 2EK8A 4P4IA 2QYVA 2JBKA 1Y0RA 2Q43A 4ZY2A 4ZY0A 2G9DA 3JZTA 1JQGA 2C1CA 1ARMA 4FBEA 4UMLA 5HVFA 3GPQA 2C6CA 4F9VA 7CPAA 3EW5A 1R3NA 2ZEDA 1Z2LA 3GUXA 4A94A 4UIAA 1IGBA 1OBRA 4GVWA 4YU9A 3D7GA 2DEAA 2O4HA 4ZX9A 1QQ9A 3SI0A 5I4MA 3PEIA 2PJ9A 1SPVA 4JLLA 2J9AA 4J5SA 2IJZA 5LYDA 1F2PA 2PJ3A 3FJUA 3FVLA 4OC3A 1CX8A 2BFRA 2PJ0A 2I3CA 3FH4A 5LRJA 3H8EA 1AYEA 2HB6A 4J4ZA 3QNVA 3SIHA 4UEFA 3EWPA 3PBBA 2PJ1A 3ISZA 4F8ZA 4J5QA 4Z65A 4F9UA 3GQEA 4P10A 3GB0A 4FWUA 1YW6A 3CPAA 4B6ZA 4OC1A 1TKJA 3CPXA 3T8WA 3MN8A 3KASA 2RFHA 4NGTA 1Q7LA 3IFEA 1CPXA 4OKOA 1LANA 4MHYA 3K2KA 3KZWA 4NJQA 4OIWA 4OC2A 1ELLP 3B35A 4PXCA 4GM5A 2CF4A 3PB6X 2QVPA 1XJOA 3TX8A 4NJRA 4CPAA 5HVGA 4FAIA 4OC0A 5F09A 3FECA 3TC8A 5FSVA 1AMPA 3ETIA 2EEEA 2GLFA 3KQXA 3B3WA 3RBUA 4OIDA 1HDQA 4NGMA 3DGVA 2CTCA 1EE3P 1F2OA 2GU2A 1QMUA 2V8GA 1H8LA 5LRKA 5CMSA 2BFQA 6CPAA 2ZELA 3IWWA 4KSIA 3EWQA 5D29A 2AFOA 4TU0A 5HOLA 2XD7A 4GVVA 4KYBA 3VFQA 4P4BA 3V38A 4WWVA 4A37A 3B2YA 2GREA 2ZENA 4UIBA 3PB7X 4NGRA 3FEEA 1ZG9A 5K8PA 2PJ4A 4W9YA 4ZYQA 2AFXA 4OC4A 3SI1A 5DS0A 3NA6A 3KQZA 3B3TA 3H8GA 1LAMA 2IQ6A 3SIIA 4K0CA 2WYRA 3D66A 4IHMA 2VRIA 4J5RA 2F7VA 4IK2A 2XEIA 5JM6A 5LRGA 2PJ6A 2PIYA 1VIXA 3B7IA 3PB4X 4ONWA 4R76A 4PPZA 2FVGA 3IIBA 4PXDA 4PXBA 3LWUA 3D7HA 1ZR3A 2VL1A 3B3VA 2LGRA 1GYTA 3H8FA 3I1UA 2QJ8A 3VATA 3WC6A 1FNOA 5THWA 1XMBA 4JGKA 2XEFA 2V8DA 1VHUA 3B3SA 2PIZA 5CBMA 4H2KA 1YW4A 2DX6A 3Q6ZA 2F8HA 2ZEOA 3GQOA 1ZG7A 1PCAA 3EWOA 3RAMA 3D7FA 5FSUA 1DE4C 3D68A 4UEEA 1LAPA 3EJGA 2ABZA 3WABA 3D4UA 2PJBA 3ISXA 1CPSA 4NGQA 2OR4A 2Q4ZA 3SJXA 4EWTA 2O53A 1BLLE 5ELYA 1TXRA 1ZR5A 2AFZA 2AFMA 3KHZA 1Z5RA 3FF3A 3BHXA 3WC7A 2POKA 3V2BA 1ZG8A 3KR4A 2XEGA 5FSYA 2PVWA 1BPNA 5K8OA 4FUUA 4JCAA 3FEDA 1ZLHA 2PCUA 4JZ0A 4BD9A 3SIGA 4UEZA 4G1PA 4ESSA 2CTBA 3V45A 4DJLA 4EMEA 3NH5A 1YLOA 3CT9A 2PJ5A 1VHEA 3NH4A 2FXKA 4P4EA 3NH8A 2HC9A 3D67A 3PBEA 3IEHA 3GPGA 2BO9A 3BI0A 4MHZA 4K3NA 2BOAA 3IJ3A 4OP4A 1PYTB 2EWBA 5E3BA 4NGPA 1UWYA 1YSJA 4MCPA 4TWEA 2V77A 5D8NA 2BCOA 2X47A 2AFUA 2C6PA 2ZEFA 3SJFA 4R8FA 2C6GA 5AILA 5HIHA 4TNUA 3B3CA 1XFOA 2OOTA 3SJGA 2JBJA 1CBXA 5CPAA 3PFOA 4NGNA 1BPMA 1DTDA 4DYOA 3IO1A 4DUKA 4ZI6A 5J1QA 4MRIA 4ZX8A 4NFRA 1LFWA 2AFSA 1KWMA 4OMEA 1TF9A 2PVVA 3GPOA 3CDXA 1NJRA 3EWRA 2PRQA 1XRYA 3L2NA 4EFDA 3SJEA 2NSMA 2ZOGA 3Q71A
chains in the Genus database with same CATH superfamily
4HKFA 3EKEA 1Y7EA 2AE6A 4A32A 4EVYA 1XOVA 5C82A 1LCPA 5K8NA 4WJBA 5CB5A 1CG2A 3LD2A 2NYQA 4NGSA 2OH1A 5DUSA 2CIJA 4MXUA 2PJ2A 1VKCA 1Q2YA 4XNHB 4MFQA 3IIFA 4A30A 4UCPA 5J8CA 4PXEA 2ZEPA 3WT4A 3R9EA 3MRUA 1HEEA 2B4DA 4R3KA 3W91A 2Z3LA 4RUHA 5G22A 2YNDA 1LOKA 2JDCA 5FSZA 3IIDA 4K30A 3SI2A 4UFVA 4CAXA 4YFJA 3CXPA 3S9MA 2PE3A 3MGDA 1RTQA 3W6XA 2WZNA 2ZW7A 3R9GA 1BAVA 4MCRA 4R57A 4D86A 4ABKA 1YQEA 2FL4A 1RXTA 4KLWA 4MHNA 1FT7A 1Z8TA 4ETJA 3FNCA 4A38A 2R8VA 3SIJA 1Y0YA 2FXFA 5J8FA 1TY8A 2PJAA 3F8KA 4CRZB 2VXKA 1M44A 4JVVA 5CB3A 2Z0ZA 4XPLA 2ZEMA 1ON0A 3D2PA 1HDUA 3DSBA 2DXQA 3B8GA 3S9LA 4MCSA 4OC5A 1IB1E 3KGQA 4PQAA 4CYPA 4NCZA 4P45A 2AFWA 3BXMA 1P4NA 4X2TA 2DPSA 3R95A 5HXDA 1K4JA 1Z4RA 2CY2A 3I3GA 1R43A 2FCKA 3G8WA 4MFPA 4RN7A 4UF4A 3V8IA 2AFCA 3KHXA 3FMCA 4P4DA 2RB7A 4NXYA 2ZOFA 5FSXA 1BO4A 4F0YA 3GLJA 4CRYB 2GFQA 3EJFA 3BJ8A 4JYWA 4JWPA 3NFZA 2V8VA 4B12A 4IAVA 2GLJA 4YWYA 5IX3A 3IC1A 1I12A 3DLJA 3WC5A 2YNCC 3RO0A 2WCTA 2WPXA 3T90A 8CPAA 3KR5A 4MMOA 4B13A 2ZEEA 1TF8A 5A28A 1VGYA 5JH9A 2IL4A 1ZLIA 2HQYA 1YX0A 4MCQA 1R57A 4KUBA 1LRZA 1IY7A 5ISVA 1U6MA 4C68A 5EMIA 4ABLA 1HJZA 2A4NA 1AUGA 2QECA 3BI1A 4CGNA 1ELMP 3KL9A 3DNSA 3IU1A 2JLMA 4QUSA 1NSAA 5EBVA 4X3RA 4BBHA 2GIVA 4R7MA 3P2HA 1S3ZA 3LMSA 2REEA 4M3SA 1I21A 5HVHA 2R98A 1CP6A 2RC4A 5H86A 4IQYA 2ANPA 4MFJA 1Q2CA 4QB9A 4CYNA 1M4LA 3SXNA 2Q51A 2FAVA 2CXAA 4ETKA 2BL1A 1YREA 3FX6A 4UA3A 4M85A 4P6YA 4CAFA 3SJGA 4ZY1A 1WK4A 3VH9A 4P4FA 3VARA 4GUAA 2EBJA 4P44A 2XEJA 1Z8LA 2V8HA 2ZEGA 4O23A 5LYLA 2JZDA 4AVBA 4FD6A 2B4DB 3P2FA 5I0CA 4MHDA 4XPDB 4MHPA 3EC4A 3JRUA 3RYOA 2CNMA 4X8IA 3S9NA 1YMEA 4R3LA 4A39A 4Q7AA 4QC6A 2B3VA 4Y49C 1S7NA 2Y0MA 2ZEHA 3RZAA 4C2ZA 3PZJA 5LYFA 3K9TA 1TXZA 2HV2A 1ARLA 3TCVA 2X7BA 3WR7A 5K8MA 1V0CA 4ORFA 1VHOA 3PGPA 1Y7RA 2L8RA 