1LAPA

Molecular structure of leucine aminopeptidase at 2.7-angstroms resolution
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
484
structure length
481
Chain Sequence
TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular structure of leucine aminopeptidase at 2.7-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
molecule keywords Cytosol aminopeptidase
total genus 154
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1990-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lapA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lapA02
5K8NA 4ZX8A 3IIDA 5K8PA 4X2TA 4JLLA 3PB8X 3GPOA 2I3CA 4K0CA 2QJ8A 3IJ3A 4P4DA 1Q7LA 3WABA 4R76A 2HC9A 2PJ5A 2NYQA 4OP4A 3PBEA 3H8FA 1ELMP 4MRIA 4MCPA 4MHPA 1TF8A 2PJ9A 2ZOGA 3RAMA 2AFOA 3KGQA 1NSAA 4A37A 1LAMA 2AFXA 4P6YA 1LAPA 4KSIA 2PJ8A 2QYVA 1ARMA 4MHNA 4IK2A 2IQ6A 1DTDA 3GPQA 4OC3A 1ZR3A 4ONWA 1F57A 4MCQA 3LMSA 5LRJA 3FEEA 5ELYA 3SIGA 3SIJA 1YSJA 4PXDA 1HDUA 5K8MA 4A39A 4ABKA 3ISXA 2ZEFA 4P4BA 3D67A 3L2NA 4ZX9A 1TF9A 3GUXA 3H8GA 4NGPA 3GQOA 3RZAA 1VHOA 3SJGA 2BO9A 3B3SA 3GB0A 3CDXA 4R8FA 2O4HA 3BI0A 4X8IA 5JM6A 5FSYA 4IHMA 1CG2A 4DJLA 3D4UA 4ETKA 5LYDA 2BOAA 5E3BA 1XFOA 5FSZA 8CPAA 3LWUA 4DYOA 4ZY2A 1QQ9A 2PJ7A 4P4JA 3HLPA 3V2BA 2XD7A 1ZLHA 2ACFA 5HVGA 2ZEHA 1JQGA 2PJ6A 3T8WA 1CBXA 5K8OA 3QNVA 4OMEA 2OOTA 3IWWA 5HOLA 2G9DA 2Q4ZA 1FNOA 1FT7A 5LRKA 1CX8A 1Y7EA 4K3NA 3SI0A 4PXEA 4UMLA 1TY8A 1YMEA 1CPXA 1LOKA 2Q43A 3RBUA 2PJBA 4CPAA 2PCUA 2AFCA 2GLFA 2GLJA 2ZELA 3PB7X 2PJ3A 2ZOFA 4MHYA 3SJEA 3FJUA 5CMSA 4R6TA 4ZI6A 1DE4C 1F2PA 1TKHA 1XRYA 3WT4A 4EMEA 3PB4X 2VL1A 1PYTB 3KR5A 4R7MA 2ZEGA 2EK8A 3KQXA 2AFZA 1Y0RA 4J5QA 4BD9A 1H8LA 1LANA 4Z65A 3D7DA 3PB6X 4LQGA 4J4ZA 4WJBA 4GUAA 3IEHA 1F2OA 3GLJA 4NFRA 3S9MA 1BPMA 4P4FA 2ANPA 2CTBA 5JGFA 1HDQA 4TWEA 4NGQA 5D8NA 2JEWA 4H2KA 3JZTA 1YLOA 4GVVA 2VRIA 5LYFA 1YW4A 3BXMA 1HEEA 3B3VA 2V8DA 5LYLA 3FECA 2ZENA 1LFWA 2O53A 3D66A 3S9LA 4NGTA 3SJFA 4EWTA 4ZYQA 4YU9A 1CPSA 4P45A 5DS0A 1TKFA 1PCAA 3BI1A 4OC0A 3FMCA 2PIYA 3SIIA 4OC1A 4ZY0A 1KWMA 3NH5A 4X3RA 1LCPA 4NJQA 2C6CA 2CF4A 3D7GA 3VFQA 5HVFA 2PE3A 4JCAA 2X47A 2POKA 2PRQA 3FX6A 3B3TA 3WC7A 4A38A 2DX6A 4FAIA 7CPAA 2V77A 2CTCA 1AYEA 5F09A 4UEEA 2PJCA 3IFEA 4ESSA 3FH4A 4NJRA 3SJXA 1VHEA 4NGNA 3PB9X 2OR4A 3FVLA 3IIBA 4JGKA 4IAVA 3EJFA 1VIXA 4EFDA 5DUSA 4ETJA 3FEDA 2QVPA 4MCRA 4PPZA 1HJZA 4OC4A 3B7IA 3VARA 3GPGA 3CPXA 4G1PA 3KASA 3Q71A 5FSUA 2WZNA 3H8EA 5CPAA 5FSXA 4W9YA 2FXKA 1IGBA 4UIBA 3K2KA 5FSVA 3D68A 1IY7A 2V8HA 1R3NA 2DEAA 1CP7A 2C6PA 2GREA 3IO1A 2IMOA 3EWQA 3BHXA 3K9TA 3ETIA 4GVWA 2AFSA 1Y0YA 1CP6A 4GM5A 4MHZA 4JYWA 1XMBA 1VHUA 4P44A 4JVVA 1ZR5A 2WYRA 2FVGA 1BAVA 1NJRA 3B35A 2XEIA 1GYTA 2C1CA 1ZG7A 4MMOA 2AFUA 4A94A 2EEEA 3B2YA 2ZEOA 5THWA 3TC8A 4F9UA 3KHXA 4D86A 4NGMA 3DLJA 3KL9A 4OC5A 5HXDA 1BPNA 3MN8A 4F8ZA 1OBRA 4P4EA 3D7HA 1TXRA 3WC6A 4IQYA 2ZEPA 1M4LA 3VATA 4UF4A 3GQEA 3KQZA 1TKJA 3PBBA 4NGRA 5I4MA 5JH9A 3N5FA 4DUKA 3NFZA 3EJGA 2C6GA 1ZLIA 1XBUA 2V8GA 3NH4A 3V45A 2XEGA 2PJAA 2NSMA 1YD9A 4WWVA 1Z2LA 3EKEA 3JRUA 3MRUA 2PIZA 1Z5RA 4OIWA 4NGSA 4UIAA 2PVVA 4MXUA 4P10A 3PFEA 2EWBA 2PJ2A 4FBEA 3EW5A 2V8VA 2JBJA 2IJZA 3CPAA 2PJ1A 4JZ0A 2ZEEA 2ZEDA 3I1UA 3PEIA 1TXZA 1RTQA 2PJ4A 5J1QA 1ZG9A 2GU2A 2FG1A 2BCOA 3IIFA 3D7FA 4OIDA 4O23A 2RFHA 5HIHA 4KYBA 4RUHA 4UEFA 3SI2A 1VGYA 2LGRA 4TNUA 1AMPA 1ZG8A 1XJOA 5CB3A 3VH9A 1Z8LA 2CIJA 3EWOA 1UWYA 4OC2A 4FUUA 5LRGA 2EK9A 3HUVA 3EWRA 4FWUA 4Q7AA 2J9AA 3KZWA 1EE3P 2XEFA 5HVHA 5LYIA 3B3WA 3NA6A 3V7ZA 3SIHA 6CPAA 1QMUA 4ABLA 2BFRA 3KHZA 2AFMA 3KI9A 4B6ZA 4J5SA 2FAVA 2L8RA 4AXVA 4ZY1A 4PXCA 1BLLE 3DGVA 4YWYA 5D29A 1R43A 3CT9A 2ZEMA 2RB7A 5IB9A 3IC1A 4OKOA 5CBMA 2BFQA 2AFWA 4TU0A 2ABZA 3NH8A 4J5RA 3TX8A 3Q6ZA 3KR4A 2F8HA 4MCSA 1ELLP 2PVWA 4PQAA 4PXBA 3PFOA 4F9VA 2Q51A 4UEZA 1YW6A 4P4IA 3WC5A 2JBKA 3S9NA 2PJ0A 1ARLA 3V38A 3ISZA 3PRTA 5CB5A 2XEJA 2HB6A 5AILA 2F7VA 3EWPA 3FF3A 3SI1A 3B3CA 1SPVA
chains in the Genus database with same CATH superfamily
