1LAPA

Molecular structure of leucine aminopeptidase at 2.7-angstroms resolution
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
484
structure length
481
Chain Sequence
TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase(alpha-aminoacylpeptide)
molecule keywords Cytosol aminopeptidase
publication title Molecular structure of leucine aminopeptidase at 2.7-A resolution.
pubmed doi rcsb
source organism Bos taurus
total genus 154
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1990-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lapA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lapA02
1ARMA 4ABLA 4FAIA 3KL9A 1Y7EA 2QVPA 3H8GA 5CB5A 3JRUA 4GUAA 2JBJA 5HVFA 2EWBA 3TC8A 1YD9A 2I3CA 1CPXA 2L8RA 3PB9X 2OR4A 3FH4A 2PVWA 4IHMA 5ELYA 5HXDA 1NJRA 4ETJA 2LGRA 2EK9A 2V8GA 3D7FA 4R76A 2XEIA 2V8DA 2PJBA 1TKJA 2JEWA 5LYFA 4WWVA 2BFQA 2V77A 3KI9A 3GUXA 4UMLA 4F8ZA 1LAMA 2POKA 2X47A 2NSMA 4MCPA 1Y0RA 3SI1A 2ZENA 1CPSA 3PBBA 4UEEA 4TU0A 1HDUA 1YW6A 4DJLA 3HLPA 3GB0A 2PJ4A 1OBRA 1LAPA 4PQAA 3VATA 1F2OA 3WC6A 3ISXA 5DUSA 2PJ7A 3RZAA 3PB7X 1ZG7A 4TWEA 4ZY0A 2HB6A 1AYEA 1FT7A 1Q7LA 1CBXA 1LCPA 3DGVA 4MXUA 1Z8LA 2FAVA 3BXMA 1VGYA 1DE4C 3RAMA 4R6TA 4NJRA 4P4EA 2BO9A 2Q4ZA 2ABZA 3B3VA 3L2NA 2BFRA 4X8IA 3JZTA 4OC5A 4P6YA 2PRQA 3CDXA 1TF9A 2C6CA 2GLFA 3IIFA 1IY7A 4YU9A 4OKOA 4OC0A 2CIJA 2G9DA 3NFZA 1F57A 4ZI6A 3SJFA 3NH5A 2PJ6A 3RBUA 2RFHA 3PFOA 3SI2A 3D66A 3QNVA 3KQZA 2BOAA 4Q7AA 1ZLIA 4JZ0A 4F9UA 2PJ1A 3VH9A 4FBEA 3PRTA 4FUUA 2GLJA 5K8OA 4P45A 1PYTB 5LRGA 3KHXA 3ISZA 1H8LA 2FXKA 3V2BA 3NA6A 3I1UA 3EWPA 1SPVA 1IGBA 1ZR3A 3S9NA 1HDQA 2GU2A 4WJBA 3SIGA 4NGSA 3V45A 1EE3P 1HEEA 2C6PA 