4HNYB 3N5FA 1CP7A 3TFYA 2PJ7A 4KOVA 2JEWA 4LQGA 4CAVA 1TKHA 3T9YA 5LYIA 5IB9A 4R6TA 1QSTA 2Z3MA 2PRBA 4AXVA 3HLPA 3FYNA 3V7ZA 1M1DA 4AVAA 3A9LA 3D7DA 3PB9X 2WPWA 2VI7A 4PK2A 1S7KA 4KOWA 3PFEA 2FG1A 4FD5A 4KVXA 2ACFA 2EK9A 4XPKA 3KI9A 3PB8X 3TOBA 3PRTA 1B6BA 3JUWA 3D2MA 2J8MA 2PJCA 1YGHA 2PSWA 4J3GA 4CYQA 3HUVA 1F57A 4JXRA 3W6SA 1XBUA 2PJ8A 2FS5A 2J8RA 4P4JA 4KZTA 4UBRA 1YD9A 4LUAA 1IICA 1S7LA 1TKFA 3I9SA 1IU8A 2IMOA 2EK8A 4PSXA 2QYVA 2JBKA 4P4IA 1Y0RA 4JJXA 1Z8XA 2Q43A 4ZY2A 4ZY0A 1PU9A 3JZTA 1JQGA 1OZPA 2C1CA 1ARMA 2G9DA 2QMLA 3CXQA 4UMLA 4MY3A 4A2ZA 4FBEA 2DPTA 5HVFA 5F49A 4DNCA 3GPQA 2G3AA 4B11A 2C6CA 4F9VA 7CPAA 2PC1A 3EW5A 1R3NA 2ZEDA 4B5OA 1Z2LA 3GUXA 4YGOA 4C2YA 4A94A 3FRMA 5G21A 1CM0A 3TO6A 4M6IA 4UIAA 2VBQA 4RI1A 1IGBA 4A31A 1MJAA 4M6GA 1OBRA 4GVWA 2JDDA 4YU9A 3TO9A 2HUZA 3D7GA 5EC4A 3TTHA 5F48A 2DEAA 2O4HA 3D8PA 4M6HA 1NMTA 4H89A 4ZX9A 1QQ9A 3SI0A 1CJWA 4U9YA 5I4MA 2J8NA 1QSOA 2OB0A 4JD6A 1JWQA 3PEIA 2PJ9A 4NEXA 5JPHA 1SPVA 2AJ6A 2R7HA 2Z3PA 4OADA 5CNPA 4F0XA 4E2AA 1Z9UA 4JLLA 2J9AA 4J5SA 1BOBA 2EVNA 2IJZA 1F2PA 2PJ3A 5LYDA 3FJUA 3FVLA 4OC3A 5A27A 3ZJ0A 1CX8A 2BFRA 2PJ0A 2Q44A 1YVOA 2I3CA 3CZXA 3FH4A 5LRJA 3H8EA 1TIQA 1AYEA 1NE9A 2HB6A 3RNZA 4AG9A 4J4ZA 2I00A 3QNVA 3SIHA 1ZO0A 3FBUA 4UEFA 3EWPA 4U9ZA 4AG7A 3PBBA 2PJ1A 3ISZA 4F8ZA 2JZFA 4J5QA 2Q04A 4Z65A 2OZGA 3D3SA 4H6ZA 4F9UA 3GQEA 2GE3A 3GB0A 4KVME 4FWUA 1YW6A 1RO5A 3CPAA 4P10A 1J4JA 3TOAA 4OC1A 4B6ZA 2O28A 1TKJA 4CGMA 1WWZA 3CPXA 3TT2A 5C88A 2FE7A 4MBUA 3T8WA 2PDOA 3MN8A 3KASA 2QIRA 1Z4EA 2B4BA 2RFHA 5AG6A 4NGTA 5AG5A 4X5KA 1Q7LA 3IFEA 4KOXA 4I49A 1CPXA 4OKOA 5IB0A 4PK3A 1LANA 4MHYA 1YVKA 3KZWA 3K2KA 4NJQA 4OIWA 1ELLP 4OC2A 2Q7BA 3B35A 4PXCA 4GM5A 2CF4A 2ZW6A 3PB6X 2VZZA 4UWIA 2QVPA 4FD4A 1XJOA 3TX8A 5KTCA 3IGRA 4NJRA 4CPAA 1N71A 5HVGA 3BLNA 4FAIA 4R9MA 1Y9WA 4OC0A 5F09A 3FECA 3TC8A 2W2GA 5FSVA 2D4OA 1AMPA 2Z3OA 3ETIA 4KSAA 4MFKA 4CS0B 2EEEA 2GLFA 3KQXA 3B3WA 4IUSA 3RBUA 5IV0A 4OIDA 1HDQA 4NGMA 2PQ8A 2B5GB 3KKWA 1XEBA 3DGVA 5JQ4A 5KTDA 2CTCA 1EE3P 1F2OA 4HPSA 2GU2A 1QMUA 2V8GA 1H8LA 4MY0A 4Y49B 3IU2A 5LRKA 5CMSA 2BFQA 3DR6A 6CPAA 1KUYA 4KVOE 2YNCA 1IOIA 3QAYA 2ZELA 3IWWA 4UFXA 4UCNA 4KSIA 3EWQA 2CNTA 2AFOA 4LX9A 5D29A 1KZFA 4TU0A 5HOLA 4CGLA 2XD7A 4GVVA 4KYBA 1S7FA 3VFQA 2B58A 4CGPA 4P4BA 3V38A 2VEZA 4WWVA 4A37A 4HNWB 3NE7A 3B2YA 3IWGA 2GREA 3R96A 2ZENA 4BINA 3F0AA 3GYAA 3N7ZA 2WUUA 3PB7X 4NGRA 4UIBA 4NSQA 3FEEA 1ZG9A 4KOYA 2PJ4A 5K8PA 1P0HA 4W9YA 2KCWA 4C7IA 4ZYQA 2AFXA 4OC4A 4QBJA 2P0WA 4MJ8A 5F47A 3SI1A 2OZUA 5DS0A 5E96A 3DDDA 3NA6A 3KQZA 2CNSA 2EUIA 3B3TA 4UCMA 3R9FA 3H8GA 1LAMA 2IQ6A 4UFWA 4RS2A 3SIIA 2FIAA 4K0CA 3F5BA 2WYRA 3D66A 4IHMA 2VRIA 4J5RA 1Q2DA 1YK3A 2F7VA 2Q7SA 3C26A 2XEIA 2BEIA 4IK2A 4LQ6A 5LRGA 5BWAB 2P6EA 5JM6A 4GXHA 2YGWA 4JXQA 4PV6A 2PJ6A 2PIYA 1XF8A 2B5GA 4U5YA 1VIXA 3SXOA 3B7IA 3PB4X 4ONWA 4R76A 2WSAA 4KOTA 4PPZA 3LODA 2FVGA 3IIBA 2NMTA 4PXDA 4PXBA 1X10A 3D7HA 3LWUA 4KOSA 1ZR3A 2VL1A 2BSWA 3B3VA 4II9A 1X12A 2JEVA 2ODFA 4Q38A 3FIXA 1SQHA 1IOFA 2LGRA 4XNHC 3H5ZA 1GYTA 3H8FA 1M4GA 3I1UA 1QSNA 2QJ8A 4AB7A 2PR1A 4YRHA 3VATA 3WC6A 1FNOA 5THWA 2P6FA 1XMBA 4JGKA 1PUAA 2XEFA 2V8DA 4L89A 1VHUA 3B3SA 2PIZA 5CBMA 4H2KA 3GKRA 1YW4A 1I1DA 4MFZA 2Z11A 2DX6A 3Q6ZA 2F8HA 2ZEOA 3GQOA 1ZG7A 5F46A 2OZHA 1M4IA 4ZGYB 1PCAA 3EWOA 3RAMA 3D7FA 2FSRA 3R1KA 1XE4A 5FSUA 1DE4C 2FT0A 3D68A 3G3SA 1LAPA 3EJGA 4GS4A 4UEEA 2ABZA 4MFLA 4QVTA 3D4UA 2PJBA 2Q4VA 3EY5A 2G0BA 3ISXA 1CPSA 2I79A 2Z10A 4KORA 2OR4A 4NGQA 2Q4ZA 4A33A 3SJXA 3S6GA 4EWTA 2O53A 1BLLE 5ELYA 1GHEA 1TXRA 1ZR5A 2VZYA 1A2ZA 2AFZA 2AFMA 3KHZA 1VHSA 1Z5RA 3FF3A 3BHXA 3WC7A 2POKA 3GIUA 3V2BA 1IYLA 1ZG8A 3KR4A 1B87A 2XEGA 5DWNA 4CAEA 3IWEA 5FSYA 2RNKA 2ATRA 2PVWA 1BPNA 5K8OA 4FUUA 1KUVA 5HH1A 2H5MA 4JCAA 3FEDA 1ZLHA 4KOUA 2R1IA 2PCUA 3PP9A 2ZW4A 4JZ0A 4BD9A 3S6HA 4C7HA 3SIGA 4UEZA 2ZXVA 4H6UA 4G1PA 4OLLA 4ESSA 2CTBA 3JVNA 3V45A 3QAHA 4FD7A 4DJLA 4EMEA 3NH5A 1YLOA 3H4QA 3CT9A 2P6GA 5JGFA 2PJ5A 1VHEA 4KSFA 5DWMA 5KTAA 3NH4A 5AG7A 4UWJA 4BMHA 2FXKA 4P4EA 2PR8A 3NE8A 1IIDA 2K5TA 3JTKA 3NH8A 3EFAA 2HC9A 2C27A 3D67A 1IYKA 1Y9KA 4IF5A 4OAEA 3PBEA 4ZBGA 4A95A 3IEHA 2KQVA 3GPGA 2BO9A 4Q36A 