1LAPA

Molecular structure of leucine aminopeptidase at 2.7-angstroms resolution
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
484
structure length
481
Chain Sequence
b'TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytosol aminopeptidase
publication title Molecular structure of leucine aminopeptidase at 2.7-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 154
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1990-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lapA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lapA02
2PJBA 5FSXA 5K8NA 4UIAA 1KWMA 4MHPA 1CPXA 4MMOA 1DE4C 5J1QA 3RAMA 2PRQA 2PJ0A 4X3RA 4JLLA 4YWYA 5ELYA 2CTBA 3GB0A 4IK2A 5HVFA 1ZG9A 3B3CA 1F2PA 1ARMA 2DX6A 4P4IA 1F57A 2O4HA 4PXCA 1RTQA 4YU9A 4OC0A 3FH4A 3MRUA 5LYDA 2JBKA 4GVVA 1IY7A 2PE3A 2C6CA 3D68A 4AXVA 2V8DA 4PXBA 2Q43A 3KHXA 3GPQA 3WC6A 3L2NA 5K8MA 4LQGA 4J5RA 3SI0A 4FBEA 4ZX8A 3LMSA 4B6ZA 4PXEA 2IMOA 2XEJA 2X47A 2PJ7A 1CBXA 4ZYQA 4PQAA 4P4FA 4MHNA 5F09A 4P44A 4OP4A 1FT7A 3EWPA 1Y7EA 4P4DA 3FVLA 1XBUA 1VGYA 4W9YA 5DUSA 1ZR5A 1YW4A 3IFEA 1YSJA 3WABA 1XRYA 3B35A 3PB8X 1LAPA 1Q7LA 4IHMA 5CB5A 2GLJA 4MRIA 3VARA 3K2KA 3SIHA 3SIGA 3HLPA 2WZNA 3SIJA 5JH9A 4FUUA 2ZEEA 5FSZA 2AFWA 3BI1A 4NJRA 2J9AA 4BD9A 2PVWA 4A38A 4WWVA 3S9LA 3GPGA 2C1CA 3NH4A 2BO9A 1DTDA 3H8GA 3VH9A 4MCPA 3EKEA 1Z2LA 4P6YA 3KR5A 3KI9A 3WT4A 3K9TA 3KL9A 4EMEA 3V38A 4NGRA 2ANPA 3PB9X 4J5QA 3H8EA 2PCUA 3CT9A 3RBUA 2PJ6A 4FAIA 5FSVA 4MHYA 1M4LA 5LYFA 1CG2A 1ZG7A 3EWQA 1XJOA 2NSMA 2F7VA 2AFSA 2JEWA 4OC1A 4NFRA 4MCSA 5LRGA 3B7IA 1XFOA 3KQZA 2C6GA 4JGKA 4P10A 3DGVA 3BI0A 2ZEGA 1H8LA 2IJZA 4IQYA 3EWOA 2Q4ZA 2RB7A 1TXZA 4FWUA 3SJXA 3GQEA 4ZI6A 5D29A 5I4MA 4P4JA 3EJFA 4P4BA 2IQ6A 2XEGA 3V7ZA 3FECA 4OIDA 3TC8A 2FXKA 3V45A 1BAVA 2XEFA 4OKOA 4ZY2A 4F8ZA 1TKFA 4X8IA 3SI1A 1NSAA 2OOTA 5DS0A 2BOAA 3GPOA 4UIBA 2AFZA 3KHZA 3KZWA 4A94A 3D7GA 3B3SA 5AILA 1VHOA 2CTCA 3ISXA 4UMLA 4ONWA 1LOKA 2PVVA 5E3BA 5LRKA 3CDXA 2BFRA 4UEZA 3S9MA 2PJ2A 3PB7X 1EE3P 2ZELA 2FVGA 2L8RA 3PB4X 3ISZA 5IB9A 2HB6A 4KSIA 3NH8A 5FSYA 2LGRA 1CP6A 3BXMA 1YLOA 3IC1A 3PEIA 3JZTA 3FX6A 4ETKA 1QQ9A 1TY8A 2XD7A 4UEEA 1PYTB 1VHEA 4R8FA 1JQGA 1TXRA 3WC5A 1XMBA 2OR4A 1SPVA 4OC2A 4MCQA 5HVHA 2GREA 1ZLHA 4J5SA 2PJ4A 2ZEMA 4NGNA 3KASA 1ELMP 1TF8A 3SJFA 3D4UA 4D86A 4K0CA 4NGSA 3GQOA 4TWEA 4TU0A 2NYQA 5LYIA 5CBMA 5THWA 3PFEA 2EK9A 1FNOA 3EW5A 5LRJA 1HEEA 4DYOA 3NFZA 2ZOGA 1CP7A 4K3NA 4P4EA 3Q71A 2BCOA 3B3WA 4NGTA 3IIBA 3SIIA 2ZEDA 5HOLA 4MXUA 2G9DA 1PCAA 2POKA 4R7MA 2Q51A 2WYRA 4ESSA 2PJ3A 2CIJA 2QYVA 8CPAA 3B3VA 3D67A 2C6PA 3PFOA 3EWRA 4ABKA 4GM5A 4OC4A 2AFUA 4PXDA 4Z65A 2V8GA 7CPAA 2VL1A 3VATA 3FJUA 2XEIA 2VRIA 2I3CA 2BFQA 3D7DA 3CPAA 3BHXA 3MN8A 1BLLE 2CF4A 4NGMA 4NGPA 1OBRA 4ZY1A 1NJRA 2PJ9A 3D7HA 2AFMA 2PJAA 2ZEPA 4RUHA 1YMEA 3S9NA 5CMSA 1VIXA 1F2OA 1Z5RA 4JYWA 5FSUA 2AFOA 1TKJA 5HXDA 1Y0YA 4MCRA 3KR4A 4P45A 5CPAA 3IJ3A 4ZX9A 3FEEA 1AMPA 4TNUA 2GLFA 1LCPA 4R76A 2QJ8A 4JZ0A 3H8FA 3IEHA 1LANA 1IGBA 4ETJA 1AYEA 2EEEA 3EJGA 3D7FA 1LAMA 1QMUA 2EWBA 4CPAA 2V8VA 1R3NA 5HIHA 3FMCA 1CPSA 4UF4A 3WC7A 2ABZA 3IIFA 4J4ZA 1GYTA 5HVGA 1BPMA 1ELLP 4OC3A 4NJQA 2PJ5A 4ABLA 2V8HA 3FEDA 2PIZA 4UEFA 5CB3A 3VFQA 2DEAA 1YW6A 2ZEFA 4O23A 3KQXA 3ETIA 4DUKA 3KGQA 1YD9A 3SI2A 4X2TA 5JM6A 2AFCA 3IIDA 2V77A 4G1PA 2RFHA 3T8WA 3NH5A 1TF9A 2FAVA 2QVPA 3TX8A 4GVWA 5LYLA 4A39A 3PB6X 2PIYA 3DLJA 1CX8A 4A37A 1Y0RA 2O53A 3SJGA 4R6TA 5D8NA 3FF3A 4ZY0A 3PBEA 2PJ8A 3IWWA 4OMEA 4EFDA 4IAVA 4Q7AA 3JRUA 3Q6ZA 2ZOFA 3NA6A 2ZEOA 5K8PA 1R43A 2JBJA 4H2KA 4WJBA 4JVVA 3PRTA 3RZAA 3GLJA 4DJLA 3D66A 5JGFA 3N5FA 4F9UA 2HC9A 1HDQA 4EWTA 1LFWA 3LWUA 2FG1A 3B2YA 4GUAA 2AFXA 3I1UA 4MHZA 3PBBA 4NGQA 6CPAA 3GUXA 4PPZA 4JCAA 1HDUA 5K8OA 1HJZA 2EK8A 3IO1A 2ACFA 2F8HA 3SJEA 3QNVA 2ZEHA 1BPNA 1VHUA 1ARLA 1ZR3A 4KYBA 3V2BA 4OC5A 3B3TA 1Z8LA 4OIWA 4F9VA 2GU2A 3CPXA 2ZENA 1TKHA 1ZG8A 2PJ1A 1UWYA 1ZLIA 2PJCA 3HUVA
chains in the Genus database with same CATH superfamily