3EO4A 5K8NA 4ZX8A 3IIDA 2BL1A 5K8PA 4X2TA 4JLLA 3GYAA 3PB8X 3GPOA 2I3CA 2FS5A 4K0CA 4CAXA 2QJ8A 3IJ3A 4CGNA 4P4DA 1Q7LA 1V0CA 3TO6A 4R76A 3WABA 4CAEA 2HC9A 2PJ5A 1Z4RA 2NYQA 3DSBA 2H5MA 2OB0A 2R7HA 3PBEA 3H8FA 4OP4A 1ELMP 4C7IA 4GXHA 2VZZA 4MRIA 4MCPA 4MHPA 1NE9A 1X10A 1TF8A 2PJ9A 4JD6A 3R9GA 2ZOGA 4K30A 4XPLA 3RAMA 1IIDA 2AFOA 1X12A 3FIXA 4PV6A 3KGQA 5KTAA 1NSAA 2D4OA 4JJXA 1S7FA 4A37A 4FD7A 1M4GA 5FVJA 3E0KA 2DPTA 1LAMA 4KOVA 2AFXA 2BEIA 4P6YA 1LAPA 4KSIA 2PJ8A 2QYVA 1ARMA 4MHNA 4H89A 4IK2A 1XOVA 4UWJA 4U9YA 2IQ6A 1DTDA 3GPQA 1ZO0A 2B4DB 3VWEA 2J8NA 4OC3A 1ZR3A 4ONWA 1YLEA 2R8VA 1F57A 2HUZA 4XPKA 5AGEA 3WR7A 4MCQA 1RO5A 3LMSA 5CNPA 4MFQA 2BSWA 3K9UA 5LRJA 3SXNA 3FEEA 5ELYA 3SIGA 3SIJA 1MK4A 1YSJA 4E0AA 4PXDA 4JXRA 3ZZIA 2DF5A 1HDUA 3LACA 2PC1A 4L8AA 4A39A 5K8MA 4ABKA 3ISXA 1XF8A 2ZEFA 4P4BA 3H5ZA 2Z3MA 3S6HA 3D67A 4JLYA 3L2NA 4KUBA 4UCNA 4ZX9A 1KUYA 1S7NA 1OZPA 4CGOA 1TF9A 1XIXA 3GUXA 3H8GA 3FYNA 1S5KA 4NGPA 3GQOA 4MHDA 1VHOA 1FY7A 2B4BA 2PSWA 3RZAA 3SJGA 3TTHA 4B5PA 2JDCA 2OU2A 2BO9A 3B3SA 3GB0A 4J3GA 1AUGA 3CDXA 3FNCA 3TO9A 1SQHA 4R8FA 2VXKA 1Y9WA 3B8GA 2AJ6A 4PK3A 1QSRA 2ZW7A 5J8CA 2O4HA 3BI0A 1Q2CA 4X8IA 5A28A 2FL4A 5FSYA 4IHMA 5JM6A 1CG2A 1CM0A 4DJLA 1CJWA 4CRYB 3D4UA 2JLMA 5J8FA 4ETKA 3I9SA 1NMTA 5LYDA 4XNHC 1I1DA 4OADA 3EFAA 2BOAA 5E3BA 1XFOA 3DR6A 5FSZA 8CPAA 2Q44A 3LWUA 4DYOA 2Z3LA 4ZY2A 1QQ9A 2PJ7A 4P4JA 3HLPA 3V2BA 2XD7A 1ZLHA 2ACFA 2Z3KA 3C26A 4MFLA 4MI4A 4KORA 4C7HA 2ZEHA 5HVGA 2ODFA 1JQGA 1Z8TA 4A31A 2PJ6A 3T8WA 1CBXA 2Z3PA 1MJAA 4CPAA 3QB8A 5K8OA 1I12A 2VEZA 3QNVA 4OMEA 5EMIA 2OOTA 2GE3A 3I3GA 5HOLA 3IWWA 2G9DA 4QBJA 2Q4ZA 1FNOA 2PDOA 1PU9A 1FT7A 4B5OA 5LRKA 1Z9UA 1CX8A 2FXFA 1Y7EA 4FD6A 5DWMA 4MBUA 4K3NA 4XPDB 3R1KA 3SI0A 4PXEA 4C2YA 3BLNA 4UMLA 1TY8A 2P6GA 1YMEA 2Q7SA 4XNHB 3TO7A 1CPXA 1LOKA 1B87A 2G3AA 2Q43A 3R9EA 3RBUA 2JZEA 2PJBA 2PCUA 2AFCA 2GLFA 2GLJA 2ZELA 3GY9A 2PJ3A 2Z11A 3PB7X 2ZOFA 4MHYA 3SJEA 2CNMA 1S3ZA 4UCPA 3FJUA 2GANA 5CMSA 4R6TA 4ZI6A 1DE4C 1F2PA 1TKHA 1XRYA 3WT4A 2WPXA 4EMEA 3PB4X 1B6BA 1YX0A 1YK3A 1PYTB 2VL1A 3KR5A 4R7MA 4QVTA 2ZEGA 2EK8A 4NF1A 3KQXA 2AFZA 1Y0RA 4J5QA 1J4JA 1H8LA 1LANA 3QAHA 4R3KA 4BD9A 4Z65A 4MFJA 4MFKA 3D7DA 5IB0A 3PB6X 2VI7A 4J4ZA 4LQGA 4GUAA 4R9MA 4WJBA 3IEHA 2Z10A 1F2OA 3GLJA 4NFRA 3S9MA 1BPMA 4P4FA 2ANPA 2B58A 2CTBA 4R57A 5JGFA 1HDQA 4ZBGA 3IGRA 4TWEA 4NGQA 5D8NA 2W2GA 2JEWA 4H2KA 3JZTA 1YLOA 1Z8WA 4CYOA 4GVVA 2VRIA 2GIVA 5G20A 5LYFA 1YW4A 1P0HA 4KZTA 3BXMA 1HEEA 3B3VA 4H6UA 2Q0YA 2V8DA 1KUVA 5LYLA 5G21A 1U6MA 3FECA 2ZENA 4QUSA 5F47A 2Q7BA 4DNCA 1Z8XA 1LFWA 2O53A 3D66A 2BUEA 3FBUA 4NGTA 3S9LA 3MGDA 5HMNA 2P0WA 3SJFA 4MJ8A 1M1DA 1Q2YA 4F0YA 4EWTA 5IX3A 4ZYQA 4YU9A 1CPSA 4KOWA 5E96A 3G8WA 4P45A 5AG7A 5DS0A 2IL4A 1TKFA 1PCAA 3H4QA 3BI1A 4OC0A 3FMCA 2PIYA 3SIIA 4OC1A 4ZY0A 3FB3A 4RN7A 2KCWA 1YR0A 1KWMA 3CXSA 3NH5A 4QB9A 4F0XA 4X3RA 5G22A 1LCPA 2B4DA 4NJQA 2C6CA 1QSMA 1P4NA 2FIAA 3D8PA 2J8MA 2CF4A 5GCNA 3D7GA 3VFQA 5HVFA 2PE3A 2YNCC 1Y9KA 4JCAA 1N71A 2X47A 2POKA 2PRQA 3FX6A 1ON0A 3B3TA 3GKRA 2Z3NA 3T90A 3WC7A 2OZGA 4A38A 2DX6A 1K4JA 4FAIA 7CPAA 2V77A 1S7KA 2CTCA 1AYEA 5F09A 4UEEA 2PJCA 3IFEA 2YNDA 5C82A 5IV0A 4ESSA 3FH4A 5H84A 4NJRA 3SJXA 3TT2A 1VHEA 2F5IA 2WSAA 4NGNA 3ZJ0A 4CRZB 4IUSA 3PB9X 2OR4A 4UFWA 3FVLA 4JXQA 4CYNA 4LX9A 4YRHA 2CY2A 2RC4A 1S7LA 3IIBA 4JGKA 3IWEA 4XPDC 4E2AA 4EVYA 4IAVA 3EJFA 2EO8A 3IU2A 3PZJA 4M3SA 4UWIA 1VIXA 4EFDA 4HNYB 4B11A 2B3VA 1VKCA 5DUSA 4ETJA 1XEBA 2OH1A 3FEDA 4HNXB 2Z3OA 2QVPA 4M6HA 4U9ZA 4MCRA 4PPZA 1HJZA 4OC4A 3B7IA 3VARA 4UBRA 3GPGA 3FXTA 2G0BA 2QIRA 3CPXA 4G1PA 3D2MA 3KASA 4KOYA 3DDDA 4R87A 2PQ8A 3LODA 2HV2A 4HKFA 4Q36A 3Q71A 5FSUA 4QC6A 4UFVA 2WZNA 3H8EA 5A27A 5CPAA 2X7BA 4C2XA 4ORFA 5FSXA 4CGLA 4HNWB 4W9YA 4Q38A 2FXKA 1KZFA 4NEXA 2ZW5A 1IGBA 2P6EA 2Q4YA 3EC4A 4UIBA 3K2KA 4A32A 4PK2A 5FSVA 2PR1A 3RO0A 3D68A 3P2HA 3CZXA 1IY7A 3LD2A 2V8HA 5AG5A 1R3NA 4OAEA 2DEAA 1CP7A 2C6PA 2GREA 3IO1A 2IMOA 1IICA 2ATRA 3EWQA 3PP9A 4CYPA 2Y0MA 4M6GA 4U5YA 3JVNA 2JDDA 3BHXA 3K9TA 4A2ZA 1RXTA 3ETIA 4GVWA 2AFSA 4FD4A 2R98A 1Y0YA 2CXAA 2VBQA 1CP6A 4GM5A 1MJ9A 4KOXA 4AG9A 3W91A 4AVBA 2D4PA 4MHZA 4JYWA 5C88A 1XMBA 1VHUA 3EY5A 1A2ZA 4P44A 2QECA 4C2ZA 4JVVA 1ZR5A 2CNTA 2WYRA 2FVGA 2YGWA 1BAVA 1NJRA 1WK4A 3BJ8A 1KUXA 4B13A 3B35A 3RYOA 4B12A 2XEIA 2O28A 4IF5A 1GYTA 2C1CA 1ZG7A 2ARHA 5KTCA 4MMOA 2AFUA 4A94A 2I00A 2EEEA 3B2YA 3FRMA 4MFPA 4MY3A 1M4DA 1S60A 2B3UA 2ZEOA 5THWA 1NSLA 3TC8A 4BMHA 4F9UA 3KHXA 4D86A 3N7ZA 4JWPA 4NGMA 2PRBA 3DLJA 3KL9A 2EBJA 1IOIA 4CAWA 4C68A 4OC5A 1Q2DA 3S6KA 5HXDA 4A95A 3R9FA 1BPNA 3MN8A 4F8ZA 1IB1E 2REEA 5KTDA 2EUIA 1OBRA 4P4EA 3D7HA 1TXRA 2DXQA 5F46A 3WC6A 1QSOA 2HQYA 5EBVA 4IQYA 2Q4VA 3CXPA 2ZEPA 3DR8A 3G3SA 1M4LA 3VATA 4UF4A 3GIUA 3GQEA 3KQZA 2QMLA 4CYQA 1TKJA 