3BI0A 4L8AA 4K3NA 2Q4YA 4MHZA 2BOAA 4B10A 1KUXA 3IJ3A 5G1ZA 3VWEA 4OP4A 4B5PB 1PYTB 3GY9A 4KLVA 1XMTA 4KUAA 4JLYA 2Z3NA 3OWCA 4CAWA 2YNEA 2EWBA 2REFA 4C2XA 5HMNA 5E3BA 1MJ9A 3S6FA 3SHPA 2OU2A 4NGPA 1UWYA 4B14A 1UFHA 1YSJA 5G20A 4MCPA 5AGEA 2BUEA 2GANA 1MJBA 4TWEA 4CYOA 2V77A 5D8NA 3EXNA 2BCOA 2X47A 2AFUA 4ONUA 4R87A 3E0KA 2C6PA 3CXSA 2ZEFA 3BJ7A 5GCNA 3TO7A 3SJFA 4R8FA 2C6GA 4XPDC 5AILA 5HIHA 2EO8A 4CGOA 2G3TA 2JZEA 3VWDA 5AG4A 4KS9A 4TNUA 3B3CA 1XFOA 2Z3KA 2OOTA 3S6KA 2JBJA 2VQYA 4HNXB 1CBXA 5CPAA 3EO4A 3PFOA 4NGNA 2DF5A 1M4DA 1BPMA 1DTDA 1Z8WA 5FVJA 1YLEA 4DYOA 3IO1A 4DUKA 3FXTA 4F6AA 3QB8A 4ZI6A 1YR0A 3WABA 2Q0YA 4MRIA 4ZX8A 2D4PA 3LACA 5J1QA 4NFRA 1LFWA 2AFSA 2ZPAA 5H84A 1KWMA 4OMEA 1QSRA 3DR8A 1NSLA 3ZZIA 1TF9A 2PVVA 3FB3A 4MI4A 3GPOA 3CDXA 4AVCA 1NJRA 3EWRA 2PRQA 3TE4A 1XRYA 3L2NA 3K9UA 4EFDA 4B5PA 3SJEA 1S60A 1XIXA 2NSMA 3Q71A 2ZOGA 4PSWA 4E0AA 1MK4A 2B3UA 1S5KA 1FY7A 2FIWA 1L0CA 2ARHA 2F5IA 2ZW5A 4NF1A 3UY5A 4E8OA 1QSMA
chains in the Genus database with same CATH topology
3EKEA 1Y7EA 1LCPA 5K8NA 4WJBA 5CB5A 1CG2A 2NYQA 4NGSA 5DUSA 2CIJA 4MXUA 2PJ2A 3IIFA 4PXEA 2ZEPA 3WT4A 4RUHA 3MRUA 1HEEA 1LOKA 5FSZA 3IIDA 3SI2A 3S9MA 2PE3A 1RTQA 2WZNA 1BAVA 4MCRA 4D86A 4ABKA 4MHNA 1FT7A 4ETJA 4A38A 3SIJA 1Y0YA 1TY8A 2PJAA 4JVVA 5CB3A 2ZEMA 1HDUA 3S9LA 4MCSA 4OC5A 3KGQA 4PQAA 4P45A 2AFWA 3BXMA 4X2TA 5HXDA 1R43A 4UF4A 2AFCA 3KHXA 3FMCA 4P4DA 2RB7A 2ZOFA 5FSXA 3GLJA 3EJFA 4JYWA 3NFZA 2V8VA 4IAVA 2GLJA 4YWYA 3IC1A 3DLJA 3WC5A 8CPAA 3KR5A 4MMOA 5JH9A 2ZEEA 1TF8A 1VGYA 1ZLIA 4MCQA 1IY7A 4ABLA 1HJZA 3BI1A 1ELMP 3KL9A 1NSAA 4X3RA 4R7MA 3LMSA 5HVHA 5JGFA 1CP6A 4IQYA 2ANPA 1M4LA 2Q51A 2FAVA 4ETKA 3FX6A 4P6YA 4ZY1A 3VH9A 4P4FA 3VARA 4GUAA 4P44A 2XEJA 1Z8LA 2V8HA 2ZEGA 4O23A 5LYLA 4MHPA 3S9NA 3JRUA 4X8IA 1YMEA 4A39A 4Q7AA 3RZAA 2ZEHA 5LYFA 3K9TA 1TXZA 1ARLA 5K8MA 1VHOA 2L8RA 3N5FA 1CP7A 2PJ7A 2JEWA 4LQGA 1TKHA 5LYIA 5IB9A 4R6TA 4AXVA 3HLPA 3V7ZA 3D7DA 3PB9X 3PFEA 2FG1A 2ACFA 2EK9A 3KI9A 3PB8X 3PRTA 2PJCA 3HUVA 1F57A 1XBUA 2PJ8A 4P4JA 1YD9A 1TKFA 2IMOA 2EK8A 4P4IA 2QYVA 2JBKA 1Y0RA 2Q43A 4ZY2A 4ZY0A 2G9DA 3JZTA 1JQGA 2C1CA 1ARMA 4FBEA 4UMLA 5HVFA 3GPQA 2C6CA 4F9VA 7CPAA 3EW5A 1R3NA 2ZEDA 1Z2LA 3GUXA 4A94A 4UIAA 1IGBA 1OBRA 4GVWA 4YU9A 3D7GA 2DEAA 2O4HA 4ZX9A 1QQ9A 3SI0A 5I4MA 3PEIA 2PJ9A 1SPVA 4JLLA 2J9AA 4J5SA 2IJZA 5LYDA 1F2PA 2PJ3A 3FJUA 3FVLA 4OC3A 1CX8A 2BFRA 2PJ0A 2I3CA 3FH4A 5LRJA 3H8EA 1AYEA 2HB6A 4J4ZA 3QNVA 3SIHA 4UEFA 3EWPA 3PBBA 2PJ1A 3ISZA 4F8ZA 4J5QA 4Z65A 4F9UA 3GQEA 4P10A 3GB0A 4FWUA 1YW6A 3CPAA 4B6ZA 4OC1A 1TKJA 3CPXA 3T8WA 3MN8A 3KASA 2RFHA 4NGTA 1Q7LA 3IFEA 1CPXA 4OKOA 1LANA 4MHYA 3K2KA 3KZWA 4NJQA 4OIWA 4OC2A 1ELLP 3B35A 4PXCA 4GM5A 2CF4A 3PB6X 2QVPA 1XJOA 3TX8A 4NJRA 4CPAA 5HVGA 4FAIA 4OC0A 5F09A 3FECA 3TC8A 5FSVA 1AMPA 3ETIA 2EEEA 2GLFA 3KQXA 3B3WA 3RBUA 4OIDA 1HDQA 4NGMA 3DGVA 2CTCA 1EE3P 1F2OA 2GU2A 1QMUA 2V8GA 1H8LA 5LRKA 5CMSA 2BFQA 6CPAA 2ZELA 3IWWA 4KSIA 3EWQA 5D29A 2AFOA 4TU0A 5HOLA 2XD7A 4GVVA 4KYBA 3VFQA 4P4BA 3V38A 4WWVA 4A37A 3B2YA 2GREA 2ZENA 4UIBA 3PB7X 4NGRA 3FEEA 1ZG9A 5K8PA 2PJ4A 4W9YA 4ZYQA 2AFXA 4OC4A 3SI1A 5DS0A 3NA6A 3KQZA 3B3TA 3H8GA 1LAMA 2IQ6A 3SIIA 4K0CA 2WYRA 3D66A 4IHMA 2VRIA 4J5RA 2F7VA 4IK2A 2XEIA 5JM6A 5LRGA 2PJ6A 2PIYA 1VIXA 3B7IA 3PB4X 4ONWA 4R76A 4PPZA 2FVGA 3IIBA 4PXDA 4PXBA 3LWUA 3D7HA 1ZR3A 2VL1A 3B3VA 2LGRA 1GYTA 3H8FA 3I1UA 2QJ8A 3VATA 3WC6A 1FNOA 5THWA 1XMBA 4JGKA 2XEFA 2V8DA 1VHUA 3B3SA 2PIZA 5CBMA 4H2KA 1YW4A 2DX6A 3Q6ZA 2F8HA 2ZEOA 3GQOA 1ZG7A 1PCAA 3EWOA 3RAMA 3D7FA 5FSUA 1DE4C 3D68A 4UEEA 1LAPA 3EJGA 2ABZA 3WABA 3D4UA 2PJBA 3ISXA 1CPSA 4NGQA 2OR4A 2Q4ZA 3SJXA 4EWTA 2O53A 1BLLE 5ELYA 1TXRA 1ZR5A 2AFZA 2AFMA 3KHZA 1Z5RA 3FF3A 3BHXA 3WC7A 2POKA 3V2BA 1ZG8A 3KR4A 2XEGA 5FSYA 2PVWA 1BPNA 5K8OA 4FUUA 4JCAA 3FEDA 1ZLHA 2PCUA 4JZ0A 4BD9A 3SIGA 4UEZA 4G1PA 4ESSA 2CTBA 3V45A 4DJLA 4EMEA 3NH5A 1YLOA 3CT9A 2PJ5A 1VHEA 3NH4A 2FXKA 4P4EA 3NH8A 2HC9A 3D67A 3PBEA 3IEHA 3GPGA 2BO9A 3BI0A 4MHZA 4K3NA 2BOAA 3IJ3A 4OP4A 1PYTB 2EWBA 5E3BA 4NGPA 1UWYA 1YSJA 4MCPA 4TWEA 2V77A 5D8NA 2BCOA 2X47A 2AFUA 2C6PA 2ZEFA 3SJFA 4R8FA 2C6GA 5AILA 5HIHA 4TNUA 3B3CA 1XFOA 2OOTA 3SJGA 2JBJA 