4OC3A 5D8NA 3IIDA 1YW4A 2J9AA 3EWOA 4JGKA 2AFMA 3BI1A 4K3NA 3T8WA 3EJFA 2EEEA 4LQGA 4CPAA 2CTBA 2XEJA 3SIIA 2EK8A 3IC1A 4X2TA 4J4ZA 2FG1A 4ETKA 2ZEFA 2O4HA 4MMOA 3S9MA 2IMOA 2ANPA 4JCAA 4OIWA 3IWWA 4BD9A 2QJ8A 2ZEEA 1BPMA 2O53A 2ZEGA 3IO1A 4ZX9A 3K9TA 1KWMA 2CF4A 4ZY1A 4PXDA 1YSJA 4PPZA 4F9VA 1ZG8A 5K8NA 1TF8A 4EWTA 4UIAA 1VIXA 3H8EA 5LYLA 1TY8A 1YMEA 4W9YA 3BHXA 5FSYA 5K8MA 3SIHA 3IFEA 1NSAA 3KZWA 4ZY2A 5HVHA 1RTQA 4NGRA 4UEZA 3CPAA 4JYWA 4AXVA 3MN8A 4IQYA 1F2PA 2ACFA 2VRIA 3WABA 2AFUA 4RUHA 2JBKA 1UWYA 2IJZA 1R3NA 2DEAA 1ELLP 3GQEA 3KR4A 3NH4A 4A38A 2ZEPA 1M4LA 3EWRA 3CPXA 2WYRA 3D7DA 4OC4A 2HC9A 2IQ6A 4KSIA 3WT4A 3SJGA 4NJQA 4P4BA 5CBMA 2AFOA 2XEFA 4MCRA 2PJ3A 1BLLE 3FEDA 5FSUA 3D4UA 4JVVA 4FWUA 4MCQA 5HIHA 5JGFA 3DLJA 3KQXA 2ZOGA 2PIZA 5CPAA 2AFWA 4R8FA 4OIDA 2ZEDA 4K0CA 2AFZA 5CB3A 2ZEHA 1YLOA 3Q71A 1BAVA 3PBEA 4OMEA 4PXCA 4MHYA 3B35A 3GPQA 2PJ8A 3KHZA 5FSXA 4NFRA 3B3WA 2ZELA 3EW5A 2ZEOA 2DX6A 6CPAA 4J5RA 3GPGA 1CP6A 4MHNA 3D7GA 5K8PA 1TXRA 2C6GA 2Q51A 4IK2A 4P4IA 4OC2A 3GQOA 2QYVA 3FMCA 1LANA 3D7HA 2AFCA 3FEEA 2FVGA 5D29A 3SJEA 5LRKA 3S9LA 3SJXA 3B3SA 3SI0A 4ZX8A 2V8VA 4D86A 1DTDA 4H2KA 4OC1A 4ESSA 1ZR5A 3V38A 1ZLHA 4GVVA 1XFOA 5F09A 3B7IA 3FECA 4YWYA 4DYOA 4P10A 3H8FA 4Z65A 5FSZA 2CTCA 4KYBA 2PJ5A 2PJ2A 5FSVA 1BPNA 3PB4X 3NH8A 4A94A 2F8HA 2XD7A 1TKHA 4P4FA 3LMSA 2PJ0A 3B3CA 2PVVA 4MHPA 3HUVA 3GLJA 5HVGA 1ELMP 1PCAA 4IAVA 4ABKA 2OOTA 2NYQA 3BI0A 2F7VA 3GPOA 3IIBA 4NGNA 3EWQA 2VL1A 1VHEA 2XEGA 4UIBA 4NGQA 4UF4A 3KASA 4R7MA 1TXZA 2PJAA 5LYDA 4MHZA 1LFWA 3PFEA 4NGTA 1TKFA 1LOKA 3WC5A 4DUKA 1HJZA 1Y0YA 1FNOA 1GYTA 3K2KA 4TNUA 3FX6A 5JM6A 5I4MA 3B2YA 5E3BA 3D67A 1CX8A 2ZOFA 3EKEA 