2P6FA 2WPWA 3PBBA 4A33A 2YNCA 1IU8A 4NGRA 4OLLA 1BO4A 3F0AA 1UFHA 5I4MA 1IOFA 5JH9A 3N5FA 4DUKA 2Z0ZA 3F5BA 4MY0A 3NFZA 3EJGA 4KLWA 5HH1A 2C6GA 5ISVA 5JPHA 1IYLA 4PSXA 4KLVA 3S6FA 1ZLIA 3IWGA 4KVXA 1XBUA 2V8GA 4B10A 3NH4A 3V45A 2XEGA 2PJAA 4X5KA 5G1ZA 4A30A 2NSMA 1YD9A 4WWVA 3S6GA 3JUWA 1Z2LA 2JEVA 4AVAA 3F8KA 3OWCA 2YNEA 1QSTA 4HPSA 4AVCA 1YVKA 2OZUA 3EKEA 3JRUA 3MRUA 1XE4A 1VHSA 4NCZA 2RNKA 2FCKA 2PIZA 3W6SA 1Z5RA 5AG4A 4OIWA 5JQ4A 4NGSA 3JTKA 4UIAA 2PVVA 4MXUA 4P10A 3PFEA 2EWBA 2PJ2A 3KKWA 4UCMA 1YQEA 3EW5A 4MFZA 3NE7A 3V8IA 2V8VA 4NXYA 4FBEA 2JBJA 2IJZA 3CPAA 2PJ1A 3D3SA 4H6ZA 4JZ0A 2ZEEA 4UFXA 2ZEDA 3I1UA 4CAVA 3PEIA 1TXZA 3TE4A 1RTQA 2PJ4A 3T9YA 2FT0A 5J1QA 1ZG9A 4Y49B 2GU2A 2FG1A 2BCOA 2R1IA 3IIFA 3UY5A 3RNZA 2VQYA 3D7FA 4OIDA 4O23A 2REFA 5HIHA 1GHEA 4KYBA 2RFHA 4E8OA 4RUHA 4UEFA 3SI2A 1VGYA 1TIQA 4KSFA 2LGRA 3EXNA 4TNUA 5BWAB 1AMPA 2JZFA 1XJOA 2KQVA 5CB3A 1ZG8A 1Z8LA 2CIJA 4M6IA 3DNSA 3EWOA 3R95A 3SHPA 3VH9A 1UWYA 3A9LA 4OC2A 4FUUA 3R96A 5I0CA 5AG6A 4F6AA 5LRGA 4FD5A 1I21A 2EK9A 3TFYA 3HUVA 3EWRA 5F49A 4YFJA 3P2FA 4BBHA 4GS4A 4FWUA 2I79A 4LUAA 3TOBA 4Q7AA 2J9AA 2ZXVA 3KZWA 1EE3P 1QSNA 3QAYA 4CAFA 2XEFA 1JWQA 5HVHA 2JZDA 2FIWA 3CXQA 4II9A 4CGPA 1IYKA 5LYIA 3SXOA 3B3WA 4B14A 1M44A 3BJ7A 1Y7RA 3NA6A 5DWNA 3SIHA 3V7ZA 3VWDA 4B5PB 1QMUA 3IU1A 6CPAA 4ABLA 2BFRA 3KHZA 1YREA 4L89A 3TCVA 2AFMA 3KI9A 3PGPA 3NE8A 4B6ZA 4J5SA 2FAVA 2L8RA 1PUAA 4RI1A 1YVOA 4AXVA 1YGHA 4ZY1A 1XMTA 2FE7A 4PXCA 1BLLE 3DGVA 4YWYA 2VZYA 5D29A 1R43A 3CT9A 2EVNA 2PR8A 2WCTA 1MJBA 2ZEMA 2RB7A 2GFQA 4KOSA 4KOUA 4CGMA 3IC1A 4OKOA 5CBMA 2BFQA 4YGOA 3W6XA 5IB9A 2A4NA 4R3LA 4LQ6A 2AFWA 4TU0A 2ABZA 3NH8A 5F48A 1L0CA 1WWZA 4J5RA 3TX8A 2OZHA 4ZGYB 3Q6ZA 3KR4A 4AG7A 2F8HA 4I49A 4MCSA 4KUAA 1ELLP 2PVWA 2ZW6A 4KVME 2K5TA 4PQAA 3PFOA 4PXBA 4M85A 3TOAA 4F9VA 4ONUA 2Q51A 2WUUA 4RS2A 2C27A 4UEZA 2ZPAA 1YW6A 4P4IA 3WC5A 4BINA 2JBKA 4Y49C 4UA3A 1BOBA 3D2PA 4KS9A 3S9NA 2ZW4A 2PJ0A 1ARLA 2AE6A 3ISZA 3PRTA 3V38A 5EC4A 1R57A 2DPSA 5CB5A 2B5GA 4PSWA 2G3TA 2XEJA 4CS0B 2HB6A 5AILA 2F7VA 3EWPA 2FSRA 3FF3A 2B5GB 2J8RA 2NMTA 4AB7A 1M4IA 1Z4EA 4KVOE 3SI1A 5H86A 1LRZA 4KSAA 2Q04A 2CNSA 3B3CA 4NSQA 4KOTA 1SPVA
chains in the Genus database with same CATH topology
5K8NA 4ZX8A 3IIDA 5K8PA 4X2TA 4JLLA 3PB8X 3GPOA 2I3CA 4K0CA 2QJ8A 3IJ3A 4P4DA 1Q7LA 3WABA 4R76A 2HC9A 2PJ5A 2NYQA 4OP4A 3PBEA 3H8FA 1ELMP 4MRIA 4MCPA 4MHPA 1TF8A 2PJ9A 2ZOGA 3RAMA 2AFOA 3KGQA 1NSAA 4A37A 1LAMA 2AFXA 4P6YA 1LAPA 4KSIA 2PJ8A 2QYVA 1ARMA 4MHNA 4IK2A 2IQ6A 1DTDA 3GPQA 4OC3A 1ZR3A 4ONWA 1F57A 4MCQA 3LMSA 5LRJA 3FEEA 5ELYA 3SIGA 3SIJA 1YSJA 4PXDA 1HDUA 5K8MA 4A39A 4ABKA 3ISXA 2ZEFA 4P4BA 3D67A 3L2NA 4ZX9A 1TF9A 3GUXA 3H8GA 4NGPA 3GQOA 3RZAA 1VHOA 3SJGA 2BO9A 3B3SA 3GB0A 3CDXA 4R8FA 2O4HA 3BI0A 4X8IA 5JM6A 5FSYA 4IHMA 1CG2A 4DJLA 3D4UA 4ETKA 5LYDA 2BOAA 5E3BA 1XFOA 5FSZA 8CPAA 3LWUA 4DYOA 4ZY2A 1QQ9A 2PJ7A 4P4JA 3HLPA 3V2BA 2XD7A 1ZLHA 2ACFA 5HVGA 2ZEHA 1JQGA 2PJ6A 3T8WA 1CBXA 5K8OA 3QNVA 4OMEA 2OOTA 3IWWA 5HOLA 2G9DA 2Q4ZA 1FNOA 1FT7A 5LRKA 1CX8A 1Y7EA 4K3NA 3SI0A 4PXEA 4UMLA 1TY8A 1YMEA 1CPXA 1LOKA 2Q43A 3RBUA 2PJBA 4CPAA 2PCUA 2AFCA 2GLFA 2GLJA 2ZELA 3PB7X 2PJ3A 2ZOFA 4MHYA 3SJEA 3FJUA 5CMSA 4R6TA 4ZI6A 1DE4C 1F2PA 1TKHA 1XRYA 3WT4A 4EMEA 3PB4X 2VL1A 1PYTB 3KR5A 4R7MA 2ZEGA 2EK8A 3KQXA 2AFZA 1Y0RA 4J5QA 4BD9A 1H8LA 1LANA 4Z65A 3D7DA 3PB6X 4LQGA 4J4ZA 4WJBA 4GUAA 3IEHA 1F2OA 3GLJA 4NFRA 3S9MA 1BPMA 4P4FA 2ANPA 2CTBA 5JGFA 1HDQA 4TWEA 4NGQA 5D8NA 2JEWA 4H2KA 3JZTA 1YLOA 4GVVA 2VRIA 5LYFA 1YW4A 3BXMA 1HEEA 3B3VA 2V8DA 5LYLA 3FECA 2ZENA 1LFWA 2O53A 3D66A 3S9LA 4NGTA 3SJFA 4EWTA 4ZYQA 4YU9A 1CPSA 4P45A 5DS0A 1TKFA 1PCAA 3BI1A 4OC0A 3FMCA 2PIYA 3SIIA 4OC1A 4ZY0A 1KWMA 3NH5A 4X3RA 1LCPA 4NJQA 2C6CA 2CF4A 3D7GA 3VFQA 5HVFA 2PE3A 4JCAA 2X47A 2POKA 2PRQA 3FX6A 3B3TA 3WC7A 4A38A 2DX6A 4FAIA 7CPAA 2V77A 2CTCA 1AYEA 5F09A 4UEEA 2PJCA 3IFEA 4ESSA 3FH4A 4NJRA 3SJXA 1VHEA 4NGNA 3PB9X 2OR4A 3FVLA 3IIBA 4JGKA 4IAVA 3EJFA 1VIXA 4EFDA 5DUSA 4ETJA 3FEDA 2QVPA 4MCRA 4PPZA 1HJZA 4OC4A 3B7IA 3VARA 3GPGA 3CPXA 4G1PA 3KASA 3Q71A 5FSUA 2WZNA 3H8EA 5CPAA 5FSXA 4W9YA 2FXKA 1IGBA 4UIBA 3K2KA 5FSVA 3D68A 1IY7A 2V8HA 1R3NA 2DEAA 1CP7A 2C6PA 2GREA 3IO1A 2IMOA 3EWQA 3BHXA 3K9TA 3ETIA 4GVWA 2AFSA 1Y0YA 1CP6A 4GM5A 4MHZA 4JYWA 1XMBA 1VHUA 4P44A 4JVVA 1ZR5A 2WYRA 2FVGA 1BAVA 1NJRA 3B35A 2XEIA 1GYTA 2C1CA 