1CBXA 5CPAA 3PFOA 4NGNA 1BPMA 1DTDA 4DYOA 3IO1A 4DUKA 4ZI6A 5J1QA 4MRIA 4ZX8A 4NFRA 1LFWA 2AFSA 1KWMA 4OMEA 1TF9A 2PVVA 3GPOA 3CDXA 1NJRA 3EWRA 2PRQA 1XRYA 3L2NA 4EFDA 3SJEA 2NSMA 2ZOGA 3Q71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKE A;  1Y7E A;  1LCP A;  5K8N A;  4WJB A;  5CB5 A;  1CG2 A;  2NYQ A;  4NGS A;  5DUS A;  2CIJ A;  4MXU A;  2PJ2 A;  3IIF A;  4PXE A;  2ZEP A;  3WT4 A;  4RUH A;  3MRU A;  1HEE A;  1LOK A;  5FSZ A;  3IID A;  3SI2 A;  3S9M A;  2PE3 A;  1RTQ A;  2WZN A;  1BAV A;  4MCR A;  4D86 A;  4ABK A;  4MHN A;  1FT7 A;  4ETJ A;  4A38 A;  3SIJ A;  1Y0Y A;  1TY8 A;  2PJA A;  4JVV A;  5CB3 A;  2ZEM A;  1HDU A;  3S9L A;  4MCS A;  4OC5 A;  3KGQ A;  4PQA A;  4P45 A;  2AFW A;  3BXM A;  4X2T A;  5HXD A;  1R43 A;  4UF4 A;  2AFC A;  3KHX A;  3FMC A;  4P4D A;  2RB7 A;  2ZOF A;  5FSX A;  3GLJ A;  3EJF A;  4JYW A;  3NFZ A;  2V8V A;  4IAV A;  2GLJ A;  4YWY A;  3IC1 A;  3DLJ A;  3WC5 A;  8CPA A;  3KR5 A;  4MMO A;  5JH9 A;  2ZEE A;  1TF8 A;  1VGY A;  1ZLI A;  4MCQ A;  1IY7 A;  4ABL A;  1HJZ A;  3BI1 A;  1ELM P;  3KL9 A;  1NSA A;  4X3R A;  4R7M A;  3LMS A;  5HVH A;  5JGF A;  1CP6 A;  4IQY A;  2ANP A;  1M4L A;  2Q51 A;  2FAV A;  4ETK A;  3FX6 A;  4P6Y A;  4ZY1 A;  3VH9 A;  4P4F A;  3VAR A;  4GUA A;  4P44 A;  2XEJ A;  1Z8L A;  2V8H A;  2ZEG A;  4O23 A;  5LYL A;  4MHP A;  3S9N A;  3JRU A;  4X8I A;  1YME A;  4A39 A;  4Q7A A;  3RZA A;  2ZEH A;  5LYF A;  3K9T A;  1TXZ A;  1ARL A;  5K8M A;  1VHO A;  2L8R A;  3N5F A;  1CP7 A;  2PJ7 A;  2JEW A;  4LQG A;  1TKH A;  5LYI A;  5IB9 A;  4R6T A;  4AXV A;  3HLP A;  3V7Z A;  3D7D A;  3PB9 X;  3PFE A;  2FG1 A;  2ACF A;  2EK9 A;  3KI9 A;  3PB8 X;  3PRT A;  2PJC A;  3HUV A;  1F57 A;  1XBU A;  2PJ8 A;  4P4J A;  1YD9 A;  1TKF A;  2IMO A;  2EK8 A;  4P4I A;  2QYV A;  2JBK A;  1Y0R A;  2Q43 A;  4ZY2 A;  4ZY0 A;  2G9D A;  3JZT A;  1JQG A;  2C1C A;  1ARM A;  4FBE A;  4UML A;  5HVF A;  3GPQ A;  2C6C A;  4F9V A;  7CPA A;  3EW5 A;  1R3N A;  2ZED A;  1Z2L A;  3GUX A;  4A94 A;  4UIA A;  1IGB A;  1OBR A;  4GVW A;  4YU9 A;  3D7G A;  2DEA A;  2O4H A;  4ZX9 A;  1QQ9 A;  3SI0 A;  5I4M A;  3PEI A;  2PJ9 A;  1SPV A;  4JLL A;  2J9A A;  4J5S A;  2IJZ A;  5LYD A;  1F2P A;  2PJ3 A;  3FJU A;  3FVL A;  4OC3 A;  1CX8 A;  2BFR A;  2PJ0 A;  2I3C A;  3FH4 A;  5LRJ A;  3H8E A;  1AYE A;  2HB6 A;  4J4Z A;  3QNV A;  3SIH A;  4UEF A;  3EWP A;  3PBB A;  2PJ1 A;  3ISZ A;  4F8Z A;  4J5Q A;  4Z65 A;  4F9U A;  3GQE A;  4P10 A;  3GB0 A;  4FWU A;  1YW6 A;  3CPA A;  4B6Z A;  4OC1 A;  1TKJ A;  3CPX A;  3T8W A;  3MN8 A;  3KAS A;  2RFH A;  4NGT A;  1Q7L A;  3IFE A;  1CPX A;  4OKO A;  1LAN A;  4MHY A;  3K2K A;  3KZW A;  4NJQ A;  4OIW A;  4OC2 A;  1ELL P;  3B35 A;  4PXC A;  4GM5 A;  2CF4 A;  3PB6 X;  2QVP A;  1XJO A;  3TX8 A;  4NJR A;  4CPA A;  5HVG A;  4FAI A;  4OC0 A;  5F09 A;  3FEC A;  3TC8 A;  5FSV A;  1AMP A;  3ETI A;  2EEE A;  2GLF A;  3KQX A;  3B3W A;  3RBU A;  4OID A;  1HDQ A;  4NGM A;  3DGV A;  2CTC A;  1EE3 P;  1F2O A;  2GU2 A;  1QMU A;  2V8G A;  1H8L A;  5LRK A;  5CMS A;  2BFQ A;  6CPA A;  2ZEL A;  3IWW A;  4KSI A;  3EWQ A;  5D29 A;  2AFO A;  4TU0 A;  5HOL A;  2XD7 A;  4GVV A;  4KYB A;  3VFQ A;  4P4B A;  3V38 A;  4WWV A;  4A37 A;  3B2Y A;  2GRE A;  2ZEN A;  4UIB A;  3PB7 X;  4NGR A;  3FEE A;  1ZG9 A;  5K8P A;  2PJ4 A;  4W9Y A;  4ZYQ A;  2AFX A;  4OC4 A;  3SI1 A;  5DS0 A;  3NA6 A;  3KQZ A;  3B3T A;  3H8G A;  1LAM A;  2IQ6 A;  3SII A;  4K0C A;  2WYR A;  3D66 A;  4IHM A;  2VRI A;  4J5R A;  2F7V A;  4IK2 A;  2XEI A;  5JM6 A;  5LRG A;  2PJ6 A;  2PIY A;  1VIX A;  3B7I A;  3PB4 X;  4ONW A;  4R76 A;  4PPZ A;  2FVG A;  3IIB A;  4PXD A;  4PXB A;  3LWU A;  3D7H A;  1ZR3 A;  2VL1 A;  3B3V A;  2LGR A;  1GYT A;  3H8F A;  3I1U A;  2QJ8 A;  3VAT A;  3WC6 A;  1FNO A;  5THW A;  1XMB A;  4JGK A;  2XEF A;  2V8D A;  1VHU A;  3B3S A;  2PIZ A;  5CBM A;  4H2K A;  1YW4 A;  2DX6 A;  3Q6Z A;  2F8H A;  2ZEO A;  3GQO A;  1ZG7 A;  1PCA A;  3EWO A;  3RAM A;  3D7F A;  5FSU A;  1DE4 C;  3D68 A;  4UEE A;  1LAP A;  3EJG A;  2ABZ A;  3WAB A;  3D4U A;  2PJB A;  3ISX A;  1CPS A;  4NGQ A;  2OR4 A;  2Q4Z A;  3SJX A;  4EWT A;  2O53 A;  