3CT9A 1R43A 1ARLA 5JH9A 4MRIA 1XRYA 3IJ3A 4EMEA 4X3RA 5LRJA 4P4JA 4P44A 3LWUA 1QMUA 2AFXA 2PE3A 8CPAA 4PXEA 4EFDA 3VFQA 5AILA 1Z5RA 2GREA 3B3TA 3FVLA 2AFSA 4NGPA 4JLLA 4A37A 5CMSA 4ONWA 2PJCA 2RB7A 4P4DA 4G1PA 1VHOA 1ZG9A 3FF3A 1Z2LA 4MCSA 3PEIA 4ZYQA 3V7ZA 1CG2A 2BCOA 1XBUA 3KGQA 1JQGA 3WC7A 5THWA 3ETIA 5IB9A 4GVWA 1XMBA 4NGMA 3FJUA 4OP4A 2WZNA 4O23A 5DS0A 3KR5A 5J1QA 3MRUA 5HOLA 5LYIA 2C1CA 3SIJA 7CPAA 4J5QA 3N5FA 2PIYA 3D68A 4PXBA 3PB8X 3VARA 1QQ9A 4A39A 3TX8A 2PJ9A 1VHUA 1CP7A 3IEHA 1AMPA 3EJGA 3PB6X 4B6ZA 1XJOA 2PCUA 2V8HA 2ZEMA 4J5SA 3Q6ZA 2Q43A 4UEFA 4GM5A
chains in the Genus database with same CATH superfamily
1ARMA 1AUGA 4ABLA 3TCVA 3QB8A 1XMTA 4KSFA 4FAIA 3S6FA 2PQ8A 3KL9A 1Y7EA 2QVPA 3H8GA 4HNXB 5CB5A 3JRUA 4GUAA 2JBJA 2VI7A 4B13A 1YR0A 5HVFA 2EWBA 3TC8A 1YD9A 2I3CA 4F0XA 1CPXA 2L8RA 3PB9X 2OR4A 4OAEA 1IB1E 2PVWA 3FH4A 4IHMA 5ELYA 3T90A 5HXDA 5C82A 1NJRA 2DF5A 4ETJA 4KOSA 4UWIA 2VZYA 3R96A 2LGRA 2EK9A 3IWEA 5CNPA 2V8GA 3KKWA 3D7FA 4R76A 4KUBA 4PV6A 4QB9A 2XEIA 2V8DA 2Q44A 3BJ8A 4MFLA 4C7IA 2PJBA 3SHPA 4JXQA 4MY3A 1S60A 4LUAA 4XNHC 1L0CA 1XF8A 1TKJA 2JEWA 4UWJA 5LYFA 3IU1A 4WWVA 2BFQA 2V77A 4M6IA 3KI9A 3EO4A 4CGNA 4CGPA 3GUXA 4UMLA 1KZFA 4C2XA 4F8ZA 1LAMA 2POKA 1P0HA 2ZW4A 2X47A 2NSMA 4MCPA 1Y0RA 3SI1A 2ZENA 4B5PB 4CGOA 1CPSA 2JEVA 2A4NA 2Q0YA 3PBBA 2Q4VA 4TU0A 1HDUA 1YW6A 4UEEA 4DJLA 4H89A 3HLPA 4RN7A 4CYOA 2J8RA 3GB0A 2PJ4A 1OBRA 1IYKA 1LAPA 2Z11A 2ZW6A 4PQAA 4I49A 1NMTA 5AG7A 1F2OA 2W2GA 3RYOA 1OZPA 2B58A 3VATA 2EUIA 2OB0A 5F47A 3WC6A 3ISXA 5H84A 5DUSA 4Y49C 5KTAA 3K9UA 3PGPA 2PR1A 2PJ7A 2RC4A 3PB7X 3RZAA 3EXNA 2K5TA 2Q7BA 4J5SA 1ZG7A 2DXQA 4TWEA 4F0YA 4ZY0A 1Q2CA 