1ZG7A 4MMOA 2AFUA 4A94A 2EEEA 3B2YA 2ZEOA 5THWA 3TC8A 4F9UA 3KHXA 4D86A 4NGMA 3DLJA 3KL9A 4OC5A 5HXDA 1BPNA 3MN8A 4F8ZA 1OBRA 4P4EA 3D7HA 1TXRA 3WC6A 4IQYA 2ZEPA 1M4LA 3VATA 4UF4A 3GQEA 3KQZA 1TKJA 3PBBA 4NGRA 5I4MA 5JH9A 3N5FA 4DUKA 3NFZA 3EJGA 2C6GA 1ZLIA 1XBUA 2V8GA 3NH4A 3V45A 2XEGA 2PJAA 2NSMA 1YD9A 4WWVA 1Z2LA 3EKEA 3JRUA 3MRUA 2PIZA 1Z5RA 4OIWA 4NGSA 4UIAA 2PVVA 4MXUA 4P10A 3PFEA 2EWBA 2PJ2A 4FBEA 3EW5A 2V8VA 2JBJA 2IJZA 3CPAA 2PJ1A 4JZ0A 2ZEEA 2ZEDA 3I1UA 3PEIA 1TXZA 1RTQA 2PJ4A 5J1QA 1ZG9A 2GU2A 2FG1A 2BCOA 3IIFA 3D7FA 4OIDA 4O23A 2RFHA 5HIHA 4KYBA 4RUHA 4UEFA 3SI2A 1VGYA 2LGRA 4TNUA 1AMPA 1ZG8A 1XJOA 5CB3A 3VH9A 1Z8LA 2CIJA 3EWOA 1UWYA 4OC2A 4FUUA 5LRGA 2EK9A 3HUVA 3EWRA 4FWUA 4Q7AA 2J9AA 3KZWA 1EE3P 2XEFA 5HVHA 5LYIA 3B3WA 3NA6A 3V7ZA 3SIHA 6CPAA 1QMUA 4ABLA 2BFRA 3KHZA 2AFMA 3KI9A 4B6ZA 4J5SA 2FAVA 2L8RA 4AXVA 4ZY1A 4PXCA 1BLLE 3DGVA 4YWYA 5D29A 1R43A 3CT9A 2ZEMA 2RB7A 5IB9A 3IC1A 4OKOA 5CBMA 2BFQA 2AFWA 4TU0A 2ABZA 3NH8A 4J5RA 3TX8A 3Q6ZA 3KR4A 2F8HA 4MCSA 1ELLP 2PVWA 4PQAA 4PXBA 3PFOA 4F9VA 2Q51A 4UEZA 1YW6A 4P4IA 3WC5A 2JBKA 3S9NA 2PJ0A 1ARLA 3V38A 3ISZA 3PRTA 5CB5A 2XEJA 2HB6A 5AILA 2F7VA 3EWPA 3FF3A 3SI1A 3B3CA 1SPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K8N A;  4ZX8 A;  3IID A;  5K8P A;  4X2T A;  4JLL A;  3PB8 X;  3GPO A;  2I3C A;  4K0C A;  2QJ8 A;  3IJ3 A;  4P4D A;  1Q7L A;  3WAB A;  4R76 A;  2HC9 A;  2PJ5 A;  2NYQ A;  4OP4 A;  3PBE A;  3H8F A;  1ELM P;  4MRI A;  4MCP A;  4MHP A;  1TF8 A;  2PJ9 A;  2ZOG A;  3RAM A;  2AFO A;  3KGQ A;  1NSA A;  4A37 A;  1LAM A;  2AFX A;  4P6Y A;  1LAP A;  4KSI A;  2PJ8 A;  2QYV A;  1ARM A;  4MHN A;  4IK2 A;  2IQ6 A;  1DTD A;  3GPQ A;  4OC3 A;  1ZR3 A;  4ONW A;  1F57 A;  4MCQ A;  3LMS A;  5LRJ A;  3FEE A;  5ELY A;  3SIG A;  3SIJ A;  1YSJ A;  4PXD A;  1HDU A;  5K8M A;  4A39 A;  4ABK A;  3ISX A;  2ZEF A;  4P4B A;  3D67 A;  3L2N A;  4ZX9 A;  1TF9 A;  3GUX A;  3H8G A;  4NGP A;  3GQO A;  3RZA A;  1VHO A;  3SJG A;  2BO9 A;  3B3S A;  3GB0 A;  3CDX A;  4R8F A;  2O4H A;  3BI0 A;  4X8I A;  5JM6 A;  5FSY A;  4IHM A;  1CG2 A;  4DJL A;  3D4U A;  4ETK A;  5LYD A;  2BOA A;  5E3B A;  1XFO A;  5FSZ A;  8CPA A;  3LWU A;  4DYO A;  4ZY2 A;  1QQ9 A;  2PJ7 A;  4P4J A;  3HLP A;  3V2B A;  2XD7 A;  1ZLH A;  2ACF A;  5HVG A;  2ZEH A;  1JQG A;  2PJ6 A;  3T8W A;  1CBX A;  5K8O A;  3QNV A;  4OME A;  2OOT A;  3IWW A;  5HOL A;  2G9D A;  2Q4Z A;  1FNO A;  1FT7 A;  5LRK A;  1CX8 A;  1Y7E A;  4K3N A;  3SI0 A;  4PXE A;  4UML A;  1TY8 A;  1YME A;  1CPX A;  1LOK A;  2Q43 A;  3RBU A;  2PJB A;  4CPA A;  2PCU A;  2AFC A;  2GLF A;  2GLJ A;  2ZEL A;  3PB7 X;  2PJ3 A;  2ZOF A;  4MHY A;  3SJE A;  3FJU A;  5CMS A;  4R6T A;  4ZI6 A;  1DE4 C;  1F2P A;  1TKH A;  1XRY A;  3WT4 A;  4EME A;  3PB4 X;  2VL1 A;  1PYT B;  3KR5 A;  4R7M A;  2ZEG A;  2EK8 A;  3KQX A;  2AFZ A;  1Y0R A;  4J5Q A;  4BD9 A;  1H8L A;  1LAN A;  4Z65 A;  3D7D A;  3PB6 X;  4LQG A;  4J4Z A;  4WJB A;  4GUA A;  3IEH A;  1F2O A;  3GLJ A;  4NFR A;  3S9M A;  1BPM A;  4P4F A;  2ANP A;  2CTB A;  5JGF A;  1HDQ A;  4TWE A;  4NGQ A;  5D8N A;  2JEW A;  4H2K A;  3JZT A;  1YLO A;  4GVV A;  2VRI A;  5LYF A;  1YW4 A;  3BXM A;  1HEE A;  3B3V A;  2V8D A;  5LYL A;  3FEC A;  2ZEN A;  1LFW A;  2O53 A;  3D66 A;  3S9L A;  4NGT A;  3SJF A;  4EWT A;  4ZYQ A;  4YU9 A;  1CPS A;  4P45 A;  5DS0 A;  1TKF A;  1PCA A;  3BI1 A;  4OC0 A;  3FMC A;  2PIY A;  3SII A;  4OC1 A;  4ZY0 A;  1KWM A;  3NH5 A;  4X3R A;  1LCP A;  4NJQ A;  2C6C A;  2CF4 A;  3D7G A;  3VFQ A;  5HVF A;  2PE3 A;  4JCA A;  2X47 A;  2POK A;  2PRQ A;  3FX6 A;  3B3T A;  3WC7 A;  4A38 A;  2DX6 A;  4FAI A;  7CPA A;  2V77 A;  2CTC A;  1AYE A;  5F09 A;  4UEE A;  2PJC A;  3IFE A;  4ESS A;  3FH4 A;  4NJR A;  3SJX A;  1VHE A;  4NGN A;  3PB9 X;  2OR4 A;  3FVL A;  3IIB A;  4JGK A;  4IAV A;  3EJF A;  1VIX A;  4EFD A;  5DUS A;  4ETJ A;  3FED A;  2QVP A;  4MCR A;  4PPZ A;  1HJZ A;  4OC4 A;  3B7I A;  3VAR A;  3GPG A;  3CPX A;  4G1P A;  3KAS A;  3Q71 A;  5FSU A;  2WZN A;  3H8E A;  5CPA A;  5FSX A;  4W9Y A;  2FXK A;  1IGB A;  4UIB A;  3K2K A;  5FSV A;  3D68 A;  1IY7 A;  2V8H A;  1R3N A;  2DEA A;  1CP7 A;  2C6P A;  2GRE A;  3IO1 A;  2IMO A;  3EWQ A;  3BHX A;  3K9T A;  3ETI A;  4GVW A;  2AFS A;  1Y0Y A;  1CP6 A;  4GM5 A;  4MHZ A;  4JYW A;  1XMB A;  1VHU A;  4P44 A;  4JVV A;  1ZR5 A;  2WYR A;  