1BLL E;  5ELY A;  1TXR A;  1ZR5 A;  2AFZ A;  2AFM A;  3KHZ A;  1Z5R A;  3FF3 A;  3BHX A;  3WC7 A;  2POK A;  3V2B A;  1ZG8 A;  3KR4 A;  2XEG A;  5FSY A;  2PVW A;  1BPN A;  5K8O A;  4FUU A;  4JCA A;  3FED A;  1ZLH A;  2PCU A;  4JZ0 A;  4BD9 A;  3SIG A;  4UEZ A;  4G1P A;  4ESS A;  2CTB A;  3V45 A;  4DJL A;  4EME A;  3NH5 A;  1YLO A;  3CT9 A;  2PJ5 A;  1VHE A;  3NH4 A;  2FXK A;  4P4E A;  3NH8 A;  2HC9 A;  3D67 A;  3PBE A;  3IEH A;  3GPG A;  2BO9 A;  3BI0 A;  4MHZ A;  4K3N A;  2BOA A;  3IJ3 A;  4OP4 A;  1PYT B;  2EWB A;  5E3B A;  4NGP A;  1UWY A;  1YSJ A;  4MCP A;  4TWE A;  2V77 A;  5D8N A;  2BCO A;  2X47 A;  2AFU A;  2C6P A;  2ZEF A;  3SJF A;  4R8F A;  2C6G A;  5AIL A;  5HIH A;  4TNU A;  3B3C A;  1XFO A;  2OOT A;  3SJG A;  2JBJ A;  1CBX A;  5CPA A;  3PFO A;  4NGN A;  1BPM A;  1DTD A;  4DYO A;  3IO1 A;  4DUK A;  4ZI6 A;  5J1Q A;  4MRI A;  4ZX8 A;  4NFR A;  1LFW A;  2AFS A;  1KWM A;  4OME A;  1TF9 A;  2PVV A;  3GPO A;  3CDX A;  1NJR A;  3EWR A;  2PRQ A;  1XRY A;  3L2N A;  4EFD A;  3SJE A;  2NSM A;  2ZOG A;  3Q71 A; 
#chains in the Genus database with same CATH topology
 4HKF A;  3EKE A;  1Y7E A;  2AE6 A;  4A32 A;  4EVY A;  1XOV A;  5C82 A;  1LCP A;  5K8N A;  4WJB A;  5CB5 A;  1CG2 A;  3LD2 A;  2NYQ A;  4NGS A;  2OH1 A;  5DUS A;  2CIJ A;  4MXU A;  2PJ2 A;  1VKC A;  1Q2Y A;  4XNH B;  4MFQ A;  3IIF A;  4A30 A;  4UCP A;  5J8C A;  4PXE A;  2ZEP A;  3WT4 A;  3R9E A;  3MRU A;  1HEE A;  2B4D A;  4R3K A;  3W91 A;  2Z3L A;  4RUH A;  5G22 A;  2YND A;  1LOK A;  2JDC A;  5FSZ A;  3IID A;  4K30 A;  3SI2 A;  4UFV A;  4CAX A;  4YFJ A;  3CXP A;  3S9M A;  2PE3 A;  3MGD A;  1RTQ A;  3W6X A;  2WZN A;  2ZW7 A;  3R9G A;  1BAV A;  4MCR A;  4R57 A;  4D86 A;  4ABK A;  1YQE A;  2FL4 A;  1RXT A;  4KLW A;  4MHN A;  1FT7 A;  1Z8T A;  4ETJ A;  3FNC A;  4A38 A;  2R8V A;  3SIJ A;  1Y0Y A;  2FXF A;  5J8F A;  1TY8 A;  2PJA A;  3F8K A;  4CRZ B;  2VXK A;  1M44 A;  4JVV A;  5CB3 A;  2Z0Z A;  4XPL A;  2ZEM A;  1ON0 A;  3D2P A;  1HDU A;  3DSB A;  2DXQ A;  3B8G A;  3S9L A;  4MCS A;  4OC5 A;  1IB1 E;  3KGQ A;  4PQA A;  4CYP A;  4NCZ A;  4P45 A;  2AFW A;  3BXM A;  1P4N A;  4X2T A;  2DPS A;  3R95 A;  5HXD A;  1K4J A;  1Z4R A;  2CY2 A;  3I3G A;  1R43 A;  2FCK A;  3G8W A;  4MFP A;  4RN7 A;  4UF4 A;  3V8I A;  2AFC A;  3KHX A;  3FMC A;  4P4D A;  2RB7 A;  4NXY A;  2ZOF A;  5FSX A;  1BO4 A;  4F0Y A;  3GLJ A;  4CRY B;  2GFQ A;  3EJF A;  3BJ8 A;  4JYW A;  4JWP A;  3NFZ A;  2V8V A;  4B12 A;  4IAV A;  2GLJ A;  4YWY A;  5IX3 A;  3IC1 A;  1I12 A;  3DLJ A;  3WC5 A;  2YNC C;  3RO0 A;  2WCT A;  2WPX A;  3T90 A;  8CPA A;  3KR5 A;  4MMO A;  4B13 A;  2ZEE A;  1TF8 A;  5A28 A;  1VGY A;  5JH9 A;  2IL4 A;  1ZLI A;  2HQY A;  1YX0 A;  4MCQ A;  1R57 A;  4KUB A;  1LRZ A;  1IY7 A;  5ISV A;  1U6M A;  4C68 A;  5EMI A;  4ABL A;  1HJZ A;  2A4N A;  1AUG A;  2QEC A;  3BI1 A;  4CGN A;  1ELM P;  3KL9 A;  3DNS A;  3IU1 A;  2JLM A;  4QUS A;  1NSA A;  5EBV A;  4X3R A;  4BBH A;  2GIV A;  4R7M A;  3P2H A;  1S3Z A;  3LMS A;  2REE A;  4M3S A;  1I21 A;  5HVH A;  2R98 A;  1CP6 A;  2RC4 A;  5H86 A;  4IQY A;  2ANP A;  4MFJ A;  1Q2C A;  4QB9 A;  4CYN A;  1M4L A;  3SXN A;  2Q51 A;  2FAV A;  2CXA A;  4ETK A;  2BL1 A;  1YRE A;  3FX6 A;  4UA3 A;  4M85 A;  4P6Y A;  4CAF A;  3SJG A;  4ZY1 A;  1WK4 A;  3VH9 A;  4P4F A;  3VAR A;  4GUA A;  2EBJ A;  4P44 A;  2XEJ A;  1Z8L A;  2V8H A;  2ZEG A;  4O23 A;  5LYL A;  2JZD A;  4AVB A;  4FD6 A;  2B4D B;  3P2F A;  5I0C A;  4MHD A;  4XPD B;  4MHP A;  3EC4 A;  3JRU A;  3RYO A;  2CNM A;  4X8I A;  3S9N A;  1YME A;  4R3L A;  4A39 A;  4Q7A A;  4QC6 A;  2B3V A;  4Y49 C;  1S7N A;  2Y0M A;  2ZEH A;  3RZA A;  4C2Z A;  3PZJ A;  5LYF A;  3K9T A;  1TXZ A;  2HV2 A;  1ARL A;  3TCV A;  2X7B A;  3WR7 A;  5K8M A;  1V0C A;  4ORF A;  1VHO A;  3PGP A;  1Y7R A;  2L8R A;  4HNY B;  3N5F A;  1CP7 A;  3TFY A;  2PJ7 A;  4KOV A;  2JEW A;  4LQG A;  4CAV A;  1TKH A;  3T9Y A;  5LYI A;  5IB9 A;  4R6T A;  1QST A;  2Z3M A;  2PRB A;  4AXV A;  3HLP A;  3FYN A;  3V7Z A;  1M1D A;  4AVA A;  3A9L A;  3D7D A;  3PB9 X;  2WPW A;  2VI7 A;  4PK2 A;  1S7K A;  4KOW A;  3PFE A;  2FG1 A;  4FD5 A;  4KVX A;  