5IX3A 3A9LA 2EO8A 1AYEA 2EVNA 1FT7A 2HB6A 1Q7LA 1CBXA 1LCPA 1QSRA 2OU2A 1Z8LA 3DGVA 4MXUA 4ZBGA 4A33A 2FAVA 1XE4A 3BXMA 1VGYA 1DE4C 3D8PA 3RAMA 5H86A 4R6TA 4CYPA 4NJRA 5EBVA 1WK4A 1M4GA 5EMIA 1Z8XA 4P4EA 2BO9A 2G0BA 2Q4ZA 3GY9A 1VHSA 2ABZA 3B3VA 3L2NA 4NCZA 2ZW5A 3JVNA 2BFRA 4X8IA 3JZTA 4OC5A 4P6YA 2PRQA 2P6FA 3R1KA 3W6XA 2B4DA 4CYQA 3CDXA 1TF9A 2ZW7A 5AG6A 1QSMA 2C6CA 2GLFA 3IIFA 2Z10A 2FCKA 3I3GA 1IY7A 2BUEA 4YU9A 3LACA 1I1DA 4OKOA 2CIJA 2G9DA 2RNKA 4OC0A 3NFZA 4AVBA 1F57A 2YNCA 4ZI6A 2P0WA 3FIXA 3SJFA 3NH5A 1S3ZA 2YNCC 2D4PA 4AG7A 5I0CA 2PJ6A 4FD5A 2RFHA 3PFOA 3RBUA 4RS2A 3SI2A 3D66A 2BEIA 3QNVA 3KQZA 2BOAA 5KTDA 4Q7AA 1ZLIA 4JZ0A 4F9UA 4MFJA 3TE4A 2PJ1A 3FYNA 1Y9WA 3VH9A 4E2AA 4FBEA 4FD7A 4NEXA 2OZGA 3PRTA 4FUUA 4AVCA 2GLJA 5A27A 5K8OA 4P45A 1PYTB 1QSOA 5LRGA 4J3GA 4B14A 2J8MA 3KHXA 2NMTA 3ISZA 1H8LA 2H5MA 3MGDA 3T9YA 2FXKA 3V2BA 3NA6A 3I1UA 4NSQA 2FXFA 4C2YA 4M85A 2B4BA 2Z3NA 3EWPA 2F5IA 4R57A 5IV0A 1SPVA 1IGBA 1ZR3A 3S9NA 3PP9A 4KZTA 1WWZA 3TO6A 4HKFA 1HDQA 2GU2A 4WJBA 3SIGA 2QECA 4R9MA 3NE8A 4NGSA 3V45A 1EE3P 5A28A 1HEEA 3ZZIA 5HMNA 2X7BA 2C6PA 3G8WA 4PSWA 4R87A 4OC3A 5D8NA 1XEBA 1BO4A 4MFQA 4KVXA 3IIDA 2JZFA 1YW4A 2J9AA 3EWOA 4JGKA 2PC1A 3FBUA 4CYNA 2AFMA 4HNWB 4UA3A 3BI1A 4K3NA 3T8WA 4YRHA 4MFZA 3EJFA 2AJ6A 2EEEA 3V8IA 4LQGA 3S6KA 2CTBA 4UCNA 4CPAA 2I00A 4B12A 2XEJA 3SIIA 1YVKA 2EK8A 3R95A 3IC1A 3VWEA 2OZUA 4X2TA 4XPKA 4OLLA 4J4ZA 2GFQA 1NSLA 4A30A 2ZPAA 2FG1A 4ETKA 4R3KA 1IU8A 1GHEA 2CNMA 2O4HA 2ZEFA 4MJ8A 4MMOA 3S9MA 2IMOA 2ANPA 4JCAA 4OIWA 1RXTA 4JJXA 5AG5A 2FS5A 4XPDC 2B4DB 2FIAA 2FL4A 3IWWA 1B6BA 2Q7SA 4LQ6A 2P6GA 4PK3A 4XPLA 2QJ8A 3R9EA 1VKCA 2ZEEA 3SXNA 1BPMA 2O53A 