2FVG A;  1BAV A;  1NJR A;  3B35 A;  2XEI A;  1GYT A;  2C1C A;  1ZG7 A;  4MMO A;  2AFU A;  4A94 A;  2EEE A;  3B2Y A;  2ZEO A;  5THW A;  3TC8 A;  4F9U A;  3KHX A;  4D86 A;  4NGM A;  3DLJ A;  3KL9 A;  4OC5 A;  5HXD A;  1BPN A;  3MN8 A;  4F8Z A;  1OBR A;  4P4E A;  3D7H A;  1TXR A;  3WC6 A;  4IQY A;  2ZEP A;  1M4L A;  3VAT A;  4UF4 A;  3GQE A;  3KQZ A;  1TKJ A;  3PBB A;  4NGR A;  5I4M A;  5JH9 A;  3N5F A;  4DUK A;  3NFZ A;  3EJG A;  2C6G A;  1ZLI A;  1XBU A;  2V8G A;  3NH4 A;  3V45 A;  2XEG A;  2PJA A;  2NSM A;  1YD9 A;  4WWV A;  1Z2L A;  3EKE A;  3JRU A;  3MRU A;  2PIZ A;  1Z5R A;  4OIW A;  4NGS A;  4UIA A;  2PVV A;  4MXU A;  4P10 A;  3PFE A;  2EWB A;  2PJ2 A;  4FBE A;  3EW5 A;  2V8V A;  2JBJ A;  2IJZ A;  3CPA A;  2PJ1 A;  4JZ0 A;  2ZEE A;  2ZED A;  3I1U A;  3PEI A;  1TXZ A;  1RTQ A;  2PJ4 A;  5J1Q A;  1ZG9 A;  2GU2 A;  2FG1 A;  2BCO A;  3IIF A;  3D7F A;  4OID A;  4O23 A;  2RFH A;  5HIH A;  4KYB A;  4RUH A;  4UEF A;  3SI2 A;  1VGY A;  2LGR A;  4TNU A;  1AMP A;  1ZG8 A;  1XJO A;  5CB3 A;  3VH9 A;  1Z8L A;  2CIJ A;  3EWO A;  1UWY A;  4OC2 A;  4FUU A;  5LRG A;  2EK9 A;  3HUV A;  3EWR A;  4FWU A;  4Q7A A;  2J9A A;  3KZW A;  1EE3 P;  2XEF A;  5HVH A;  5LYI A;  3B3W A;  3NA6 A;  3V7Z A;  3SIH A;  6CPA A;  1QMU A;  4ABL A;  2BFR A;  3KHZ A;  2AFM A;  3KI9 A;  4B6Z A;  4J5S A;  2FAV A;  2L8R A;  4AXV A;  4ZY1 A;  4PXC A;  1BLL E;  3DGV A;  4YWY A;  5D29 A;  1R43 A;  3CT9 A;  2ZEM A;  2RB7 A;  5IB9 A;  3IC1 A;  4OKO A;  5CBM A;  2BFQ A;  2AFW A;  4TU0 A;  2ABZ A;  3NH8 A;  4J5R A;  3TX8 A;  3Q6Z A;  3KR4 A;  2F8H A;  4MCS A;  1ELL P;  2PVW A;  4PQA A;  4PXB A;  3PFO A;  4F9V A;  2Q51 A;  4UEZ A;  1YW6 A;  4P4I A;  3WC5 A;  2JBK A;  3S9N A;  2PJ0 A;  1ARL A;  3V38 A;  3ISZ A;  3PRT A;  5CB5 A;  2XEJ A;  2HB6 A;  5AIL A;  2F7V A;  3EWP A;  3FF3 A;  3SI1 A;  3B3C A;  1SPV A; 
#chains in the Genus database with same CATH topology
 3EO4 A;  5K8N A;  4ZX8 A;  3IID A;  2BL1 A;  5K8P A;  4X2T A;  4JLL A;  3GYA A;  3PB8 X;  3GPO A;  2I3C A;  2FS5 A;  4K0C A;  4CAX A;  2QJ8 A;  3IJ3 A;  4CGN A;  4P4D A;  1Q7L A;  1V0C A;  3TO6 A;  4R76 A;  3WAB A;  4CAE A;  2HC9 A;  2PJ5 A;  1Z4R A;  2NYQ A;  3DSB A;  2H5M A;  2OB0 A;  2R7H A;  3PBE A;  3H8F A;  4OP4 A;  1ELM P;  4C7I A;  4GXH A;  2VZZ A;  4MRI A;  4MCP A;  4MHP A;  1NE9 A;  1X10 A;  1TF8 A;  2PJ9 A;  4JD6 A;  3R9G A;  2ZOG A;  4K30 A;  4XPL A;  3RAM A;  1IID A;  2AFO A;  1X12 A;  3FIX A;  4PV6 A;  3KGQ A;  5KTA A;  1NSA A;  2D4O A;  4JJX A;  1S7F A;  4A37 A;  4FD7 A;  1M4G A;  5FVJ A;  3E0K A;  2DPT A;  1LAM A;  4KOV A;  2AFX A;  2BEI A;  4P6Y A;  1LAP A;  4KSI A;  2PJ8 A;  2QYV A;  1ARM A;  4MHN A;  4H89 A;  4IK2 A;  1XOV A;  4UWJ A;  4U9Y A;  2IQ6 A;  1DTD A;  3GPQ A;  1ZO0 A;  2B4D B;  3VWE A;  2J8N A;  4OC3 A;  1ZR3 A;  4ONW A;  1YLE A;  2R8V A;  1F57 A;  2HUZ A;  4XPK A;  5AGE A;  3WR7 A;  4MCQ A;  1RO5 A;  3LMS A;  5CNP A;  4MFQ A;  2BSW A;  3K9U A;  5LRJ A;  3SXN A;  3FEE A;  5ELY A;  3SIG A;  3SIJ A;  1MK4 A;  1YSJ A;  4E0A A;  4PXD A;  4JXR A;  3ZZI A;  2DF5 A;  1HDU A;  3LAC A;  2PC1 A;  4L8A A;  4A39 A;  5K8M A;  4ABK A;  3ISX A;  1XF8 A;  2ZEF A;  4P4B A;  3H5Z A;  2Z3M A;  3S6H A;  3D67 A;  4JLY A;  3L2N A;  4KUB A;  4UCN A;  4ZX9 A;  1KUY A;  1S7N A;  1OZP A;  4CGO A;  1TF9 A;  1XIX A;  3GUX A;  3H8G A;  3FYN A;  1S5K A;  4NGP A;  3GQO A;  4MHD A;  1VHO A;  1FY7 A;  2B4B A;  2PSW A;  3RZA A;  3SJG A;  3TTH A;  4B5P A;  2JDC A;  2OU2 A;  2BO9 A;  3B3S A;  3GB0 A;  4J3G A;  1AUG A;  3CDX A;  3FNC A;  3TO9 A;  1SQH A;  4R8F A;  2VXK A;  1Y9W A;  3B8G A;  2AJ6 A;  4PK3 A;  1QSR A;  2ZW7 A;  5J8C A;  2O4H A;  3BI0 A;  1Q2C A;  4X8I A;  5A28 A;  2FL4 A;  5FSY A;  4IHM A;  5JM6 A;  1CG2 A;  1CM0 A;  4DJL A;  1CJW A;  4CRY B;  3D4U A;  2JLM A;  5J8F A;  4ETK A;  3I9S A;  1NMT A;  5LYD A;  4XNH C;  1I1D A;  4OAD A;  3EFA A;  2BOA A;  5E3B A;  1XFO A;  3DR6 A;  5FSZ A;  8CPA A;  2Q44 A;  3LWU A;  4DYO A;  2Z3L A;  4ZY2 A;  1QQ9 A;  2PJ7 A;  4P4J A;  3HLP A;  3V2B A;  2XD7 A;  1ZLH A;  2ACF A;  2Z3K A;  3C26 A;  4MFL A;  4MI4 A;  4KOR A;  4C7H A;  2ZEH A;  5HVG A;  2ODF A;  1JQG A;  1Z8T A;  4A31 A;  2PJ6 A;  3T8W A;  1CBX A;  2Z3P A;  1MJA A;  4CPA A;  3QB8 A;  5K8O A;  1I12 A;  2VEZ A;  3QNV A;  4OME A;  5EMI A;  2OOT A;  2GE3 A;  3I3G A;  5HOL A;  