2ACF A;  2EK9 A;  4XPK A;  3KI9 A;  3PB8 X;  3TOB A;  3PRT A;  1B6B A;  3JUW A;  3D2M A;  2J8M A;  2PJC A;  1YGH A;  2PSW A;  4J3G A;  4CYQ A;  3HUV A;  1F57 A;  4JXR A;  3W6S A;  1XBU A;  2PJ8 A;  2FS5 A;  2J8R A;  4P4J A;  4KZT A;  4UBR A;  1YD9 A;  4LUA A;  1IIC A;  1S7L A;  1TKF A;  3I9S A;  1IU8 A;  2IMO A;  2EK8 A;  4PSX A;  2QYV A;  2JBK A;  4P4I A;  1Y0R A;  4JJX A;  1Z8X A;  2Q43 A;  4ZY2 A;  4ZY0 A;  1PU9 A;  3JZT A;  1JQG A;  1OZP A;  2C1C A;  1ARM A;  2G9D A;  2QML A;  3CXQ A;  4UML A;  4MY3 A;  4A2Z A;  4FBE A;  2DPT A;  5HVF A;  5F49 A;  4DNC A;  3GPQ A;  2G3A A;  4B11 A;  2C6C A;  4F9V A;  7CPA A;  2PC1 A;  3EW5 A;  1R3N A;  2ZED A;  4B5O A;  1Z2L A;  3GUX A;  4YGO A;  4C2Y A;  4A94 A;  3FRM A;  5G21 A;  1CM0 A;  3TO6 A;  4M6I A;  4UIA A;  2VBQ A;  4RI1 A;  1IGB A;  4A31 A;  1MJA A;  4M6G A;  1OBR A;  4GVW A;  2JDD A;  4YU9 A;  3TO9 A;  2HUZ A;  3D7G A;  5EC4 A;  3TTH A;  5F48 A;  2DEA A;  2O4H A;  3D8P A;  4M6H A;  1NMT A;  4H89 A;  4ZX9 A;  1QQ9 A;  3SI0 A;  1CJW A;  4U9Y A;  5I4M A;  2J8N A;  1QSO A;  2OB0 A;  4JD6 A;  1JWQ A;  3PEI A;  2PJ9 A;  4NEX A;  5JPH A;  1SPV A;  2AJ6 A;  2R7H A;  2Z3P A;  4OAD A;  5CNP A;  4F0X A;  4E2A A;  1Z9U A;  4JLL A;  2J9A A;  4J5S A;  1BOB A;  2EVN A;  2IJZ A;  1F2P A;  2PJ3 A;  5LYD A;  3FJU A;  3FVL A;  4OC3 A;  5A27 A;  3ZJ0 A;  1CX8 A;  2BFR A;  2PJ0 A;  2Q44 A;  1YVO A;  2I3C A;  3CZX A;  3FH4 A;  5LRJ A;  3H8E A;  1TIQ A;  1AYE A;  1NE9 A;  2HB6 A;  3RNZ A;  4AG9 A;  4J4Z A;  2I00 A;  3QNV A;  3SIH A;  1ZO0 A;  3FBU A;  4UEF A;  3EWP A;  4U9Z A;  4AG7 A;  3PBB A;  2PJ1 A;  3ISZ A;  4F8Z A;  2JZF A;  4J5Q A;  2Q04 A;  4Z65 A;  2OZG A;  3D3S A;  4H6Z A;  4F9U A;  3GQE A;  2GE3 A;  3GB0 A;  4KVM E;  4FWU A;  1YW6 A;  1RO5 A;  3CPA A;  4P10 A;  1J4J A;  3TOA A;  4OC1 A;  4B6Z A;  2O28 A;  1TKJ A;  4CGM A;  1WWZ A;  3CPX A;  3TT2 A;  5C88 A;  2FE7 A;  4MBU A;  3T8W A;  2PDO A;  3MN8 A;  3KAS A;  2QIR A;  1Z4E A;  2B4B A;  2RFH A;  5AG6 A;  4NGT A;  5AG5 A;  4X5K A;  1Q7L A;  3IFE A;  4KOX A;  4I49 A;  1CPX A;  4OKO A;  5IB0 A;  4PK3 A;  1LAN A;  4MHY A;  1YVK A;  3KZW A;  3K2K A;  4NJQ A;  4OIW A;  1ELL P;  4OC2 A;  2Q7B A;  3B35 A;  4PXC A;  4GM5 A;  2CF4 A;  2ZW6 A;  3PB6 X;  2VZZ A;  4UWI A;  2QVP A;  4FD4 A;  1XJO A;  3TX8 A;  5KTC A;  3IGR A;  4NJR A;  4CPA A;  1N71 A;  5HVG A;  3BLN A;  4FAI A;  4R9M A;  1Y9W A;  4OC0 A;  5F09 A;  3FEC A;  3TC8 A;  2W2G A;  5FSV A;  2D4O A;  1AMP A;  2Z3O A;  3ETI A;  4KSA A;  4MFK A;  4CS0 B;  2EEE A;  2GLF A;  3KQX A;  3B3W A;  4IUS A;  3RBU A;  5IV0 A;  4OID A;  1HDQ A;  4NGM A;  2PQ8 A;  2B5G B;  3KKW A;  1XEB A;  3DGV A;  5JQ4 A;  5KTD A;  2CTC A;  1EE3 P;  1F2O A;  4HPS A;  2GU2 A;  1QMU A;  2V8G A;  1H8L A;  4MY0 A;  4Y49 B;  3IU2 A;  5LRK A;  5CMS A;  2BFQ A;  3DR6 A;  6CPA A;  1KUY A;  4KVO E;  2YNC A;  1IOI A;  3QAY A;  2ZEL A;  3IWW A;  4UFX A;  4UCN A;  4KSI A;  3EWQ A;  2CNT A;  2AFO A;  4LX9 A;  5D29 A;  1KZF A;  4TU0 A;  5HOL A;  4CGL A;  2XD7 A;  4GVV A;  4KYB A;  1S7F A;  3VFQ A;  2B58 A;  4CGP A;  4P4B A;  3V38 A;  2VEZ A;  4WWV A;  4A37 A;  4HNW B;  3NE7 A;  3B2Y A;  3IWG A;  2GRE A;  3R96 A;  2ZEN A;  4BIN A;  3F0A A;  3GYA A;  3N7Z A;  2WUU A;  3PB7 X;  4NGR A;  4UIB A;  4NSQ A;  3FEE A;  1ZG9 A;  4KOY A;  2PJ4 A;  5K8P A;  1P0H A;  4W9Y A;  2KCW A;  4C7I A;  4ZYQ A;  2AFX A;  4OC4 A;  4QBJ A;  2P0W A;  4MJ8 A;  5F47 A;  3SI1 A;  2OZU A;  5DS0 A;  5E96 A;  3DDD A;  3NA6 A;  3KQZ A;  2CNS A;  2EUI A;  3B3T A;  4UCM A;  3R9F A;  3H8G A;  1LAM A;  2IQ6 A;  4UFW A;  4RS2 A;  3SII A;  2FIA A;  4K0C A;  3F5B A;  2WYR A;  3D66 A;  4IHM A;  2VRI A;  4J5R A;  1Q2D A;  1YK3 A;  2F7V A;  2Q7S A;  3C26 A;  2XEI A;  2BEI A;  4IK2 A;  4LQ6 A;  5LRG A;  5BWA B;  2P6E A;  5JM6 A;  4GXH A;  2YGW A;  4JXQ A;  4PV6 A;  2PJ6 A;  2PIY A;  1XF8 A;  2B5G A;  4U5Y A;  1VIX A;  3SXO A;  3B7I A;  3PB4 X;  4ONW A;  4R76 A;  2WSA A;  4KOT A;  4PPZ A;  3LOD A;  2FVG A;  3IIB A;  2NMT A;  4PXD A;  4PXB A;  1X10 A;  3D7H A;  3LWU A;  4KOS A;  1ZR3 A;  2VL1 A;  2BSW A;  3B3V A;  4II9 A;  1X12 A;  2JEV A;  2ODF A;  