2ZEGA 4ZGYB 3IO1A 4ZX9A 1YX0A 3K9TA 1UFHA 2FSRA 2PR8A 3S6HA 3SXOA 2REFA 4YFJA 1KWMA 2CF4A 4ZY1A 3CXSA 1YSJA 3GYAA 4MFKA 4PPZA 4PXDA 4F9VA 1ZG8A 3PZJA 3LODA 3FNCA 3TT2A 2CNTA 3W91A 5K8NA 4B10A 1TF8A 4EWTA 4UIAA 1VIXA 2AE6A 3H8EA 2VEZA 1TY8A 1YMEA 5LYLA 4KOWA 2YNEA 4W9YA 4GXHA 3BHXA 2GE3A 1IIDA 5FSYA 3IGRA 5K8MA 2Q04A 3SIHA 3IFEA 2B3VA 1NSAA 3KZWA 4ZY2A 5HVHA 4A32A 4B11A 2WPXA 1RTQA 2KQVA 4NGRA 1P4NA 1FY7A 4UBRA 3CPAA 2I79A 2G3TA 3F5BA 4UEZA 4UFVA 4JYWA 3S6GA 2B5GB 5G21A 4E8OA 1V0CA 4FD4A 4UFXA 4AXVA 5JQ4A 3MN8A 4IQYA 2HV2A 1F2PA 4MHDA 2BSWA 3DR8A 4KOXA 4GS4A 2ACFA 2VRIA 3WABA 1YVOA 3OWCA 3F0AA 4K30A 2AFUA 4RUHA 2JBKA 1Q2DA 1YGHA 1UWYA 4OADA 1R3NA 2IJZA 2DPSA 2DEAA 4Q38A 5JPHA 1ELLP 3GQEA 3KR4A 2CY2A 3NH4A 2ZEPA 4MFPA 4A38A 1M4LA 3EWRA 4U9ZA 1CM0A 4CAEA 3CPXA 2WYRA 3D7DA 1PUAA 4OC4A 2HC9A 5GCNA 4AB7A 2YGWA 1Y9KA 1MJBA 1J4JA 4KSIA 2IQ6A 2BL1A 4YGOA 3SJGA 4PK2A 3WT4A 4BINA 4NJQA 4P4BA 5CBMA 2JZEA 1IICA 4Q36A 2AFOA 3CXQA 1M1DA 2XEFA 2HQYA 3TTHA 2FIWA 2PJ3A 1BLLE 3FEDA 4MCRA 3RNZA 5FSUA 4JLYA 4C7HA 1Z8WA 4JVVA 3D4UA 4FWUA 2IL4A 4MCQA 5HIHA 5JGFA 3DLJA 3KQXA 2ZOGA 1X12A 4C2ZA 1MK4A 2EBJA 2PIZA 4H6ZA 5CPAA 1K4JA 1YQEA 2AFWA 3DR6A 4R8FA 4LX9A 4XNHB 1B87A 4OIDA 2ZEDA 2ZXVA 4MI4A 4K0CA 1BOBA 2AFZA 5CB3A 1IYLA 4ONUA 2ZEHA 1YLOA 5J8FA 2Z3KA 3C26A 3GIUA 3Q71A 2GANA 1RO5A 1BAVA 2VZZA 3N7ZA 1Z9UA 3PBEA 1Y7RA 4OMEA 4PXCA 4MHYA 3B35A 3GPQA 1IOFA 2D4OA 2HUZA 2PJ8A 5FSXA 3KHZA 4KS9A 3B3WA 1S7LA 2ZELA 4NFRA 2R98A 3R9GA 4BBHA 3EW5A 2ZEOA 2DX6A 4CAFA 4Y49B 2WCTA 4J5RA 2R8VA 4NXYA 6CPAA 3GPGA 1CP6A 1S7NA 4MHNA 3W6SA 1YLEA 3G3SA 5IB0A 4A2ZA 2CNSA 2Q4YA 1M4DA 3D7GA 4CAWA 5K8PA 4HPSA 4AVAA 1TXRA 1XOVA 2C6GA 