4M6IA 2C27A 1XIXA 2CY2A 2PJBA 5FSXA 4Q38A 5K8NA 4UIAA 1KWMA 4MHPA 1CPXA 4MMOA 1DE4C 4KSAA 3RAMA 5J1QA 4B13A 2Y0MA 1Z8TA 2PRQA 3JTKA 1I1DA 2GFQA 4KS9A 3S6FA 3TO9A 2PJ0A 4X3RA 1Z4RA 2REEA 4JLLA 5H84A 4YWYA 2HQYA 5HMNA 5ELYA 2CTBA 2WSAA 3GB0A 3PP9A 2Z10A 4IK2A 4MFQA 1M44A 1XOVA 1ZG9A 3B3CA 5HVFA 1F2PA 3CXSA 1ARMA 2DX6A 4P4IA 2B5GA 1F57A 2O4HA 3FBUA 4KLVA 4MFLA 1RTQA 4PXCA 1R57A 4YU9A 2JZDA 3W91A 4CAVA 4ORFA 4OC0A 5KTAA 1IICA 2H5MA 3FH4A 3MRUA 5LYDA 2JBKA 3R9EA 4EVYA 4X5KA 1XE4A 4RN7A 4KVME 5IV0A 5AG7A 4GVVA 1IY7A 4KOUA 2PE3A 3B8GA 4MY0A 1Y9KA 5AG5A 2C6CA 3D68A 4AXVA 5A27A 2V8DA 4PXBA 4UCPA 4HNXB 2Q43A 2DF5A 1QSNA 4CAWA 5G22A 4BMHA 3KHXA 4FD4A 3GPQA 3WC6A 4CS0B 5AG4A 1S7NA 1Y7RA 3L2NA 5K8MA 4LQGA 4J5RA 3SI0A 3RYOA 2P0WA 4AVCA 4FBEA 4ZX8A 3LMSA 4B6ZA 2B4BA 4PXEA 4IUSA 2IMOA 2XEJA 2X47A 2PJ7A 1CBXA 4ZYQA 4PQAA 4RI1A 4P4FA 4MHNA 5F09A 2BSWA 1MJ9A 4OP4A 2R8VA 1FT7A 4P44A 3EWPA 1Y7EA 4P4DA 3OWCA 4B5PA 1I21A 1V0CA 3QAYA 1ZO0A 3FVLA 1XBUA 1X12A 5FVJA 2ATRA 3I9SA 1VGYA 4W9YA 5DUSA 3JUWA 1ZR5A 4QUSA 1YW4A 3IFEA 2DXQA 3GY9A 1XMTA 2GIVA 4MHDA 3T90A 1YSJA 4M85A 3WR7A 4B10A 3WABA 1XRYA 3B35A 3PB8X 1LAPA 5J8FA 4CAEA 5IB0A 2VI7A 2KQVA 1Q7LA 4IHMA 5CB5A 2GLJA 4KZTA 4MRIA 2FXFA 3VARA 5ISVA 3K2KA 3SIHA 1QSMA 1QSOA 3SIGA 3HLPA 2WZNA 3SIJA 5JH9A 4FUUA 2ZEEA 4CGLA 4E0AA 4JJXA 5FSZA 4II9A 2AFWA 3BI1A 4NJRA 2J9AA 4UBRA 3EO4A 4BD9A 2PVWA 4A38A 2Z3KA 4WWVA 3S9LA 3GPGA 2C1CA 3NH4A 3F5BA 2BO9A 1DTDA 2REFA 4PSXA 3H8GA 2Q4VA 4MCPA 3VH9A 3EKEA 1KUYA 1Z2LA 2AJ6A 2PC1A 1IIDA 4P6YA 3KR5A 1JWQA 3R9GA 3TE4A 3KI9A 3WT4A 3K9TA 2FSRA 2Q0YA 1YVOA 3DDDA 3KL9A 3UY5A 4C68A 2B4DB 2WPWA 3PGPA 4YFJA 4EMEA 3R95A 4F0YA 3V38A 2EO8A 4NGRA 2ANPA 2YNCC 3PB9X 4J5QA 3EY5A 1XEBA 3H8EA 3G8WA 2PCUA 3CT9A 3RBUA 4C2XA 1N71A 2PJ6A 4R3LA 4FAIA 4KOYA 5FSVA 2ZW4A 3FNCA 4HPSA 4MHYA 1M4LA 3BLNA 2P6FA 4JWPA 4A32A 1YK3A 4XNHB 5LYFA 1CG2A 1ZG7A 3EWQA 2VXKA 1MJBA 2DPSA 3W6XA 1XJOA 2NSMA 3D3SA 5DWMA 4MFZA 4U9YA 3IGRA 4F0XA 2F7VA 2AFSA 2JEWA 4OC1A 3VWEA 4NFRA 1Q2DA 4MCSA 1M1DA 4AB7A 2G3AA 5LRGA 3B7IA 1XFOA 2G3TA 3KQZA 2Q04A 2C6GA 4JGKA 3N7ZA 4P10A 3DGVA 3GIUA 2K5TA 2WUUA 3BI0A 2CNSA 2ZEGA 1H8LA 4NSQA 1K4JA 3P2HA 2IJZA 5BWAB 4IQYA 3EWOA 4XPKA 4CGOA 4MI4A 1LRZA 2Q4ZA 1U6MA 2RB7A 1TXZA 4LUAA 1ON0A 3LACA 4FWUA 3SJXA 3GQEA 4ZI6A 5D29A 5I4MA 4P4JA 4IF5A 4CRYB 2EVNA 2VZYA 4QVTA 2FE7A 2P6GA 3EJFA 4P4BA 4UFXA 2IQ6A 2XEGA 3V7ZA 3FECA 4OIDA 1S7LA 1VHSA 3IWEA 4KLWA 3TC8A 2FXKA 3V45A 1BAVA 2XEFA 3F8KA 5F49A 4OKOA 4ZY2A 2HV2A 3EC4A 4F8ZA 3D2MA 1TKFA 4X8IA 3SI1A 4C7IA 2EUIA 4ZBGA 1NSAA 3R96A 2OOTA 5C88A 5DS0A 2BOAA 3GPOA 2PRBA 4UIBA 2AFZA 2CXAA 2WPXA 2ZPAA 3KZWA 3KHZA 4A94A 3D7GA 3B3SA 4M6HA 5AILA 1VHOA 3R1KA 2CTCA 3ISXA 4UMLA 4ONWA 1LOKA 2PVVA 4OADA 5E3BA 4AVBA 5LRKA 1Z8XA 1BO4A 2BFRA 2GANA 3CDXA 4UEZA 3S9MA 2PDOA 4MFKA 4KOVA 2PJ2A 3PB7X 4Y49B 4CGNA 1EE3P 2ZELA 4PV6A 5EBVA 1IOIA 2PR1A 2FVGA 4FD6A 1YLEA 2D4OA 5G1ZA 2L8RA 2Q7SA 3PB4X 3ISZA 2B5GB 5IB9A 2HB6A 4ZGYB 4KSIA 3NH8A 5FSYA 2LGRA 1CP6A 2P6EA 3BXMA 1YLOA 4KOWA 4GXHA 3IC1A 3CXQA 3PEIA 3S6HA 2FS5A 1FY7A 4YGOA 2W2GA 3JZTA 3FX6A 4ETKA 1QQ9A 1TY8A 2ARHA 4C2ZA 2XD7A 1B6BA 1TIQA 1PYTB 4UFVA 2I00A 2OB0A 4UEEA 3ZZIA 1VHEA 2YGWA 4NCZA 1JQGA 1TXRA 4R8FA 3W6SA 3NE7A 1XMBA 3WC5A 2OR4A 4UFWA 1SPVA 2CNTA 4NXYA 4OC2A 2J8NA 2Z3OA 4MCQA 4K30A 4R87A 3T9YA 5HVHA 5G21A 2GREA 1KUVA 4H6UA 4KORA 4CYPA 1PU9A 1ZLHA 4J5SA 2PJ4A 2ZEMA 1PUAA 3R9FA 4NGNA 3KASA 1ELMP 4UWJA 1TF8A 3SJFA 2R98A 3D4UA 4D86A 4K0CA 4NGSA 4BINA 3GQOA 4TWEA 4JXRA 3DNSA 1GHEA 4NF1A 4UCMA 1M4GA 4B5PB 3QB8A 4TU0A 2NYQA 4FD7A 5LYIA 2FIAA 5CBMA 4ONUA 3PFEA 5THWA 2Q7BA 2EK9A 1FNOA 1BOBA 1RO5A 2AE6A 3I3GA 2YNCA 3EW5A 4PK2A 4XPDC 5LRJA 3TT2A 1HEEA 2ZXVA 3NFZA 4DYOA 2ZOGA 4PSWA 1I12A 5KTCA 3EXNA 1CP7A 4YRHA 2HUZA 4K3NA 4CYQA 4P4EA 3Q71A 2BCOA 2BUEA 3B3WA 2B3UA 4NGTA 2R7HA 1Z4EA 3IIBA 3SIIA 2ZEDA 2FCKA 5HOLA 4XNHC 2O28A 2B58A 4MXUA 4A33A 2G9DA 1PCAA 2BEIA 2POKA 3CXPA 4AG9A 2PQ8A 3CZXA 3A9LA 5IX3A 4R7MA 2Q51A 1S60A 2WYRA 4RS2A 4KUAA 4ESSA 2PJ3A 2CIJA 5J8CA 1MK4A 2QYVA 2ODFA 2R1IA 1S7FA 2B3VA 3B3VA 4CGMA 3DSBA 8CPAA 3D67A 2C6PA 3DR8A 4GS4A 4KOSA 4B14A 3PFOA 3EWRA 4ABKA 1WK4A 4GM5A 4PK3A 2JDDA 4OC4A 3MGDA 5EMIA 2AFUA 4A30A 4PXDA 4Z65A 2V8GA 1QSRA 4CGPA 7CPAA 2VL1A 3LODA 3VATA 4LX9A 3FJUA 2XEIA 2VRIA 2I3CA 2BFQA 4KOXA 3PZJA 3D7DA 3CPAA 3BHXA 3MN8A 3P2FA 4KVOE 5F47A 1BLLE 2CF4A 4NGMA 4R57A 4NGPA 1OBRA 4ZY1A 3H4QA 1NJRA 2PJ9A 2Z11A 4Q36A 3F0AA 3D7HA 4JLYA 1IYKA 2AFMA 3NE8A 2PR8A 1YVKA 2PJAA 4A31A 2ZEPA 4RUHA 1YMEA 3S9NA 5CMSA 5AG6A 4BBHA 1B87A 1F2OA 1VIXA 1Z5RA 4U9ZA 4JYWA 3SHPA 5FSUA 2EBJA 2AFOA 1TKJA 3TO6A 4B12A 5A28A 5HXDA 2GE3A 4DNCA 1Y0YA 4MCRA 3KR4A 3S6GA 5C82A 4P45A 4R9MA 3IJ3A 4ZX9A 5CPAA 5H86A 3FEEA 1AMPA 4TNUA 2GLFA 2ZW6A 4MBUA 1LCPA 4R76A 2FL4A 