4Q38 A;  3FIX A;  1SQH A;  1IOF A;  2LGR A;  4XNH C;  3H5Z A;  1GYT A;  3H8F A;  1M4G A;  3I1U A;  1QSN A;  2QJ8 A;  4AB7 A;  2PR1 A;  4YRH A;  3VAT A;  3WC6 A;  1FNO A;  5THW A;  2P6F A;  1XMB A;  4JGK A;  1PUA A;  2XEF A;  2V8D A;  4L89 A;  1VHU A;  3B3S A;  2PIZ A;  5CBM A;  4H2K A;  3GKR A;  1YW4 A;  1I1D A;  4MFZ A;  2Z11 A;  2DX6 A;  3Q6Z A;  2F8H A;  2ZEO A;  3GQO A;  1ZG7 A;  5F46 A;  2OZH A;  1M4I A;  4ZGY B;  1PCA A;  3EWO A;  3RAM A;  3D7F A;  2FSR A;  3R1K A;  1XE4 A;  5FSU A;  1DE4 C;  2FT0 A;  3D68 A;  3G3S A;  1LAP A;  3EJG A;  4GS4 A;  4UEE A;  2ABZ A;  4MFL A;  4QVT A;  3D4U A;  2PJB A;  2Q4V A;  3EY5 A;  2G0B A;  3ISX A;  1CPS A;  2I79 A;  2Z10 A;  4KOR A;  2OR4 A;  4NGQ A;  2Q4Z A;  4A33 A;  3SJX A;  3S6G A;  4EWT A;  2O53 A;  1BLL E;  5ELY A;  1GHE A;  1TXR A;  1ZR5 A;  2VZY A;  1A2Z A;  2AFZ A;  2AFM A;  3KHZ A;  1VHS A;  1Z5R A;  3FF3 A;  3BHX A;  3WC7 A;  2POK A;  3GIU A;  3V2B A;  1IYL A;  1ZG8 A;  3KR4 A;  1B87 A;  2XEG A;  5DWN A;  4CAE A;  3IWE A;  5FSY A;  2RNK A;  2ATR A;  2PVW A;  1BPN A;  5K8O A;  4FUU A;  1KUV A;  5HH1 A;  2H5M A;  4JCA A;  3FED A;  1ZLH A;  4KOU A;  2R1I A;  2PCU A;  3PP9 A;  2ZW4 A;  4JZ0 A;  4BD9 A;  3S6H A;  4C7H A;  3SIG A;  4UEZ A;  2ZXV A;  4H6U A;  4G1P A;  4OLL A;  4ESS A;  2CTB A;  3JVN A;  3V45 A;  3QAH A;  4FD7 A;  4DJL A;  4EME A;  3NH5 A;  1YLO A;  3H4Q A;  3CT9 A;  2P6G A;  5JGF A;  2PJ5 A;  1VHE A;  4KSF A;  5DWM A;  5KTA A;  3NH4 A;  5AG7 A;  4UWJ A;  4BMH A;  2FXK A;  4P4E A;  2PR8 A;  3NE8 A;  1IID A;  2K5T A;  3JTK A;  3NH8 A;  3EFA A;  2HC9 A;  2C27 A;  3D67 A;  1IYK A;  1Y9K A;  4IF5 A;  4OAE A;  3PBE A;  4ZBG A;  4A95 A;  3IEH A;  2KQV A;  3GPG A;  2BO9 A;  4Q36 A;  3BI0 A;  4L8A A;  4K3N A;  2Q4Y A;  4MHZ A;  2BOA A;  4B10 A;  1KUX A;  3IJ3 A;  5G1Z A;  3VWE A;  4OP4 A;  4B5P B;  1PYT B;  3GY9 A;  4KLV A;  1XMT A;  4KUA A;  4JLY A;  2Z3N A;  3OWC A;  4CAW A;  2YNE A;  2EWB A;  2REF A;  4C2X A;  5HMN A;  5E3B A;  1MJ9 A;  3S6F A;  3SHP A;  2OU2 A;  4NGP A;  1UWY A;  4B14 A;  1UFH A;  1YSJ A;  5G20 A;  4MCP A;  5AGE A;  2BUE A;  2GAN A;  1MJB A;  4TWE A;  4CYO A;  2V77 A;  5D8N A;  3EXN A;  2BCO A;  2X47 A;  2AFU A;  4ONU A;  4R87 A;  3E0K A;  2C6P A;  3CXS A;  2ZEF A;  3BJ7 A;  5GCN A;  3TO7 A;  3SJF A;  4R8F A;  2C6G A;  4XPD C;  5AIL A;  5HIH A;  2EO8 A;  4CGO A;  2G3T A;  2JZE A;  3VWD A;  5AG4 A;  4KS9 A;  4TNU A;  3B3C A;  1XFO A;  2Z3K A;  2OOT A;  3S6K A;  2JBJ A;  2VQY A;  4HNX B;  1CBX A;  5CPA A;  3EO4 A;  3PFO A;  4NGN A;  2DF5 A;  1M4D A;  1BPM A;  1DTD A;  1Z8W A;  5FVJ A;  1YLE A;  4DYO A;  3IO1 A;  4DUK A;  3FXT A;  4F6A A;  3QB8 A;  4ZI6 A;  1YR0 A;  3WAB A;  2Q0Y A;  4MRI A;  4ZX8 A;  2D4P A;  3LAC A;  5J1Q A;  4NFR A;  1LFW A;  2AFS A;  2ZPA A;  5H84 A;  1KWM A;  4OME A;  1QSR A;  3DR8 A;  1NSL A;  3ZZI A;  1TF9 A;  2PVV A;  3FB3 A;  4MI4 A;  3GPO A;  3CDX A;  4AVC A;  1NJR A;  3EWR A;  2PRQ A;  3TE4 A;  1XRY A;  3L2N A;  3K9U A;  4EFD A;  4B5P A;  3SJE A;  1S60 A;  1XIX A;  2NSM A;  3Q71 A;  2ZOG A;  4PSW A;  4E0A A;  1MK4 A;  2B3U A;  1S5K A;  1FY7 A;  2FIW A;  1L0C A;  2ARH A;  2F5I A;  2ZW5 A;  4NF1 A;  3UY5 A;  4E8O A;  1QSM A; 
#chains in the Genus database with same CATH homology
 3EKE A;  1Y7E A;  1LCP A;  5K8N A;  4WJB A;  5CB5 A;  1CG2 A;  2NYQ A;  4NGS A;  5DUS A;  2CIJ A;  4MXU A;  2PJ2 A;  3IIF A;  4PXE A;  2ZEP A;  3WT4 A;  4RUH A;  3MRU A;  1HEE A;  1LOK A;  5FSZ A;  3IID A;  3SI2 A;  3S9M A;  2PE3 A;  1RTQ A;  2WZN A;  1BAV A;  4MCR A;  4D86 A;  4ABK A;  4MHN A;  1FT7 A;  4ETJ A;  4A38 A;  3SIJ A;  1Y0Y A;  1TY8 A;  2PJA A;  4JVV A;  5CB3 A;  2ZEM A;  1HDU A;  3S9L A;  4MCS A;  4OC5 A;  3KGQ A;  4PQA A;  4P45 A;  2AFW A;  3BXM A;  4X2T A;  5HXD A;  1R43 A;  4UF4 A;  2AFC A;  3KHX A;  3FMC A;  4P4D A;  2RB7 A;  2ZOF A;  5FSX A;  3GLJ A;  3EJF A;  4JYW A;  3NFZ A;  2V8V A;  4IAV A;  2GLJ A;  4YWY A;  3IC1 A;  3DLJ A;  3WC5 A;  8CPA A;  3KR5 A;  4MMO A;  5JH9 A;  2ZEE A;  1TF8 A;  1VGY A;  1ZLI A;  4MCQ A;  1IY7 A;  4ABL A;  1HJZ A;  3BI1 A;  1ELM P;  3KL9 A;  1NSA A;  4X3R A;  4R7M A;  3LMS