2Q51A 4IK2A 4P4IA 1Z4EA 4C68A 4OC2A 3GQOA 4KUAA 1KUXA 2QYVA 4L89A 2R7HA 3EC4A 3FMCA 1LANA 1YREA 3D7HA 2AFCA 3FEEA 2FVGA 4H6UA 5D29A 3SJEA 4KOTA 5LRKA 3S9LA 4QUSA 3B3SA 3SJXA 3SI0A 2KCWA 3QAHA 2PRBA 4ZX8A 1ZO0A 2V8VA 1MJAA 4D86A 1DTDA 2Z3MA 4H2KA 1TIQA 4IF5A 2OH1A 4OC1A 5G20A 4KORA 5F46A 4ESSA 1ZR5A 3V38A 3CXPA 1ZLHA 4GVVA 4MY0A 4A31A 1XFOA 2ATRA 2Z3PA 2G3AA 3B7IA 3FECA 4YWYA 3VWDA 5F09A 4IUSA 4DYOA 1KUVA 1S7FA 5G1ZA 4P10A 3H8FA 2Y0MA 4Z65A 5FSZA 2CTCA 2O28A 4KVME 4CGLA 4KYBA 2PJ5A 2PJ2A 4CRZB 5FSVA 1BPNA 5ISVA 3PB4X 4U5YA 1X10A 3NH8A 5EC4A 4A94A 2F8HA 2XD7A 1TKHA 5AGEA 4P4FA 3LMSA 2PJ0A 3B3CA 2PVVA 2VXKA 3P2HA 4MHPA 3HUVA 4EVYA 2QIRA 3GLJA 5HVGA 1ELMP 1ON0A 1PCAA 5KTCA 3B8GA 3TOAA 4IAVA 4R3LA 4ABKA 2ARHA 5DWMA 2OOTA 2NYQA 3BI0A 2F7VA 1R57A 1U6MA 2FE7A 4DNCA 3EY5A 3GPOA 2VQYA 3IIBA 3TOBA 3D3SA 4CAXA 3P2FA 4KVOE 3FXTA 4JXRA 4NGNA 3EWQA 3R9FA 3TO7A 1M4IA 3CZXA 2VL1A 4A95A 3I9SA 1A2ZA 1VHEA 2XEGA 3FB3A 2REEA 4MBUA 4UIBA 5E96A 4NGQA 4UF4A 2WSAA 3H4QA 3KASA 4R7MA 4CGMA 1TXZA 2PJAA 5LYDA 4MHZA 2DPTA 1LFWA 3PFEA 4UFWA 3BLNA 4NGTA 1NE9A 1TKFA 2B3UA 2VBQA 5HH1A 4KOUA 1LOKA 3EFAA 5J8CA 3JUWA 3WC5A 4DUKA 2JDCA 1HJZA 1Y0YA 1S5KA 4RI1A 3WR7A 2Z3OA 1FNOA 1PU9A 3LD2A 4KOYA 4KOVA 3IU2A 4UCMA 1GYTA 2OZHA 4HNYB 3DNSA 1M44A 3K2KA 4KLVA 2JZDA 4TNUA 3FX6A 5JM6A 4AG9A 5I4MA 2C27A 3F8KA 3B2YA 5E3BA 3D67A 1CX8A 1I12A 3DDDA 4UCPA 2J8NA 1I21A 1Z4RA 1QSTA 3IWGA 2ZOFA 3EKEA 3CT9A 1R43A 1ARLA 5G22A 1IOIA 3ZJ0A 5JH9A 4MRIA 4L8AA 1XRYA 3IJ3A 1XIXA 4EMEA 4X3RA 5LRJA 4M6HA 1YK3A 4P44A 4P4JA 3LWUA 4XPDB 5DWNA 1QMUA 2AFXA 1N71A 2PE3A 8CPAA 4PXEA 4M6GA 4KSAA 4EFDA 2P6EA 4QC6A 3VFQA 4X5KA 3UY5A 2CXAA 5AILA 1Z5RA 2GREA 