2QIRA 2QJ8A 4NEXA 3BJ7A 5G20A 2VQYA 4JZ0A 3H8FA 1QSTA 1UFHA 2RC4A 2YNEA 4B5OA 1NE9A 4UWIA 2FIWA 3S6KA 1IB1E 1YQEA 3KKWA 3SXNA 4H6ZA 1Z8WA 3IEHA 4HNWB 1X10A 2WCTA 5KTDA 3IU1A 4QB9A 4Y49C 4M3SA 1LANA 1IGBA 2VEZA 4ETJA 2J8RA 2OU2A 1AYEA 2RNKA 4KSFA 2EEEA 3JVNA 1KUXA 3FIXA 3EJGA 3D7FA 1L0CA 1MJAA 1LAMA 1QMUA 2EWBA 4CPAA 1R3NA 5HIHA 2V8VA 3FMCA 3FXTA 1CPSA 4UF4A 1XF8A 3WC7A 3GKRA 4XPLA 1YGHA 2ABZA 1S3ZA 3IIFA 4J4ZA 1GYTA 5HVGA 1BPMA 1ELLP 4OC3A 3V8IA 2Z3LA 2BL1A 4L8AA 2PJ5A 4NJQA 5HH1A 3RNZA 4J3GA 3TTHA 4ABLA 1P0HA 2V8HA 2PIZA 3E0KA 3FEDA 4MFJA 4UEFA 5CB3A 3D8PA 3VFQA 2X7BA 4JD6A 2DEAA 4M6GA 3FB3A 4HNYB 4KOTA 4QBJA 2ZW7A 5CNPA 1YW6A 2ZEFA 4O23A 5E96A 1NSLA 4I49A 3KQXA 2KCWA 1AUGA 3ETIA 2Z0ZA 4DUKA 3C26A 4KUBA 3GYAA 1M4IA 5DWNA 1M4DA 3KGQA 1YD9A 3SI2A 3BJ8A 4X2TA 4MFPA 5JM6A 4AVAA 2AFCA 3IIDA 1IOFA 3H5ZA 2V77A 1RXTA 4G1PA 5F46A 2RFHA 4R3KA 3T8WA 3FRMA 3IU2A 3NH5A 3TO7A 2OH1A 1SQHA 1TF9A 2FAVA 2QVPA 4UCNA 2VBQA 3TX8A 4A2ZA 4GVWA 2CNMA 2B4DA 5LYLA 4A39A 3PB6X 2PIYA 3DLJA 2IL4A 1CX8A 4A37A 1Y0RA 4CRZB 2O53A 3SJGA 4R6TA 1YX0A 4L89A 2PSWA 4JXQA 5D8NA 1IU8A 3RO0A 2YNDA 1S5KA 3FF3A 4QC6A 5I0CA 4ZY0A 2VZZA 3PBEA 2PJ8A 3G3SA 2DPTA 3IWWA 4UA3A 1WWZA 2Z3PA 1A2ZA 2JEVA 4OMEA 1P4NA 2JLMA 4EFDA 3TCVA 2OZGA 4IAVA 3JRUA 4Q7AA 2I79A 1KZFA 1Z9UA 3Q6ZA 2OZUA 2ZW5A 2ZOFA 3FYNA 4CYOA 3NA6A 2ZEOA 5K8PA 2OZHA 1R43A 2JBJA 4MY3A 4H2KA 4WJBA 3TFYA 5GCNA 4JVVA 3PRTA 1S7KA 4HKFA 4CAXA 3IWGA 3DR6A 3RZAA 3TOAA 4A95A 1Q2CA 3GLJA 2A4NA 3ZJ0A 2J8MA 5JPHA 1Q2YA 2G0BA 2JZEA 4DJLA 5EC4A 3D66A 2QMLA 5JGFA 3N5FA 4CYNA 2Z3MA 4F9UA 2HC9A 2NMTA 1HDQA 3K9UA 1Y9WA 4XPDB 4EWTA 1LFWA 3LWUA 2FG1A 3B2YA 4GUAA 3D2PA 2AFXA 3QAHA 4OAEA 3I1UA 4MHZA 3PBBA 4NGQA 1J4JA 6CPAA 2JZFA 4AG7A 2Z3NA 3GUXA 4PPZA 4JCAA 3EFAA 4KVXA 3SXOA 3TOBA 1OZPA 1HDUA 4FD5A 5K8OA 1HJZA 4H89A 2EK8A 4C2YA 4E2AA 1YREA 2JDCA 3IO1A 2ACFA 2F8HA 3SJEA 2QECA 3QNVA 4B11A 2ZEHA 1NMTA 1BPNA 4LQ6A 2FT0A 4U5YA 1VHUA 1ARLA 5AGEA 1ZR3A 4C7HA 4F6AA 4CAFA 4KYBA 3LD2A 5JQ4A 3VWDA 4MJ8A 3V2BA 2Q4YA 2D4PA 4OC5A 3B3TA 1Z8LA 1IYLA 2F5IA 4OIWA 4E8OA 4OLLA 1VKCA 4F9VA 1CJWA 2GU2A 1CM0A 3CPXA 2ZENA 1TKHA 1YR0A 1ZG8A 2PJ1A 1UWYA 1ZLIA 2PJCA 3HUVA 5F48A 2Q44A
chains in the Genus database with same CATH topology
2PJBA 5FSXA 5K8NA 4UIAA 1KWMA 4MHPA 1CPXA 4MMOA 1DE4C 5J1QA 3RAMA 2PRQA 2PJ0A 4X3RA 4JLLA 4YWYA 5ELYA 2CTBA 3GB0A 4IK2A 5HVFA 1ZG9A 3B3CA 1F2PA 1ARMA 2DX6A 4P4IA 1F57A 2O4HA 4PXCA 1RTQA 4YU9A 4OC0A 3FH4A 3MRUA 5LYDA 2JBKA 4GVVA 1IY7A 2PE3A 2C6CA 3D68A 4AXVA 2V8DA 4PXBA 2Q43A 3KHXA 3GPQA 3WC6A 3L2NA 5K8MA 4LQGA 4J5RA 3SI0A 4FBEA 4ZX8A 3LMSA 4B6ZA 4PXEA 2IMOA 2XEJA 2X47A 2PJ7A 1CBXA 4ZYQA 4PQAA 4P4FA 4MHNA 5F09A 4P44A 4OP4A 1FT7A 3EWPA 1Y7EA 4P4DA 3FVLA 1XBUA 1VGYA 4W9YA 5DUSA 1ZR5A 1YW4A 3IFEA 1YSJA 3WABA 1XRYA 3B35A 3PB8X 1LAPA 1Q7LA 4IHMA 5CB5A 2GLJA 4MRIA 3VARA 3K2KA 3SIHA 3SIGA 3HLPA 2WZNA 3SIJA 5JH9A 4FUUA 2ZEEA 5FSZA 2AFWA 3BI1A 4NJRA 2J9AA 4BD9A 2PVWA 4A38A 4WWVA 3S9LA 3GPGA 2C1CA 3NH4A 2BO9A 1DTDA 3H8GA 3VH9A 4MCPA 3EKEA 1Z2LA 4P6YA 3KR5A 3KI9A 3WT4A 3K9TA 3KL9A 4EMEA 3V38A 4NGRA 2ANPA 3PB9X 4J5QA 3H8EA 2PCUA 3CT9A 3RBUA 2PJ6A 4FAIA 5FSVA 4MHYA 1M4LA 5LYFA 1CG2A 1ZG7A 3EWQA 1XJOA 2NSMA 2F7VA 2AFSA 2JEWA 4OC1A 4NFRA 4MCSA 5LRGA 3B7IA 1XFOA 3KQZA 2C6GA 4JGKA 4P10A 3DGVA 3BI0A 2ZEGA 1H8LA 2IJZA 4IQYA 3EWOA 2Q4ZA 2RB7A 1TXZA 4FWUA 3SJXA 3GQEA 4ZI6A 5D29A 5I4MA 4P4JA 3EJFA 4P4BA 2IQ6A 2XEGA 3V7ZA 3FECA 4OIDA 3TC8A 2FXKA 3V45A 1BAVA 2XEFA 4OKOA 4ZY2A 4F8ZA 1TKFA 4X8IA 3SI1A 1NSAA 2OOTA 5DS0A 2BOAA 3GPOA 4UIBA 2AFZA 3KHZA 3KZWA 4A94A 3D7GA 3B3SA 5AILA 1VHOA 2CTCA 3ISXA 4UMLA 4ONWA 1LOKA 2PVVA 5E3BA 5LRKA 3CDXA 2BFRA 4UEZA 3S9MA 2PJ2A 3PB7X 1EE3P 2ZELA 2FVGA 2L8RA 3PB4X 3ISZA 5IB9A 2HB6A 4KSIA 3NH8A 5FSYA 2LGRA 1CP6A 3BXMA 1YLOA 3IC1A 3PEIA 3JZTA 3FX6A 4ETKA 1QQ9A 1TY8A 2XD7A 4UEEA 1PYTB 1VHEA 4R8FA 1JQGA 1TXRA 3WC5A 1XMBA 2OR4A 1SPVA 4OC2A 4MCQA 5HVHA 2GREA 1ZLHA 4J5SA 2PJ4A 2ZEMA 4NGNA 3KASA 1ELMP 1TF8A 3SJFA 3D4UA 4D86A 4K0CA 4NGSA 3GQOA 4TWEA 4TU0A 2NYQA 5LYIA 5CBMA 5THWA 3PFEA 2EK9A 1FNOA 3EW5A 5LRJA 1HEEA 4DYOA 3NFZA 2ZOGA 1CP7A 4K3NA 4P4EA 3Q71A 2BCOA 3B3WA 4NGTA 3IIBA 3SIIA 2ZEDA 5HOLA 4MXUA 2G9DA 1PCAA 2POKA 4R7MA 2Q51A 2WYRA 4ESSA 2PJ3A 2CIJA 2QYVA 8CPAA 3B3VA 3D67A 2C6PA 3PFOA 3EWRA 4ABKA 4GM5A 4OC4A 2AFUA 4PXDA 4Z65A 2V8GA 7CPAA 2VL1A 3VATA 3FJUA 2XEIA 2VRIA 2I3CA 2BFQA 3D7DA 