3IWW A;  2G9D A;  4QBJ A;  2Q4Z A;  1FNO A;  2PDO A;  1PU9 A;  1FT7 A;  4B5O A;  5LRK A;  1Z9U A;  1CX8 A;  2FXF A;  1Y7E A;  4FD6 A;  5DWM A;  4MBU A;  4K3N A;  4XPD B;  3R1K A;  3SI0 A;  4PXE A;  4C2Y A;  3BLN A;  4UML A;  1TY8 A;  2P6G A;  1YME A;  2Q7S A;  4XNH B;  3TO7 A;  1CPX A;  1LOK A;  1B87 A;  2G3A A;  2Q43 A;  3R9E A;  3RBU A;  2JZE A;  2PJB A;  2PCU A;  2AFC A;  2GLF A;  2GLJ A;  2ZEL A;  3GY9 A;  2PJ3 A;  2Z11 A;  3PB7 X;  2ZOF A;  4MHY A;  3SJE A;  2CNM A;  1S3Z A;  4UCP A;  3FJU A;  2GAN A;  5CMS A;  4R6T A;  4ZI6 A;  1DE4 C;  1F2P A;  1TKH A;  1XRY A;  3WT4 A;  2WPX A;  4EME A;  3PB4 X;  1B6B A;  1YX0 A;  1YK3 A;  1PYT B;  2VL1 A;  3KR5 A;  4R7M A;  4QVT A;  2ZEG A;  2EK8 A;  4NF1 A;  3KQX A;  2AFZ A;  1Y0R A;  4J5Q A;  1J4J A;  1H8L A;  1LAN A;  3QAH A;  4R3K A;  4BD9 A;  4Z65 A;  4MFJ A;  4MFK A;  3D7D A;  5IB0 A;  3PB6 X;  2VI7 A;  4J4Z A;  4LQG A;  4GUA A;  4R9M A;  4WJB A;  3IEH A;  2Z10 A;  1F2O A;  3GLJ A;  4NFR A;  3S9M A;  1BPM A;  4P4F A;  2ANP A;  2B58 A;  2CTB A;  4R57 A;  5JGF A;  1HDQ A;  4ZBG A;  3IGR A;  4TWE A;  4NGQ A;  5D8N A;  2W2G A;  2JEW A;  4H2K A;  3JZT A;  1YLO A;  1Z8W A;  4CYO A;  4GVV A;  2VRI A;  2GIV A;  5G20 A;  5LYF A;  1YW4 A;  1P0H A;  4KZT A;  3BXM A;  1HEE A;  3B3V A;  4H6U A;  2Q0Y A;  2V8D A;  1KUV A;  5LYL A;  5G21 A;  1U6M A;  3FEC A;  2ZEN A;  4QUS A;  5F47 A;  2Q7B A;  4DNC A;  1Z8X A;  1LFW A;  2O53 A;  3D66 A;  2BUE A;  3FBU A;  4NGT A;  3S9L A;  3MGD A;  5HMN A;  2P0W A;  3SJF A;  4MJ8 A;  1M1D A;  1Q2Y A;  4F0Y A;  4EWT A;  5IX3 A;  4ZYQ A;  4YU9 A;  1CPS A;  4KOW A;  5E96 A;  3G8W A;  4P45 A;  5AG7 A;  5DS0 A;  2IL4 A;  1TKF A;  1PCA A;  3H4Q A;  3BI1 A;  4OC0 A;  3FMC A;  2PIY A;  3SII A;  4OC1 A;  4ZY0 A;  3FB3 A;  4RN7 A;  2KCW A;  1YR0 A;  1KWM A;  3CXS A;  3NH5 A;  4QB9 A;  4F0X A;  4X3R A;  5G22 A;  1LCP A;  2B4D A;  4NJQ A;  2C6C A;  1QSM A;  1P4N A;  2FIA A;  3D8P A;  2J8M A;  2CF4 A;  5GCN A;  3D7G A;  3VFQ A;  5HVF A;  2PE3 A;  2YNC C;  1Y9K A;  4JCA A;  1N71 A;  2X47 A;  2POK A;  2PRQ A;  3FX6 A;  1ON0 A;  3B3T A;  3GKR A;  2Z3N A;  3T90 A;  3WC7 A;  2OZG A;  4A38 A;  2DX6 A;  1K4J A;  4FAI A;  7CPA A;  2V77 A;  1S7K A;  2CTC A;  1AYE A;  5F09 A;  4UEE A;  2PJC A;  3IFE A;  2YND A;  5C82 A;  5IV0 A;  4ESS A;  3FH4 A;  5H84 A;  4NJR A;  3SJX A;  3TT2 A;  1VHE A;  2F5I A;  2WSA A;  4NGN A;  3ZJ0 A;  4CRZ B;  4IUS A;  3PB9 X;  2OR4 A;  4UFW A;  3FVL A;  4JXQ A;  4CYN A;  4LX9 A;  4YRH A;  2CY2 A;  2RC4 A;  1S7L A;  3IIB A;  4JGK A;  3IWE A;  4XPD C;  4E2A A;  4EVY A;  4IAV A;  3EJF A;  2EO8 A;  3IU2 A;  3PZJ A;  4M3S A;  4UWI A;  1VIX A;  4EFD A;  4HNY B;  4B11 A;  2B3V A;  1VKC A;  5DUS A;  4ETJ A;  1XEB A;  2OH1 A;  3FED A;  4HNX B;  2Z3O A;  2QVP A;  4M6H A;  4U9Z A;  4MCR A;  4PPZ A;  1HJZ A;  4OC4 A;  3B7I A;  3VAR A;  4UBR A;  3GPG A;  3FXT A;  2G0B A;  2QIR A;  3CPX A;  4G1P A;  3D2M A;  3KAS A;  4KOY A;  3DDD A;  4R87 A;  2PQ8 A;  3LOD A;  2HV2 A;  4HKF A;  4Q36 A;  3Q71 A;  5FSU A;  4QC6 A;  4UFV A;  2WZN A;  3H8E A;  5A27 A;  5CPA A;  2X7B A;  4C2X A;  4ORF A;  5FSX A;  4CGL A;  4HNW B;  4W9Y A;  4Q38 A;  2FXK A;  1KZF A;  4NEX A;  2ZW5 A;  1IGB A;  2P6E A;  2Q4Y A;  3EC4 A;  4UIB A;  3K2K A;  4A32 A;  4PK2 A;  5FSV A;  2PR1 A;  3RO0 A;  3D68 A;  3P2H A;  3CZX A;  1IY7 A;  3LD2 A;  2V8H A;  5AG5 A;  1R3N A;  4OAE A;  2DEA A;  1CP7 A;  2C6P A;  2GRE A;  3IO1 A;  2IMO A;  1IIC A;  2ATR A;  3EWQ A;  3PP9 A;  4CYP A;  2Y0M A;  4M6G A;  4U5Y A;  3JVN A;  2JDD A;  3BHX A;  3K9T A;  4A2Z A;  1RXT A;  3ETI A;  4GVW A;  2AFS A;  4FD4 A;  2R98 A;  1Y0Y A;  2CXA A;  2VBQ A;  1CP6 A;  4GM5 A;  1MJ9 A;  4KOX A;  4AG9 A;  3W91 A;  4AVB A;  2D4P A;  4MHZ A;  4JYW A;  5C88 A;  1XMB A;  1VHU A;  3EY5 A;  1A2Z A;  4P44 A;  2QEC A;  4C2Z A;  4JVV A;  1ZR5 A;  2CNT A;  2WYR A;  2FVG A;  2YGW A;  1BAV A;  1NJR A;  1WK4 A;  3BJ8 A;  1KUX A;  4B13 A;  3B35 A;  3RYO A;  4B12 A;  2XEI A;  2O28 A;  4IF5 A;  1GYT A;  2C1C A;  1ZG7 A;  2ARH A;  5KTC A;  4MMO A;  2AFU A;  4A94 A;  2I00 A;  2EEE A;  3B2Y A;  3FRM A;  4MFP A;  4MY3 A;  1M4D A;  1S60 A;  2B3U A;  2ZEO A;  5THW A;  1NSL A;  3TC8 A;  4BMH A;  4F9U A;  3KHX A;  4D86 A;  3N7Z A;  4JWP A;  4NGM A;  2PRB A;  3DLJ A;  3KL9 A;  2EBJ A;  1IOI A;  4CAW A;  4C68 A;  4OC5 A;  