A;  5HVH A;  5JGF A;  1CP6 A;  4IQY A;  2ANP A;  1M4L A;  2Q51 A;  2FAV A;  4ETK A;  3FX6 A;  4P6Y A;  4ZY1 A;  3VH9 A;  4P4F A;  3VAR A;  4GUA A;  4P44 A;  2XEJ A;  1Z8L A;  2V8H A;  2ZEG A;  4O23 A;  5LYL A;  4MHP A;  3S9N A;  3JRU A;  4X8I A;  1YME A;  4A39 A;  4Q7A A;  3RZA A;  2ZEH A;  5LYF A;  3K9T A;  1TXZ A;  1ARL A;  5K8M A;  1VHO A;  2L8R A;  3N5F A;  1CP7 A;  2PJ7 A;  2JEW A;  4LQG A;  1TKH A;  5LYI A;  5IB9 A;  4R6T A;  4AXV A;  3HLP A;  3V7Z A;  3D7D A;  3PB9 X;  3PFE A;  2FG1 A;  2ACF A;  2EK9 A;  3KI9 A;  3PB8 X;  3PRT A;  2PJC A;  3HUV A;  1F57 A;  1XBU A;  2PJ8 A;  4P4J A;  1YD9 A;  1TKF A;  2IMO A;  2EK8 A;  4P4I A;  2QYV A;  2JBK A;  1Y0R A;  2Q43 A;  4ZY2 A;  4ZY0 A;  2G9D A;  3JZT A;  1JQG A;  2C1C A;  1ARM A;  4FBE A;  4UML A;  5HVF A;  3GPQ A;  2C6C A;  4F9V A;  7CPA A;  3EW5 A;  1R3N A;  2ZED A;  1Z2L A;  3GUX A;  4A94 A;  4UIA A;  1IGB A;  1OBR A;  4GVW A;  4YU9 A;  3D7G A;  2DEA A;  2O4H A;  4ZX9 A;  1QQ9 A;  3SI0 A;  5I4M A;  3PEI A;  2PJ9 A;  1SPV A;  4JLL A;  2J9A A;  4J5S A;  2IJZ A;  5LYD A;  1F2P A;  2PJ3 A;  3FJU A;  3FVL A;  4OC3 A;  1CX8 A;  2BFR A;  2PJ0 A;  2I3C A;  3FH4 A;  5LRJ A;  3H8E A;  1AYE A;  2HB6 A;  4J4Z A;  3QNV A;  3SIH A;  4UEF A;  3EWP A;  3PBB A;  2PJ1 A;  3ISZ A;  4F8Z A;  4J5Q A;  4Z65 A;  4F9U A;  3GQE A;  4P10 A;  3GB0 A;  4FWU A;  1YW6 A;  3CPA A;  4B6Z A;  4OC1 A;  1TKJ A;  3CPX A;  3T8W A;  3MN8 A;  3KAS A;  2RFH A;  4NGT A;  1Q7L A;  3IFE A;  1CPX A;  4OKO A;  1LAN A;  4MHY A;  3K2K A;  3KZW A;  4NJQ A;  4OIW A;  4OC2 A;  1ELL P;  3B35 A;  4PXC A;  4GM5 A;  2CF4 A;  3PB6 X;  2QVP A;  1XJO A;  3TX8 A;  4NJR A;  4CPA A;  5HVG A;  4FAI A;  4OC0 A;  5F09 A;  3FEC A;  3TC8 A;  5FSV A;  1AMP A;  3ETI A;  2EEE A;  2GLF A;  3KQX A;  3B3W A;  3RBU A;  4OID A;  1HDQ A;  4NGM A;  3DGV A;  2CTC A;  1EE3 P;  1F2O A;  2GU2 A;  1QMU A;  2V8G A;  1H8L A;  5LRK A;  5CMS A;  2BFQ A;  6CPA A;  2ZEL A;  3IWW A;  4KSI A;  3EWQ A;  5D29 A;  2AFO A;  4TU0 A;  5HOL A;  2XD7 A;  4GVV A;  4KYB A;  3VFQ A;  4P4B A;  3V38 A;  4WWV A;  4A37 A;  3B2Y A;  2GRE A;  2ZEN A;  4UIB A;  3PB7 X;  4NGR A;  3FEE A;  1ZG9 A;  5K8P A;  2PJ4 A;  4W9Y A;  4ZYQ A;  2AFX A;  4OC4 A;  3SI1 A;  5DS0 A;  3NA6 A;  3KQZ A;  3B3T A;  3H8G A;  1LAM A;  2IQ6 A;  3SII A;  4K0C A;  2WYR A;  3D66 A;  4IHM A;  2VRI A;  4J5R A;  2F7V A;  4IK2 A;  2XEI A;  5JM6 A;  5LRG A;  2PJ6 A;  2PIY A;  1VIX A;  3B7I A;  3PB4 X;  4ONW A;  4R76 A;  4PPZ A;  2FVG A;  3IIB A;  4PXD A;  4PXB A;  3LWU A;  3D7H A;  1ZR3 A;  2VL1 A;  3B3V A;  2LGR A;  1GYT A;  3H8F A;  3I1U A;  2QJ8 A;  3VAT A;  3WC6 A;  1FNO A;  5THW A;  1XMB A;  4JGK A;  2XEF A;  2V8D A;  1VHU A;  3B3S A;  2PIZ A;  5CBM A;  4H2K A;  1YW4 A;  2DX6 A;  3Q6Z A;  2F8H A;  2ZEO A;  3GQO A;  1ZG7 A;  1PCA A;  3EWO A;  3RAM A;  3D7F A;  5FSU A;  1DE4 C;  3D68 A;  4UEE A;  1LAP A;  3EJG A;  2ABZ A;  3WAB A;  3D4U A;  2PJB A;  3ISX A;  1CPS A;  4NGQ A;  2OR4 A;  2Q4Z A;  3SJX A;  4EWT A;  2O53 A;  1BLL E;  5ELY A;  1TXR A;  1ZR5 A;  2AFZ A;  2AFM A;  3KHZ A;  1Z5R A;  3FF3 A;  3BHX A;  3WC7 A;  2POK A;  3V2B A;  1ZG8 A;  3KR4 A;  2XEG A;  5FSY A;  2PVW A;  1BPN A;  5K8O A;  4FUU A;  4JCA A;  3FED A;  1ZLH A;  2PCU A;  4JZ0 A;  4BD9 A;  3SIG A;  4UEZ A;  4G1P A;  4ESS A;  2CTB A;  3V45 A;  4DJL A;  4EME A;  3NH5 A;  1YLO A;  3CT9 A;  2PJ5 A;  1VHE A;  3NH4 A;  2FXK A;  4P4E A;  3NH8 A;  2HC9 A;  3D67 A;  3PBE A;  3IEH A;  3GPG A;  2BO9 A;  3BI0 A;  4MHZ A;  4K3N A;  2BOA A;  3IJ3 A;  4OP4 A;  1PYT B;  2EWB A;  5E3B A;  4NGP A;  1UWY A;  1YSJ A;  4MCP A;  4TWE A;  2V77 A;  5D8N A;  2BCO A;  2X47 A;  2AFU A;  2C6P A;  2ZEF A;  3SJF A;  4R8F A;  2C6G A;  5AIL A;  5HIH A;  4TNU A;  3B3C A;  1XFO A;  2OOT A;  3SJG A;  2JBJ A;  1CBX A;  5CPA A;  3PFO A;  4NGN A;  1BPM A;  1DTD A;  4DYO A;  3IO1 A;  4DUK A;  4ZI6 A;  5J1Q A;  4MRI A;  4ZX8 A;  4NFR A;  1LFW A;  2AFS A;  1KWM A;  4OME A;  1TF9 A;  2PVV A;  3GPO A;  3CDX A;  1NJR A;  3EWR A;  2PRQ A;  1XRY A;  3L2N A;  4EFD A;  3SJE A;  2NSM A;  2ZOG A;  3Q71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...