3CPAA 3BHXA 3MN8A 1BLLE 2CF4A 4NGMA 4NGPA 1OBRA 4ZY1A 1NJRA 2PJ9A 3D7HA 2AFMA 2PJAA 2ZEPA 4RUHA 1YMEA 3S9NA 5CMSA 1VIXA 1F2OA 1Z5RA 4JYWA 5FSUA 2AFOA 1TKJA 5HXDA 1Y0YA 4MCRA 3KR4A 4P45A 5CPAA 3IJ3A 4ZX9A 3FEEA 1AMPA 4TNUA 2GLFA 1LCPA 4R76A 2QJ8A 4JZ0A 3H8FA 3IEHA 1LANA 1IGBA 4ETJA 1AYEA 2EEEA 3EJGA 3D7FA 1LAMA 1QMUA 2EWBA 4CPAA 2V8VA 1R3NA 5HIHA 3FMCA 1CPSA 4UF4A 3WC7A 2ABZA 3IIFA 4J4ZA 1GYTA 5HVGA 1BPMA 1ELLP 4OC3A 4NJQA 2PJ5A 4ABLA 2V8HA 3FEDA 2PIZA 4UEFA 5CB3A 3VFQA 2DEAA 1YW6A 2ZEFA 4O23A 3KQXA 3ETIA 4DUKA 3KGQA 1YD9A 3SI2A 4X2TA 5JM6A 2AFCA 3IIDA 2V77A 4G1PA 2RFHA 3T8WA 3NH5A 1TF9A 2FAVA 2QVPA 3TX8A 4GVWA 5LYLA 4A39A 3PB6X 2PIYA 3DLJA 1CX8A 4A37A 1Y0RA 2O53A 3SJGA 4R6TA 5D8NA 3FF3A 4ZY0A 3PBEA 2PJ8A 3IWWA 4OMEA 4EFDA 4IAVA 4Q7AA 3JRUA 3Q6ZA 2ZOFA 3NA6A 2ZEOA 5K8PA 1R43A 2JBJA 4H2KA 4WJBA 4JVVA 3PRTA 3RZAA 3GLJA 4DJLA 3D66A 5JGFA 3N5FA 4F9UA 2HC9A 1HDQA 4EWTA 1LFWA 3LWUA 2FG1A 3B2YA 4GUAA 2AFXA 3I1UA 4MHZA 3PBBA 4NGQA 6CPAA 3GUXA 4PPZA 4JCAA 1HDUA 5K8OA 1HJZA 2EK8A 3IO1A 2ACFA 2F8HA 3SJEA 3QNVA 2ZEHA 1BPNA 1VHUA 1ARLA 1ZR3A 4KYBA 3V2BA 4OC5A 3B3TA 1Z8LA 4OIWA 4F9VA 2GU2A 3CPXA 2ZENA 1TKHA 1ZG8A 2PJ1A 1UWYA 1ZLIA 2PJCA 3HUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJB A;  5FSX A;  5K8N A;  4UIA A;  1KWM A;  4MHP A;  1CPX A;  4MMO A;  1DE4 C;  5J1Q A;  3RAM A;  2PRQ A;  2PJ0 A;  4X3R A;  4JLL A;  4YWY A;  5ELY A;  2CTB A;  3GB0 A;  4IK2 A;  5HVF A;  1ZG9 A;  3B3C A;  1F2P A;  1ARM A;  2DX6 A;  4P4I A;  1F57 A;  2O4H A;  4PXC A;  1RTQ A;  4YU9 A;  4OC0 A;  3FH4 A;  3MRU A;  5LYD A;  2JBK A;  4GVV A;  1IY7 A;  2PE3 A;  2C6C A;  3D68 A;  4AXV A;  2V8D A;  4PXB A;  2Q43 A;  3KHX A;  3GPQ A;  3WC6 A;  3L2N A;  5K8M A;  4LQG A;  4J5R A;  3SI0 A;  4FBE A;  4ZX8 A;  3LMS A;  4B6Z A;  4PXE A;  2IMO A;  2XEJ A;  2X47 A;  2PJ7 A;  1CBX A;  4ZYQ A;  4PQA A;  4P4F A;  4MHN A;  5F09 A;  4P44 A;  4OP4 A;  1FT7 A;  3EWP A;  1Y7E A;  4P4D A;  3FVL A;  1XBU A;  1VGY A;  4W9Y A;  5DUS A;  1ZR5 A;  1YW4 A;  3IFE A;  1YSJ A;  3WAB A;  1XRY A;  3B35 A;  3PB8 X;  1LAP A;  1Q7L A;  4IHM A;  5CB5 A;  2GLJ A;  4MRI A;  3VAR A;  3K2K A;  3SIH A;  3SIG A;  3HLP A;  2WZN A;  3SIJ A;  5JH9 A;  4FUU A;  2ZEE A;  5FSZ A;  2AFW A;  3BI1 A;  4NJR A;  2J9A A;  4BD9 A;  2PVW A;  4A38 A;  4WWV A;  3S9L A;  3GPG A;  2C1C A;  3NH4 A;  2BO9 A;  1DTD A;  3H8G A;  3VH9 A;  4MCP A;  3EKE A;  1Z2L A;  4P6Y A;  3KR5 A;  3KI9 A;  3WT4 A;  3K9T A;  3KL9 A;  4EME A;  3V38 A;  4NGR A;  2ANP A;  3PB9 X;  4J5Q A;  3H8E A;  2PCU A;  3CT9 A;  3RBU A;  2PJ6 A;  4FAI A;  5FSV A;  4MHY A;  1M4L A;  5LYF A;  1CG2 A;  1ZG7 A;  3EWQ A;  1XJO A;  2NSM A;  2F7V A;  2AFS A;  2JEW A;  4OC1 A;  4NFR A;  4MCS A;  5LRG A;  3B7I A;  1XFO A;  3KQZ A;  2C6G A;  4JGK A;  4P10 A;  3DGV A;  3BI0 A;  2ZEG A;  1H8L A;  2IJZ A;  4IQY A;  3EWO A;  2Q4Z A;  2RB7 A;  1TXZ A;  4FWU A;  3SJX A;  3GQE A;  4ZI6 A;  5D29 A;  5I4M A;  4P4J A;  3EJF A;  4P4B A;  2IQ6 A;  2XEG A;  3V7Z A;  3FEC A;  4OID A;  3TC8 A;  2FXK A;  3V45 A;  1BAV A;  2XEF A;  4OKO A;  4ZY2 A;  4F8Z A;  1TKF A;  4X8I A;  3SI1 A;  1NSA A;  2OOT A;  5DS0 A;  2BOA A;  3GPO A;  4UIB A;  2AFZ A;  3KHZ A;  3KZW A;  4A94 A;  3D7G A;  3B3S A;  5AIL A;  1VHO A;  2CTC A;  3ISX A;  4UML A;  4ONW A;  1LOK A;  2PVV A;  5E3B A;  5LRK A;  3CDX A;  2BFR A;  4UEZ A;  3S9M A;  2PJ2 A;  3PB7 X;  1EE3 P;  2ZEL A;  2FVG A;  2L8R A;  3PB4 X;  3ISZ A;  5IB9 A;  2HB6 A;  4KSI A;  3NH8 A;  5FSY A;  2LGR A;  1CP6 A;  3BXM A;  1YLO A;  3IC1 A;  3PEI A;  3JZT A;  3FX6 A;  4ETK A;  1QQ9 A;  1TY8 A;  2XD7 A;  4UEE A;  1PYT B;  1VHE A;  4R8F A;  1JQG A;  1TXR A;  3WC5 A;  1XMB A;  2OR4 A;  1SPV A;  4OC2 A;  4MCQ A;  5HVH A;  2GRE A;  1ZLH A;  4J5S A;  2PJ4 A;  2ZEM A;  4NGN A;  3KAS A;  1ELM P;  1TF8 A;  3SJF A;  3D4U A;  4D86 A;  4K0C A;  4NGS A;  3GQO A;  4TWE A;  4TU0 A;  2NYQ A;  5LYI A;  5CBM A;  5THW A;  3PFE A;  2EK9 A;  1FNO A;  3EW5 A;  5LRJ A;  1HEE A;  4DYO A;  3NFZ A;  2ZOG A;  1CP7 A;  4K3N A;  4P4E A;  3Q71 A;  2BCO A;  3B3W A;  4NGT A;  3IIB A;  3SII A;  2ZED A;  5HOL A;  4MXU A;  2G9D A;  1PCA A;  2POK A;  4R7M A;  2Q51 A;  2WYR A;  4ESS A;  2PJ3 A;  2CIJ A;  2QYV A;  8CPA A;  3B3V A;  3D67 A;  2C6P A;  3PFO A;  3EWR A;  4ABK A;  4GM5 A;  4OC4 A;  2AFU A;  4PXD A;  4Z65 A;  2V8G A;  7CPA A;  