1Q2D A;  3S6K A;  5HXD A;  4A95 A;  3R9F A;  1BPN A;  3MN8 A;  4F8Z A;  1IB1 E;  2REE A;  5KTD A;  2EUI A;  1OBR A;  4P4E A;  3D7H A;  1TXR A;  2DXQ A;  5F46 A;  3WC6 A;  1QSO A;  2HQY A;  5EBV A;  4IQY A;  2Q4V A;  3CXP A;  2ZEP A;  3DR8 A;  3G3S A;  1M4L A;  3VAT A;  4UF4 A;  3GIU A;  3GQE A;  3KQZ A;  2QML A;  4CYQ A;  1TKJ A;  2P6F A;  2WPW A;  3PBB A;  4A33 A;  2YNC A;  1IU8 A;  4NGR A;  4OLL A;  1BO4 A;  3F0A A;  1UFH A;  5I4M A;  1IOF A;  5JH9 A;  3N5F A;  4DUK A;  2Z0Z A;  3F5B A;  4MY0 A;  3NFZ A;  3EJG A;  4KLW A;  5HH1 A;  2C6G A;  5ISV A;  5JPH A;  1IYL A;  4PSX A;  4KLV A;  3S6F A;  1ZLI A;  3IWG A;  4KVX A;  1XBU A;  2V8G A;  4B10 A;  3NH4 A;  3V45 A;  2XEG A;  2PJA A;  4X5K A;  5G1Z A;  4A30 A;  2NSM A;  1YD9 A;  4WWV A;  3S6G A;  3JUW A;  1Z2L A;  2JEV A;  4AVA A;  3F8K A;  3OWC A;  2YNE A;  1QST A;  4HPS A;  4AVC A;  1YVK A;  2OZU A;  3EKE A;  3JRU A;  3MRU A;  1XE4 A;  1VHS A;  4NCZ A;  2RNK A;  2FCK A;  2PIZ A;  3W6S A;  1Z5R A;  5AG4 A;  4OIW A;  5JQ4 A;  4NGS A;  3JTK A;  4UIA A;  2PVV A;  4MXU A;  4P10 A;  3PFE A;  2EWB A;  2PJ2 A;  3KKW A;  4UCM A;  1YQE A;  3EW5 A;  4MFZ A;  3NE7 A;  3V8I A;  2V8V A;  4NXY A;  4FBE A;  2JBJ A;  2IJZ A;  3CPA A;  2PJ1 A;  3D3S A;  4H6Z A;  4JZ0 A;  2ZEE A;  4UFX A;  2ZED A;  3I1U A;  4CAV A;  3PEI A;  1TXZ A;  3TE4 A;  1RTQ A;  2PJ4 A;  3T9Y A;  2FT0 A;  5J1Q A;  1ZG9 A;  4Y49 B;  2GU2 A;  2FG1 A;  2BCO A;  2R1I A;  3IIF A;  3UY5 A;  3RNZ A;  2VQY A;  3D7F A;  4OID A;  4O23 A;  2REF A;  5HIH A;  1GHE A;  4KYB A;  2RFH A;  4E8O A;  4RUH A;  4UEF A;  3SI2 A;  1VGY A;  1TIQ A;  4KSF A;  2LGR A;  3EXN A;  4TNU A;  5BWA B;  1AMP A;  2JZF A;  1XJO A;  2KQV A;  5CB3 A;  1ZG8 A;  1Z8L A;  2CIJ A;  4M6I A;  3DNS A;  3EWO A;  3R95 A;  3SHP A;  3VH9 A;  1UWY A;  3A9L A;  4OC2 A;  4FUU A;  3R96 A;  5I0C A;  5AG6 A;  4F6A A;  5LRG A;  4FD5 A;  1I21 A;  2EK9 A;  3TFY A;  3HUV A;  3EWR A;  5F49 A;  4YFJ A;  3P2F A;  4BBH A;  4GS4 A;  4FWU A;  2I79 A;  4LUA A;  3TOB A;  4Q7A A;  2J9A A;  2ZXV A;  3KZW A;  1EE3 P;  1QSN A;  3QAY A;  4CAF A;  2XEF A;  1JWQ A;  5HVH A;  2JZD A;  2FIW A;  3CXQ A;  4II9 A;  4CGP A;  1IYK A;  5LYI A;  3SXO A;  3B3W A;  4B14 A;  1M44 A;  3BJ7 A;  1Y7R A;  3NA6 A;  5DWN A;  3SIH A;  3V7Z A;  3VWD A;  4B5P B;  1QMU A;  3IU1 A;  6CPA A;  4ABL A;  2BFR A;  3KHZ A;  1YRE A;  4L89 A;  3TCV A;  2AFM A;  3KI9 A;  3PGP A;  3NE8 A;  4B6Z A;  4J5S A;  2FAV A;  2L8R A;  1PUA A;  4RI1 A;  1YVO A;  4AXV A;  1YGH A;  4ZY1 A;  1XMT A;  2FE7 A;  4PXC A;  1BLL E;  3DGV A;  4YWY A;  2VZY A;  5D29 A;  1R43 A;  3CT9 A;  2EVN A;  2PR8 A;  2WCT A;  1MJB A;  2ZEM A;  2RB7 A;  2GFQ A;  4KOS A;  4KOU A;  4CGM A;  3IC1 A;  4OKO A;  5CBM A;  2BFQ A;  4YGO A;  3W6X A;  5IB9 A;  2A4N A;  4R3L A;  4LQ6 A;  2AFW A;  4TU0 A;  2ABZ A;  3NH8 A;  5F48 A;  1L0C A;  1WWZ A;  4J5R A;  3TX8 A;  2OZH A;  4ZGY B;  3Q6Z A;  3KR4 A;  4AG7 A;  2F8H A;  4I49 A;  4MCS A;  4KUA A;  1ELL P;  2PVW A;  2ZW6 A;  4KVM E;  2K5T A;  4PQA A;  3PFO A;  4PXB A;  4M85 A;  3TOA A;  4F9V A;  4ONU A;  2Q51 A;  2WUU A;  4RS2 A;  2C27 A;  4UEZ A;  2ZPA A;  1YW6 A;  4P4I A;  3WC5 A;  4BIN A;  2JBK A;  4Y49 C;  4UA3 A;  1BOB A;  3D2P A;  4KS9 A;  3S9N A;  2ZW4 A;  2PJ0 A;  1ARL A;  2AE6 A;  3ISZ A;  3PRT A;  3V38 A;  5EC4 A;  1R57 A;  2DPS A;  5CB5 A;  2B5G A;  4PSW A;  2G3T A;  2XEJ A;  4CS0 B;  2HB6 A;  5AIL A;  2F7V A;  3EWP A;  2FSR A;  3FF3 A;  2B5G B;  2J8R A;  2NMT A;  4AB7 A;  1M4I A;  1Z4E A;  4KVO E;  3SI1 A;  5H86 A;  1LRZ A;  4KSA A;  2Q04 A;  2CNS A;  3B3C A;  4NSQ A;  4KOT A;  1SPV A; 
#chains in the Genus database with same CATH homology
 5K8N A;  4ZX8 A;  3IID A;  5K8P A;  4X2T A;  4JLL A;  3PB8 X;  3GPO A;  2I3C A;  4K0C A;  2QJ8 A;  3IJ3 A;  4P4D A;  1Q7L A;  3WAB A;  4R76 A;  2HC9 A;  2PJ5 A;  2NYQ A;  4OP4 A;  3PBE A;  3H8F A;  1ELM P;  4MRI A;  4MCP A;  4MHP A;  1TF8 A;  2PJ9 A;  2ZOG A;  3RAM A;  2AFO A;  3KGQ A;  1NSA A;  4A37 A;  1LAM A;  2AFX A;  4P6Y A;  1LAP A;  4KSI A;  2PJ8 A;  2QYV A;  1ARM A;  4MHN A;  4IK2 A;  2IQ6 A;  1DTD A;  3GPQ A;  4OC3 A;  1ZR3 A;  4ONW A;  1F57 A;  4MCQ A;  3LMS A;  5LRJ A;  3FEE A;  5ELY A;  3SIG A;  3SIJ A;  1YSJ A;  4PXD A;  1HDU A;  5K8M A;  4A39 A;  4ABK A;  3ISX A;  2ZEF A;  4P4B A;  3D67 A;  3L2N A;  4ZX9 A;  1TF9 A;  3GUX