3B3TA 3E0KA 3FVLA 2AFSA 4M3SA 3D2PA 4ORFA 2QMLA 4JLLA 4NGPA 4FD6A 4A37A 2Z3LA 5CMSA 4BMHA 4ONWA 5BWAB 2PJCA 2RB7A 3FRMA 4G1PA 4P4DA 4E0AA 2WUUA 3H5ZA 4II9A 1VHOA 2R1IA 1ZG9A 3DSBA 4CS0B 3FF3A 1Z2LA 4MCSA 4B5PA 3PEIA 1MJ9A 4ZYQA 2GIVA 4PSXA 4QVTA 3V7ZA 1CG2A 4QBJA 3QAYA 4NF1A 2BCOA 1XBUA 3KGQA 5F48A 4B5OA 5AG4A 5F49A 1JQGA 3RO0A 3WC7A 2Z0ZA 1KUYA 1SQHA 3JTKA 2PSWA 3ETIA 5THWA 5IB9A 2JLMA 4GVWA 1XMBA 4NGMA 3FJUA 4OP4A 2YNDA 4CRYB 2WZNA 4O23A 5DS0A 3KR5A 5J1QA 3MRUA 5HOLA 3TO9A 4F6AA 3GKRA 2ODFA 2C1CA 5LYIA 3SIJA 2FT0A 4J5QA 3N5FA 7CPAA 1QSNA 2B5GA 2PIYA 3D2MA 3D68A 1JWQA 4PXBA 2PDOA 3PB8X 3VARA 4CAVA 1QQ9A 4U9YA 2JDDA 4A39A 1S7KA 3BJ7A 1Q2YA 3TX8A 2WPWA 2PJ9A 1VHUA 1CP7A 1LRZA 1AMPA 3IEHA 3TFYA 1CJWA 3EJGA 3PB6X 4BD9A 4B6ZA 1XJOA 2PCUA 5FVJA 2V8HA 2ZEMA 4JD6A 4KLWA 5C88A 3NE7A 1Z8TA 3Q6ZA 2Q43A 4UEFA 4JWPA 4GM5A
chains in the Genus database with same CATH topology
1ARMA 4ABLA 4FAIA 3KL9A 1Y7EA 2QVPA 3H8GA 5CB5A 3JRUA 4GUAA 2JBJA 5HVFA 2EWBA 3TC8A 1YD9A 2I3CA 1CPXA 2L8RA 3PB9X 2OR4A 3FH4A 2PVWA 4IHMA 5ELYA 5HXDA 1NJRA 4ETJA 2LGRA 2EK9A 2V8GA 3D7FA 4R76A 2XEIA 2V8DA 2PJBA 1TKJA 2JEWA 5LYFA 4WWVA 2BFQA 2V77A 3KI9A 3GUXA 4UMLA 4F8ZA 1LAMA 2POKA 2X47A 2NSMA 4MCPA 1Y0RA 3SI1A 2ZENA 1CPSA 3PBBA 4UEEA 4TU0A 1HDUA 1YW6A 4DJLA 3HLPA 3GB0A 2PJ4A 1OBRA 1LAPA 4PQAA 3VATA 1F2OA 3WC6A 3ISXA 5DUSA 2PJ7A 3RZAA 3PB7X 1ZG7A 4TWEA 4ZY0A 2HB6A 1AYEA 1FT7A 1Q7LA 1CBXA 1LCPA 3DGVA 4MXUA 1Z8LA 2FAVA 3BXMA 1VGYA 1DE4C 3RAMA 4R6TA 4NJRA 4P4EA 2BO9A 2Q4ZA 2ABZA 3B3VA 3L2NA 2BFRA 4X8IA 3JZTA 4OC5A 4P6YA 2PRQA 3CDXA 1TF9A 2C6CA 2GLFA 3IIFA 1IY7A 4YU9A 4OKOA 4OC0A 2CIJA 2G9DA 3NFZA 1F57A 4ZI6A 3SJFA 3NH5A 2PJ6A 