2VL1 A;  3VAT A;  3FJU A;  2XEI A;  2VRI A;  2I3C A;  2BFQ A;  3D7D A;  3CPA A;  3BHX A;  3MN8 A;  1BLL E;  2CF4 A;  4NGM A;  4NGP A;  1OBR A;  4ZY1 A;  1NJR A;  2PJ9 A;  3D7H A;  2AFM A;  2PJA A;  2ZEP A;  4RUH A;  1YME A;  3S9N A;  5CMS A;  1VIX A;  1F2O A;  1Z5R A;  4JYW A;  5FSU A;  2AFO A;  1TKJ A;  5HXD A;  1Y0Y A;  4MCR A;  3KR4 A;  4P45 A;  5CPA A;  3IJ3 A;  4ZX9 A;  3FEE A;  1AMP A;  4TNU A;  2GLF A;  1LCP A;  4R76 A;  2QJ8 A;  4JZ0 A;  3H8F A;  3IEH A;  1LAN A;  1IGB A;  4ETJ A;  1AYE A;  2EEE A;  3EJG A;  3D7F A;  1LAM A;  1QMU A;  2EWB A;  4CPA A;  2V8V A;  1R3N A;  5HIH A;  3FMC A;  1CPS A;  4UF4 A;  3WC7 A;  2ABZ A;  3IIF A;  4J4Z A;  1GYT A;  5HVG A;  1BPM A;  1ELL P;  4OC3 A;  4NJQ A;  2PJ5 A;  4ABL A;  2V8H A;  3FED A;  2PIZ A;  4UEF A;  5CB3 A;  3VFQ A;  2DEA A;  1YW6 A;  2ZEF A;  4O23 A;  3KQX A;  3ETI A;  4DUK A;  3KGQ A;  1YD9 A;  3SI2 A;  4X2T A;  5JM6 A;  2AFC A;  3IID A;  2V77 A;  4G1P A;  2RFH A;  3T8W A;  3NH5 A;  1TF9 A;  2FAV A;  2QVP A;  3TX8 A;  4GVW A;  5LYL A;  4A39 A;  3PB6 X;  2PIY A;  3DLJ A;  1CX8 A;  4A37 A;  1Y0R A;  2O53 A;  3SJG A;  4R6T A;  5D8N A;  3FF3 A;  4ZY0 A;  3PBE A;  2PJ8 A;  3IWW A;  4OME A;  4EFD A;  4IAV A;  4Q7A A;  3JRU A;  3Q6Z A;  2ZOF A;  3NA6 A;  2ZEO A;  5K8P A;  1R43 A;  2JBJ A;  4H2K A;  4WJB A;  4JVV A;  3PRT A;  3RZA A;  3GLJ A;  4DJL A;  3D66 A;  5JGF A;  3N5F A;  4F9U A;  2HC9 A;  1HDQ A;  4EWT A;  1LFW A;  3LWU A;  2FG1 A;  3B2Y A;  4GUA A;  2AFX A;  3I1U A;  4MHZ A;  3PBB A;  4NGQ A;  6CPA A;  3GUX A;  4PPZ A;  4JCA A;  1HDU A;  5K8O A;  1HJZ A;  2EK8 A;  3IO1 A;  2ACF A;  2F8H A;  3SJE A;  3QNV A;  2ZEH A;  1BPN A;  1VHU A;  1ARL A;  1ZR3 A;  4KYB A;  3V2B A;  4OC5 A;  3B3T A;  1Z8L A;  4OIW A;  4F9V A;  2GU2 A;  3CPX A;  2ZEN A;  1TKH A;  1ZG8 A;  2PJ1 A;  1UWY A;  1ZLI A;  2PJC A;  3HUV A; 
#chains in the Genus database with same CATH topology
 4M6I A;  2C27 A;  1XIX A;  2CY2 A;  2PJB A;  5FSX A;  4Q38 A;  5K8N A;  4UIA A;  1KWM A;  4MHP A;  1CPX A;  4MMO A;  1DE4 C;  4KSA A;  3RAM A;  5J1Q A;  4B13 A;  2Y0M A;  1Z8T A;  2PRQ A;  3JTK A;  1I1D A;  2GFQ A;  4KS9 A;  3S6F A;  3TO9 A;  2PJ0 A;  4X3R A;  1Z4R A;  2REE A;  4JLL A;  5H84 A;  4YWY A;  2HQY A;  5HMN A;  5ELY A;  2CTB A;  2WSA A;  3GB0 A;  3PP9 A;  2Z10 A;  4IK2 A;  4MFQ A;  1M44 A;  1XOV A;  1ZG9 A;  3B3C A;  5HVF A;  1F2P A;  3CXS A;  1ARM A;  2DX6 A;  4P4I A;  2B5G A;  1F57 A;  2O4H A;  3FBU A;  4KLV A;  4MFL A;  1RTQ A;  4PXC A;  1R57 A;  4YU9 A;  2JZD A;  3W91 A;  4CAV A;  4ORF A;  4OC0 A;  5KTA A;  1IIC A;  2H5M A;  3FH4 A;  3MRU A;  5LYD A;  2JBK A;  3R9E A;  4EVY A;  4X5K A;  1XE4 A;  4RN7 A;  4KVM E;  5IV0 A;  5AG7 A;  4GVV A;  1IY7 A;  4KOU A;  2PE3 A;  3B8G A;  4MY0 A;  1Y9K A;  5AG5 A;  2C6C A;  3D68 A;  4AXV A;  5A27 A;  2V8D A;  4PXB A;  4UCP A;  4HNX B;  2Q43 A;  2DF5 A;  1QSN A;  4CAW A;  5G22 A;  4BMH A;  3KHX A;  4FD4 A;  3GPQ A;  3WC6 A;  4CS0 B;  5AG4 A;  1S7N A;  1Y7R A;  3L2N A;  5K8M A;  4LQG A;  4J5R A;  3SI0 A;  3RYO A;  2P0W A;  4AVC A;  4FBE A;  4ZX8 A;  3LMS A;  4B6Z A;  2B4B A;  4PXE A;  4IUS A;  2IMO A;  2XEJ A;  2X47 A;  2PJ7 A;  1CBX A;  4ZYQ A;  4PQA A;  4RI1 A;  4P4F A;  4MHN A;  5F09 A;  2BSW A;  1MJ9 A;  4OP4 A;  2R8V A;  1FT7 A;  4P44 A;  3EWP A;  1Y7E A;  4P4D A;  3OWC A;  4B5P A;  1I21 A;  1V0C A;  3QAY A;  1ZO0 A;  3FVL A;  1XBU A;  1X12 A;  5FVJ A;  2ATR A;  3I9S A;  1VGY A;  4W9Y A;  5DUS A;  3JUW A;  1ZR5 A;  4QUS A;  1YW4 A;  3IFE A;  2DXQ A;  3GY9 A;  1XMT A;  2GIV A;  4MHD A;  3T90 A;  1YSJ A;  4M85 A;  3WR7 A;  4B10 A;  3WAB A;  1XRY A;  3B35 A;  3PB8 X;  1LAP A;  5J8F A;  4CAE A;  5IB0 A;  2VI7 A;  2KQV A;  1Q7L A;  4IHM A;  5CB5 A;  2GLJ A;  4KZT A;  4MRI A;  2FXF A;  3VAR A;  5ISV A;  3K2K A;  3SIH A;  1QSM A;  1QSO A;  3SIG A;  3HLP A;  2WZN A;  3SIJ A;  5JH9 A;  4FUU A;  2ZEE A;  4CGL A;  4E0A A;  4JJX A;  5FSZ A;  4II9 A;  2AFW A;  3BI1 A;  4NJR A;  2J9A A;  4UBR A;  3EO4 A;  4BD9 A;  2PVW A;  4A38 A;  2Z3K A;  4WWV A;  3S9L A;  3GPG A;  2C1C A;  3NH4 A;  3F5B A;  2BO9 A;  1DTD A;  2REF A;  4PSX A;  3H8G A;  2Q4V A;  4MCP A;  3VH9 A;  3EKE A;  1KUY A;  1Z2L A;  2AJ6 A;  2PC1 A;  1IID A;  4P6Y A;  3KR5 A;  1JWQ A;  3R9G A;  3TE4 A;  3KI9 A;  3WT4 A;  3K9T A;  2FSR A;  2Q0Y A;  1YVO A;  3DDD A;  3KL9 A;  