A;  3H8G A;  4NGP A;  3GQO A;  3RZA A;  1VHO A;  3SJG A;  2BO9 A;  3B3S A;  3GB0 A;  3CDX A;  4R8F A;  2O4H A;  3BI0 A;  4X8I A;  5JM6 A;  5FSY A;  4IHM A;  1CG2 A;  4DJL A;  3D4U A;  4ETK A;  5LYD A;  2BOA A;  5E3B A;  1XFO A;  5FSZ A;  8CPA A;  3LWU A;  4DYO A;  4ZY2 A;  1QQ9 A;  2PJ7 A;  4P4J A;  3HLP A;  3V2B A;  2XD7 A;  1ZLH A;  2ACF A;  5HVG A;  2ZEH A;  1JQG A;  2PJ6 A;  3T8W A;  1CBX A;  5K8O A;  3QNV A;  4OME A;  2OOT A;  3IWW A;  5HOL A;  2G9D A;  2Q4Z A;  1FNO A;  1FT7 A;  5LRK A;  1CX8 A;  1Y7E A;  4K3N A;  3SI0 A;  4PXE A;  4UML A;  1TY8 A;  1YME A;  1CPX A;  1LOK A;  2Q43 A;  3RBU A;  2PJB A;  4CPA A;  2PCU A;  2AFC A;  2GLF A;  2GLJ A;  2ZEL A;  3PB7 X;  2PJ3 A;  2ZOF A;  4MHY A;  3SJE A;  3FJU A;  5CMS A;  4R6T A;  4ZI6 A;  1DE4 C;  1F2P A;  1TKH A;  1XRY A;  3WT4 A;  4EME A;  3PB4 X;  2VL1 A;  1PYT B;  3KR5 A;  4R7M A;  2ZEG A;  2EK8 A;  3KQX A;  2AFZ A;  1Y0R A;  4J5Q A;  4BD9 A;  1H8L A;  1LAN A;  4Z65 A;  3D7D A;  3PB6 X;  4LQG A;  4J4Z A;  4WJB A;  4GUA A;  3IEH A;  1F2O A;  3GLJ A;  4NFR A;  3S9M A;  1BPM A;  4P4F A;  2ANP A;  2CTB A;  5JGF A;  1HDQ A;  4TWE A;  4NGQ A;  5D8N A;  2JEW A;  4H2K A;  3JZT A;  1YLO A;  4GVV A;  2VRI A;  5LYF A;  1YW4 A;  3BXM A;  1HEE A;  3B3V A;  2V8D A;  5LYL A;  3FEC A;  2ZEN A;  1LFW A;  2O53 A;  3D66 A;  3S9L A;  4NGT A;  3SJF A;  4EWT A;  4ZYQ A;  4YU9 A;  1CPS A;  4P45 A;  5DS0 A;  1TKF A;  1PCA A;  3BI1 A;  4OC0 A;  3FMC A;  2PIY A;  3SII A;  4OC1 A;  4ZY0 A;  1KWM A;  3NH5 A;  4X3R A;  1LCP A;  4NJQ A;  2C6C A;  2CF4 A;  3D7G A;  3VFQ A;  5HVF A;  2PE3 A;  4JCA A;  2X47 A;  2POK A;  2PRQ A;  3FX6 A;  3B3T A;  3WC7 A;  4A38 A;  2DX6 A;  4FAI A;  7CPA A;  2V77 A;  2CTC A;  1AYE A;  5F09 A;  4UEE A;  2PJC A;  3IFE A;  4ESS A;  3FH4 A;  4NJR A;  3SJX A;  1VHE A;  4NGN A;  3PB9 X;  2OR4 A;  3FVL A;  3IIB A;  4JGK A;  4IAV A;  3EJF A;  1VIX A;  4EFD A;  5DUS A;  4ETJ A;  3FED A;  2QVP A;  4MCR A;  4PPZ A;  1HJZ A;  4OC4 A;  3B7I A;  3VAR A;  3GPG A;  3CPX A;  4G1P A;  3KAS A;  3Q71 A;  5FSU A;  2WZN A;  3H8E A;  5CPA A;  5FSX A;  4W9Y A;  2FXK A;  1IGB A;  4UIB A;  3K2K A;  5FSV A;  3D68 A;  1IY7 A;  2V8H A;  1R3N A;  2DEA A;  1CP7 A;  2C6P A;  2GRE A;  3IO1 A;  2IMO A;  3EWQ A;  3BHX A;  3K9T A;  3ETI A;  4GVW A;  2AFS A;  1Y0Y A;  1CP6 A;  4GM5 A;  4MHZ A;  4JYW A;  1XMB A;  1VHU A;  4P44 A;  4JVV A;  1ZR5 A;  2WYR A;  2FVG A;  1BAV A;  1NJR A;  3B35 A;  2XEI A;  1GYT A;  2C1C A;  1ZG7 A;  4MMO A;  2AFU A;  4A94 A;  2EEE A;  3B2Y A;  2ZEO A;  5THW A;  3TC8 A;  4F9U A;  3KHX A;  4D86 A;  4NGM A;  3DLJ A;  3KL9 A;  4OC5 A;  5HXD A;  1BPN A;  3MN8 A;  4F8Z A;  1OBR A;  4P4E A;  3D7H A;  1TXR A;  3WC6 A;  4IQY A;  2ZEP A;  1M4L A;  3VAT A;  4UF4 A;  3GQE A;  3KQZ A;  1TKJ A;  3PBB A;  4NGR A;  5I4M A;  5JH9 A;  3N5F A;  4DUK A;  3NFZ A;  3EJG A;  2C6G A;  1ZLI A;  1XBU A;  2V8G A;  3NH4 A;  3V45 A;  2XEG A;  2PJA A;  2NSM A;  1YD9 A;  4WWV A;  1Z2L A;  3EKE A;  3JRU A;  3MRU A;  2PIZ A;  1Z5R A;  4OIW A;  4NGS A;  4UIA A;  2PVV A;  4MXU A;  4P10 A;  3PFE A;  2EWB A;  2PJ2 A;  4FBE A;  3EW5 A;  2V8V A;  2JBJ A;  2IJZ A;  3CPA A;  2PJ1 A;  4JZ0 A;  2ZEE A;  2ZED A;  3I1U A;  3PEI A;  1TXZ A;  1RTQ A;  2PJ4 A;  5J1Q A;  1ZG9 A;  2GU2 A;  2FG1 A;  2BCO A;  3IIF A;  3D7F A;  4OID A;  4O23 A;  2RFH A;  5HIH A;  4KYB A;  4RUH A;  4UEF A;  3SI2 A;  1VGY A;  2LGR A;  4TNU A;  1AMP A;  1ZG8 A;  1XJO A;  5CB3 A;  3VH9 A;  1Z8L A;  2CIJ A;  3EWO A;  1UWY A;  4OC2 A;  4FUU A;  5LRG A;  2EK9 A;  3HUV A;  3EWR A;  4FWU A;  4Q7A A;  2J9A A;  3KZW A;  1EE3 P;  2XEF A;  5HVH A;  5LYI A;  3B3W A;  3NA6 A;  3V7Z A;  3SIH A;  6CPA A;  1QMU A;  4ABL A;  2BFR A;  3KHZ A;  2AFM A;  3KI9 A;  4B6Z A;  4J5S A;  2FAV A;  2L8R A;  4AXV A;  4ZY1 A;  4PXC A;  1BLL E;  3DGV A;  4YWY A;  5D29 A;  1R43 A;  3CT9 A;  2ZEM A;  2RB7 A;  5IB9 A;  3IC1 A;  4OKO A;  5CBM A;  2BFQ A;  2AFW A;  4TU0 A;  2ABZ A;  3NH8 A;  4J5R A;  3TX8 A;  3Q6Z A;  3KR4 A;  2F8H A;  4MCS A;  1ELL P;  2PVW A;  4PQA A;  4PXB A;  3PFO A;  4F9V A;  2Q51 A;  4UEZ A;  1YW6 A;  4P4I A;  3WC5 A;  2JBK A;  3S9N A;  2PJ0 A;  1ARL A;  3V38 A;  3ISZ A;  3PRT A;  5CB5 A;  2XEJ A;  2HB6 A;  5AIL A;  2F7V A;  3EWP A;  3FF3 A;  3SI1 A;  3B3C A;  1SPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...