3UY5 A;  4C68 A;  2B4D B;  2WPW A;  3PGP A;  4YFJ A;  4EME A;  3R95 A;  4F0Y A;  3V38 A;  2EO8 A;  4NGR A;  2ANP A;  2YNC C;  3PB9 X;  4J5Q A;  3EY5 A;  1XEB A;  3H8E A;  3G8W A;  2PCU A;  3CT9 A;  3RBU A;  4C2X A;  1N71 A;  2PJ6 A;  4R3L A;  4FAI A;  4KOY A;  5FSV A;  2ZW4 A;  3FNC A;  4HPS A;  4MHY A;  1M4L A;  3BLN A;  2P6F A;  4JWP A;  4A32 A;  1YK3 A;  4XNH B;  5LYF A;  1CG2 A;  1ZG7 A;  3EWQ A;  2VXK A;  1MJB A;  2DPS A;  3W6X A;  1XJO A;  2NSM A;  3D3S A;  5DWM A;  4MFZ A;  4U9Y A;  3IGR A;  4F0X A;  2F7V A;  2AFS A;  2JEW A;  4OC1 A;  3VWE A;  4NFR A;  1Q2D A;  4MCS A;  1M1D A;  4AB7 A;  2G3A A;  5LRG A;  3B7I A;  1XFO A;  2G3T A;  3KQZ A;  2Q04 A;  2C6G A;  4JGK A;  3N7Z A;  4P10 A;  3DGV A;  3GIU A;  2K5T A;  2WUU A;  3BI0 A;  2CNS A;  2ZEG A;  1H8L A;  4NSQ A;  1K4J A;  3P2H A;  2IJZ A;  5BWA B;  4IQY A;  3EWO A;  4XPK A;  4CGO A;  4MI4 A;  1LRZ A;  2Q4Z A;  1U6M A;  2RB7 A;  1TXZ A;  4LUA A;  1ON0 A;  3LAC A;  4FWU A;  3SJX A;  3GQE A;  4ZI6 A;  5D29 A;  5I4M A;  4P4J A;  4IF5 A;  4CRY B;  2EVN A;  2VZY A;  4QVT A;  2FE7 A;  2P6G A;  3EJF A;  4P4B A;  4UFX A;  2IQ6 A;  2XEG A;  3V7Z A;  3FEC A;  4OID A;  1S7L A;  1VHS A;  3IWE A;  4KLW A;  3TC8 A;  2FXK A;  3V45 A;  1BAV A;  2XEF A;  3F8K A;  5F49 A;  4OKO A;  4ZY2 A;  2HV2 A;  3EC4 A;  4F8Z A;  3D2M A;  1TKF A;  4X8I A;  3SI1 A;  4C7I A;  2EUI A;  4ZBG A;  1NSA A;  3R96 A;  2OOT A;  5C88 A;  5DS0 A;  2BOA A;  3GPO A;  2PRB A;  4UIB A;  2AFZ A;  2CXA A;  2WPX A;  2ZPA A;  3KZW A;  3KHZ A;  4A94 A;  3D7G A;  3B3S A;  4M6H A;  5AIL A;  1VHO A;  3R1K A;  2CTC A;  3ISX A;  4UML A;  4ONW A;  1LOK A;  2PVV A;  4OAD A;  5E3B A;  4AVB A;  5LRK A;  1Z8X A;  1BO4 A;  2BFR A;  2GAN A;  3CDX A;  4UEZ A;  3S9M A;  2PDO A;  4MFK A;  4KOV A;  2PJ2 A;  3PB7 X;  4Y49 B;  4CGN A;  1EE3 P;  2ZEL A;  4PV6 A;  5EBV A;  1IOI A;  2PR1 A;  2FVG A;  4FD6 A;  1YLE A;  2D4O A;  5G1Z A;  2L8R A;  2Q7S A;  3PB4 X;  3ISZ A;  2B5G B;  5IB9 A;  2HB6 A;  4ZGY B;  4KSI A;  3NH8 A;  5FSY A;  2LGR A;  1CP6 A;  2P6E A;  3BXM A;  1YLO A;  4KOW A;  4GXH A;  3IC1 A;  3CXQ A;  3PEI A;  3S6H A;  2FS5 A;  1FY7 A;  4YGO A;  2W2G A;  3JZT A;  3FX6 A;  4ETK A;  1QQ9 A;  1TY8 A;  2ARH A;  4C2Z A;  2XD7 A;  1B6B A;  1TIQ A;  1PYT B;  4UFV A;  2I00 A;  2OB0 A;  4UEE A;  3ZZI A;  1VHE A;  2YGW A;  4NCZ A;  1JQG A;  1TXR A;  4R8F A;  3W6S A;  3NE7 A;  1XMB A;  3WC5 A;  2OR4 A;  4UFW A;  1SPV A;  2CNT A;  4NXY A;  4OC2 A;  2J8N A;  2Z3O A;  4MCQ A;  4K30 A;  4R87 A;  3T9Y A;  5HVH A;  5G21 A;  2GRE A;  1KUV A;  4H6U A;  4KOR A;  4CYP A;  1PU9 A;  1ZLH A;  4J5S A;  2PJ4 A;  2ZEM A;  1PUA A;  3R9F A;  4NGN A;  3KAS A;  1ELM P;  4UWJ A;  1TF8 A;  3SJF A;  2R98 A;  3D4U A;  4D86 A;  4K0C A;  4NGS A;  4BIN A;  3GQO A;  4TWE A;  4JXR A;  3DNS A;  1GHE A;  4NF1 A;  4UCM A;  1M4G A;  4B5P B;  3QB8 A;  4TU0 A;  2NYQ A;  4FD7 A;  5LYI A;  2FIA A;  5CBM A;  4ONU A;  3PFE A;  5THW A;  2Q7B A;  2EK9 A;  1FNO A;  1BOB A;  1RO5 A;  2AE6 A;  3I3G A;  2YNC A;  3EW5 A;  4PK2 A;  4XPD C;  5LRJ A;  3TT2 A;  1HEE A;  2ZXV A;  3NFZ A;  4DYO A;  2ZOG A;  4PSW A;  1I12 A;  5KTC A;  3EXN A;  1CP7 A;  4YRH A;  2HUZ A;  4K3N A;  4CYQ A;  4P4E A;  3Q71 A;  2BCO A;  2BUE A;  3B3W A;  2B3U A;  4NGT A;  2R7H A;  1Z4E A;  3IIB A;  3SII A;  2ZED A;  2FCK A;  5HOL A;  4XNH C;  2O28 A;  2B58 A;  4MXU A;  4A33 A;  2G9D A;  1PCA A;  2BEI A;  2POK A;  3CXP A;  4AG9 A;  2PQ8 A;  3CZX A;  3A9L A;  5IX3 A;  4R7M A;  2Q51 A;  1S60 A;  2WYR A;  4RS2 A;  4KUA A;  4ESS A;  2PJ3 A;  2CIJ A;  5J8C A;  1MK4 A;  2QYV A;  2ODF A;  2R1I A;  1S7F A;  2B3V A;  3B3V A;  4CGM A;  3DSB A;  8CPA A;  3D67 A;  2C6P A;  3DR8 A;  4GS4 A;  4KOS A;  4B14 A;  3PFO A;  3EWR A;  4ABK A;  1WK4 A;  4GM5 A;  4PK3 A;  2JDD A;  4OC4 A;  3MGD A;  5EMI A;  2AFU A;  4A30 A;  4PXD A;  4Z65 A;  2V8G A;  1QSR A;  4CGP A;  7CPA A;  2VL1 A;  3LOD A;  3VAT A;  4LX9 A;  3FJU A;  2XEI A;  2VRI A;  2I3C A;  2BFQ A;  4KOX A;  3PZJ A;  3D7D A;  3CPA A;  3BHX A;  3MN8 A;  3P2F A;  4KVO E;  5F47 A;  1BLL E;  2CF4 A;  4NGM A;  4R57 A;  4NGP A;  1OBR A;  4ZY1 A;  3H4Q A;  1NJR A;  2PJ9 A;  2Z11 A;  4Q36 A;  3F0A A;  3D7H A;  4JLY A;  1IYK A;  2AFM A;  3NE8 A;  2PR8 A;  1YVK A;  2PJA A;  4A31 A;  2ZEP A;  4RUH A;  1YME A;  3S9N A;  5CMS A;  5AG6 A;  4BBH A;  1B87 A;  1F2O A;  1VIX A;  1Z5R A;  4U9Z A;  4JYW A;  3SHP A;  5FSU A;  2EBJ A;  2AFO A;  1TKJ A;  3TO6 A;  4B12 A;  5A28 A;  5HXD A;  2GE3 A;  4DNC A;  1Y0Y A;  4MCR A;  3KR4 A;  3S6G A;  5C82 A;  4P45 A;  4R9M A;  3IJ3 A;  4ZX9 A;  5CPA A;  5H86 A;  3FEE A;  1AMP A;  4TNU A;  2GLF A;  2ZW6 A;  4MBU A;  1LCP A;  4R76 A;  2FL4 A;  2QIR A;  2QJ8 A;  4NEX A;  3BJ7 A;  5G20 A;  2VQY A;  4JZ0 A;  3H8F A;  1QST A;  1UFH A;  2RC4 A;  2YNE A;  4B5O A;  1NE9 A;  4UWI A;  2FIW A;  3S6K A;  1IB1 E;  1YQE A;  3KKW A;  3SXN A;  4H6Z A;  1Z8W A;  3IEH A;  4HNW B;  1X10 A;  2WCT A;  5KTD A;  3IU1 A;  4QB9 A;  4Y49 C;  4M3S A;  1LAN A;  1IGB A;  2VEZ A;  4ETJ A;  2J8R A;  2OU2 A;  1AYE A;  2RNK A;  4KSF A;  2EEE A;  3JVN A;  1KUX A;  3FIX A;  3EJG A;  3D7F A;  1L0C A;  1MJA A;  1LAM A;  1QMU A;  2EWB A;  4CPA A;  1R3N A;  5HIH A;  2V8V A;  3FMC A;  3FXT A;  1CPS A;  4UF4 A;  1XF8 A;  3WC7 A;  3GKR A;  4XPL A;  1YGH A;  2ABZ A;  1S3Z A;  3IIF A;  4J4Z A;  1GYT A;  5HVG A;  1BPM A;  1ELL P;  4OC3 A;  3V8I A;  2Z3L A;  2BL1 A;  4L8A A;  2PJ5 A;  4NJQ A;  5HH1 A;  3RNZ A;  4J3G A;  3TTH A;  4ABL A;  1P0H A;  2V8H A;  2PIZ A;  3E0K A;  3FED A;  4MFJ A;  4UEF A;  5CB3 A;  3D8P A;  3VFQ A;  2X7B A;  4JD6 A;  2DEA A;  4M6G A;  3FB3 A;  4HNY B;  4KOT A;  4QBJ A;  2ZW7 A;  5CNP A;  1YW6 A;  2ZEF A;  4O23 A;  5E96 A;  1NSL A;  4I49 A;  3KQX A;  2KCW A;  1AUG A;  3ETI A;  2Z0Z A;  4DUK A;  3C26 A;  4KUB A;  3GYA A;  1M4I A;  5DWN A;  1M4D A;  3KGQ A;  1YD9 A;  3SI2 A;  3BJ8 A;  4X2T A;  4MFP A;  5JM6 A;  4AVA A;  2AFC A;  3IID A;  1IOF A;  3H5Z A;  2V77 A;  1RXT A;  4G1P A;  5F46 A;  2RFH A;  4R3K A;  3T8W A;  3FRM A;  3IU2 A;  3NH5 A;  3TO7 A;  2OH1 A;  1SQH A;  1TF9 A;  2FAV A;  2QVP A;  4UCN A;  2VBQ A;  3TX8 A;  4A2Z A;  4GVW A;  2CNM A;  2B4D A;  5LYL A;  4A39 A;  3PB6 X;  2PIY A;  3DLJ A;  2IL4 A;  1CX8 A;  4A37 A;  1Y0R A;  4CRZ B;  2O53 A;  3SJG A;  4R6T A;  1YX0 A;  4L89 A;  2PSW A;  4JXQ A;  5D8N A;  1IU8 A;  3RO0 A;  2YND A;  1S5K A;  3FF3 A;  4QC6 A;  5I0C A;  4ZY0 A;  2VZZ A;  3PBE A;  2PJ8 A;  3G3S A;  2DPT A;  3IWW A;  4UA3 A;  1WWZ A;  2Z3P A;  1A2Z A;  2JEV A;  4OME A;  1P4N A;  2JLM A;  4EFD A;  3TCV A;  2OZG A;  4IAV A;  3JRU A;  4Q7A A;  2I79 A;  1KZF A;  1Z9U A;  3Q6Z A;  2OZU A;  2ZW5 A;  2ZOF A;  3FYN A;  4CYO A;  3NA6 A;  2ZEO A;  5K8P A;  2OZH A;  1R43 A;  2JBJ A;  4MY3 A;  4H2K A;  4WJB A;  3TFY A;  5GCN A;  4JVV A;  3PRT A;  1S7K A;  4HKF A;  4CAX A;  3IWG A;  3DR6 A;  3RZA A;  3TOA A;  4A95 A;  1Q2C A;  3GLJ A;  2A4N A;  3ZJ0 A;  2J8M A;  5JPH A;  1Q2Y A;  2G0B A;  2JZE A;  4DJL A;  5EC4 A;  3D66 A;  2QML A;  5JGF A;  3N5F A;  4CYN A;  2Z3M A;  4F9U A;  2HC9 A;  2NMT A;  1HDQ A;  3K9U A;  1Y9W A;  4XPD B;  4EWT A;  1LFW A;  3LWU A;  2FG1 A;  3B2Y A;  4GUA A;  3D2P A;  2AFX A;  3QAH A;  4OAE A;  3I1U A;  4MHZ A;  3PBB A;  4NGQ A;  1J4J A;  6CPA A;  2JZF A;  4AG7 A;  2Z3N A;  3GUX A;  4PPZ A;  4JCA A;  3EFA A;  4KVX A;  3SXO A;  3TOB A;  1OZP A;  1HDU A;  4FD5 A;  5K8O A;  1HJZ A;  4H89 A;  2EK8 A;  4C2Y A;  4E2A A;  1YRE A;  2JDC A;  3IO1 A;  2ACF A;  2F8H A;  3SJE A;  2QEC A;  3QNV A;  4B11 A;  2ZEH A;  1NMT A;  1BPN A;  4LQ6 A;  2FT0 A;  4U5Y A;  1VHU A;  1ARL A;  5AGE A;  1ZR3 A;  4C7H A;  4F6A A;  4CAF A;  4KYB A;  3LD2 A;  5JQ4 A;  3VWD A;  4MJ8 A;  3V2B A;  2Q4Y A;  2D4P A;  4OC5 A;  3B3T A;  1Z8L A;  1IYL A;  2F5I A;  4OIW A;  4E8O A;  4OLL A;  1VKC A;  4F9V A;  1CJW A;  2GU2 A;  1CM0 A;  3CPX A;  2ZEN A;  1TKH A;  1YR0 A;  1ZG8 A;  2PJ1 A;  1UWY A;  1ZLI A;  2PJC A;  3HUV A;  5F48 A;  2Q44 A; 
#chains in the Genus database with same CATH homology
 2PJB A;  5FSX A;  5K8N A;  4UIA A;  1KWM A;  4MHP A;  1CPX A;  4MMO A;  1DE4 C;  5J1Q A;  3RAM A;  2PRQ A;  2PJ0 A;  4X3R A;  4JLL A;  4YWY A;  5ELY A;  2CTB A;  3GB0 A;  4IK2 A;  5HVF A;  1ZG9 A;  3B3C A;  1F2P A;  1ARM A;  2DX6 A;  4P4I A;  1F57 A;  2O4H A;  4PXC A;  1RTQ A;  4YU9 A;  4OC0 A;  3FH4 A;  3MRU A;  5LYD A;  2JBK A;  4GVV A;  1IY7 A;  2PE3 A;  2C6C A;  3D68 A;  4AXV A;  2V8D A;  4PXB A;  2Q43 A;  3KHX A;  3GPQ A;  3WC6 A;  3L2N A;  5K8M A;  4LQG A;  4J5R A;  3SI0 A;  4FBE A;  4ZX8 A;  3LMS A;  4B6Z A;  4PXE A;  2IMO A;  2XEJ A;  2X47 A;  2PJ7 A;  1CBX A;  4ZYQ A;  4PQA A;  4P4F A;  4MHN A;  5F09 A;  4P44 A;  4OP4 A;  1FT7 A;  3EWP A;  1Y7E A;  4P4D A;  3FVL A;  1XBU A;  1VGY A;  4W9Y A;  5DUS A;  1ZR5 A;  1YW4 A;  3IFE A;  1YSJ A;  3WAB A;  1XRY A;  3B35 A;  3PB8 X;  1LAP A;  1Q7L A;  4IHM A;  5CB5 A;  2GLJ A;  4MRI A;  3VAR A;  3K2K A;  3SIH A;  3SIG A;  3HLP A;  2WZN A;  3SIJ A;  5JH9 A;  4FUU A;  2ZEE A;  5FSZ A;  2AFW A;  3BI1 A;  4NJR A;  2J9A A;  4BD9 A;  2PVW A;  4A38 A;  4WWV A;  3S9L A;  3GPG A;  2C1C A;  3NH4 A;  2BO9 A;  1DTD A;  3H8G A;  3VH9 A;  4MCP A;  3EKE A;  1Z2L A;  4P6Y A;  3KR5 A;  3KI9 A;  3WT4 A;  3K9T A;  3KL9 A;  4EME A;  3V38 A;  4NGR A;  2ANP A;  3PB9 X;  4J5Q A;  3H8E A;  2PCU A;  3CT9 A;  3RBU A;  2PJ6 A;  4FAI A;  5FSV A;  4MHY A;  1M4L A;  5LYF A;  1CG2 A;  1ZG7 A;  3EWQ A;  1XJO A;  2NSM A;  2F7V A;  2AFS A;  2JEW A;  4OC1 A;  4NFR A;  4MCS A;  5LRG A;  3B7I A;  1XFO A;  3KQZ A;  2C6G A;  4JGK A;  4P10 A;  3DGV A;  3BI0 A;  2ZEG A;  1H8L A;  2IJZ A;  4IQY A;  3EWO A;  2Q4Z A;  2RB7 A;  1TXZ A;  4FWU A;  3SJX A;  3GQE A;  4ZI6 A;  5D29 A;  5I4M A;  4P4J A;  3EJF A;  4P4B A;  2IQ6 A;  2XEG A;  3V7Z A;  3FEC A;  4OID A;  3TC8 A;  2FXK A;  3V45 A;  1BAV A;  2XEF A;  4OKO A;  4ZY2 A;  4F8Z A;  1TKF A;  4X8I A;  3SI1 A;  1NSA A;  2OOT A;  5DS0 A;  2BOA A;  3GPO A;  4UIB A;  2AFZ A;  3KHZ A;  3KZW A;  4A94 A;  3D7G A;  3B3S A;  5AIL A;  1VHO A;  2CTC A;  3ISX A;  4UML A;  4ONW A;  1LOK A;  2PVV A;  5E3B A;  5LRK A;  3CDX A;  2BFR A;  4UEZ A;  3S9M A;  2PJ2 A;  3PB7 X;  1EE3 P;  2ZEL A;  2FVG A;  2L8R A;  3PB4 X;  3ISZ A;  5IB9 A;  2HB6 A;  4KSI A;  3NH8 A;  5FSY A;  2LGR A;  1CP6 A;  3BXM A;  1YLO A;  3IC1 A;  3PEI A;  3JZT A;  3FX6 A;  4ETK A;  1QQ9 A;  1TY8 A;  2XD7 A;  4UEE A;  1PYT B;  1VHE A;  4R8F A;  1JQG A;  1TXR A;  3WC5 A;  1XMB A;  2OR4 A;  1SPV A;  4OC2 A;  4MCQ A;  5HVH A;  2GRE A;  1ZLH A;  4J5S A;  2PJ4 A;  2ZEM A;  4NGN A;  3KAS A;  1ELM P;  1TF8 A;  3SJF A;  3D4U A;  4D86 A;  4K0C A;  4NGS A;  3GQO A;  4TWE A;  4TU0 A;  2NYQ A;  5LYI A;  5CBM A;  5THW A;  3PFE A;  2EK9 A;  1FNO A;  3EW5 A;  5LRJ A;  1HEE A;  4DYO A;  3NFZ A;  2ZOG A;  1CP7 A;  4K3N A;  4P4E A;  3Q71 A;  2BCO A;  3B3W A;  4NGT A;  3IIB A;  3SII A;  2ZED A;  5HOL A;  4MXU A;  2G9D A;  1PCA A;  2POK A;  4R7M A;  2Q51 A;  2WYR A;  4ESS A;  2PJ3 A;  2CIJ A;  2QYV A;  8CPA A;  3B3V A;  3D67 A;  2C6P A;  3PFO A;  3EWR A;  4ABK A;  4GM5 A;  4OC4 A;  2AFU A;  4PXD A;  4Z65 A;  2V8G A;  7CPA A;  2VL1 A;  3VAT A;  3FJU A;  2XEI A;  2VRI A;  2I3C A;  2BFQ A;  3D7D A;  3CPA A;  3BHX A;  3MN8 A;  1BLL E;  2CF4 A;  4NGM A;  4NGP A;  1OBR A;  4ZY1 A;  1NJR A;  2PJ9 A;  3D7H A;  2AFM A;  2PJA A;  2ZEP A;  4RUH A;  1YME A;  3S9N A;  5CMS A;  1VIX A;  1F2O A;  1Z5R A;  4JYW A;  5FSU A;  2AFO A;  1TKJ A;  5HXD A;  1Y0Y A;  4MCR A;  3KR4 A;  4P45 A;  5CPA A;  3IJ3 A;  4ZX9 A;  3FEE A;  1AMP A;  4TNU A;  2GLF A;  1LCP A;  4R76 A;  2QJ8 A;  4JZ0 A;  3H8F A;  3IEH A;  1LAN A;  1IGB A;  4ETJ A;  1AYE A;  2EEE A;  3EJG A;  3D7F A;  1LAM A;  1QMU A;  2EWB A;  4CPA A;  2V8V A;  1R3N A;  5HIH A;  3FMC A;  1CPS A;  4UF4 A;  3WC7 A;  2ABZ A;  3IIF A;  4J4Z A;  1GYT A;  5HVG A;  1BPM A;  1ELL P;  4OC3 A;  4NJQ A;  2PJ5 A;  4ABL A;  2V8H A;  3FED A;  2PIZ A;  4UEF A;  5CB3 A;  3VFQ A;  2DEA A;  1YW6 A;  2ZEF A;  4O23 A;  3KQX A;  3ETI A;  4DUK A;  3KGQ A;  1YD9 A;  3SI2 A;  4X2T A;  5JM6 A;  2AFC A;  3IID A;  2V77 A;  4G1P A;  2RFH A;  3T8W A;  3NH5 A;  1TF9 A;  2FAV A;  2QVP A;  3TX8 A;  4GVW A;  5LYL A;  4A39 A;  3PB6 X;  2PIY A;  3DLJ A;  1CX8 A;  4A37 A;  1Y0R A;  2O53 A;  3SJG A;  4R6T A;  5D8N A;  3FF3 A;  4ZY0 A;  3PBE A;  2PJ8 A;  3IWW A;  4OME A;  4EFD A;  4IAV A;  4Q7A A;  3JRU A;  3Q6Z A;  2ZOF A;  3NA6 A;  2ZEO A;  5K8P A;  1R43 A;  2JBJ A;  4H2K A;  4WJB A;  4JVV A;  3PRT A;  3RZA A;  3GLJ A;  4DJL A;  3D66 A;  5JGF A;  3N5F A;  4F9U A;  2HC9 A;  1HDQ A;  4EWT A;  1LFW A;  3LWU A;  2FG1 A;  3B2Y A;  4GUA A;  2AFX A;  3I1U A;  4MHZ A;  3PBB A;  4NGQ A;  6CPA A;  3GUX A;  4PPZ A;  4JCA A;  1HDU A;  5K8O A;  1HJZ A;  2EK8 A;  3IO1 A;  2ACF A;  2F8H A;  3SJE A;  3QNV A;  2ZEH A;  1BPN A;  1VHU A;  1ARL A;  1ZR3 A;  4KYB A;  3V2B A;  4OC5 A;  3B3T A;  1Z8L A;  4OIW A;  4F9V A;  2GU2 A;  3CPX A;  2ZEN A;  1TKH A;  1ZG8 A;  2PJ1 A;  1UWY A;  1ZLI A;  2PJC A;  3HUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...