3RBUA 2RFHA 3PFOA 3SI2A 3D66A 3QNVA 3KQZA 2BOAA 4Q7AA 1ZLIA 4JZ0A 4F9UA 2PJ1A 3VH9A 4FBEA 3PRTA 4FUUA 2GLJA 5K8OA 4P45A 1PYTB 5LRGA 3KHXA 3ISZA 1H8LA 2FXKA 3V2BA 3NA6A 3I1UA 3EWPA 1SPVA 1IGBA 1ZR3A 3S9NA 1HDQA 2GU2A 4WJBA 3SIGA 4NGSA 3V45A 1EE3P 1HEEA 2C6PA 4OC3A 5D8NA 3IIDA 1YW4A 2J9AA 3EWOA 4JGKA 2AFMA 3BI1A 4K3NA 3T8WA 3EJFA 2EEEA 4LQGA 4CPAA 2CTBA 2XEJA 3SIIA 2EK8A 3IC1A 4X2TA 4J4ZA 2FG1A 4ETKA 2ZEFA 2O4HA 4MMOA 3S9MA 2IMOA 2ANPA 4JCAA 4OIWA 3IWWA 4BD9A 2QJ8A 2ZEEA 1BPMA 2O53A 2ZEGA 3IO1A 4ZX9A 3K9TA 1KWMA 2CF4A 4ZY1A 4PXDA 1YSJA 4PPZA 4F9VA 1ZG8A 5K8NA 1TF8A 4EWTA 4UIAA 1VIXA 3H8EA 5LYLA 1TY8A 1YMEA 4W9YA 3BHXA 5FSYA 5K8MA 3SIHA 3IFEA 1NSAA 3KZWA 4ZY2A 5HVHA 1RTQA 4NGRA 4UEZA 3CPAA 4JYWA 4AXVA 3MN8A 4IQYA 1F2PA 2ACFA 2VRIA 3WABA 2AFUA 4RUHA 2JBKA 1UWYA 2IJZA 1R3NA 2DEAA 1ELLP 3GQEA 3KR4A 3NH4A 4A38A 2ZEPA 1M4LA 3EWRA 3CPXA 2WYRA 3D7DA 4OC4A 2HC9A 2IQ6A 4KSIA 3WT4A 3SJGA 4NJQA 4P4BA 5CBMA 2AFOA 2XEFA 4MCRA 2PJ3A 1BLLE 3FEDA 5FSUA 3D4UA 4JVVA 4FWUA 4MCQA 5HIHA 5JGFA 3DLJA 3KQXA 2ZOGA 2PIZA 5CPAA 2AFWA 4R8FA 4OIDA 2ZEDA 4K0CA 2AFZA 5CB3A 2ZEHA 1YLOA 3Q71A 1BAVA 3PBEA 4OMEA 4PXCA 4MHYA 3B35A 3GPQA 2PJ8A 3KHZA 5FSXA 4NFRA 3B3WA 2ZELA 3EW5A 2ZEOA 2DX6A 6CPAA 4J5RA 3GPGA 1CP6A 4MHNA 3D7GA 5K8PA 1TXRA 2C6GA 2Q51A 4IK2A 4P4IA 4OC2A 3GQOA 2QYVA 3FMCA 1LANA 3D7HA 2AFCA 3FEEA 2FVGA 5D29A 3SJEA 5LRKA 3S9LA 3SJXA 3B3SA 3SI0A 4ZX8A 2V8VA 4D86A 1DTDA 4H2KA 4OC1A 4ESSA 1ZR5A 3V38A 1ZLHA 4GVVA 1XFOA 5F09A 3B7IA 3FECA 4YWYA 4DYOA 4P10A 3H8FA 4Z65A 5FSZA 2CTCA 4KYBA 2PJ5A 2PJ2A 5FSVA 1BPNA 3PB4X 3NH8A 4A94A 2F8HA 2XD7A 1TKHA 4P4FA 3LMSA 2PJ0A 3B3CA 2PVVA 4MHPA 3HUVA 3GLJA 5HVGA 1ELMP 1PCAA 4IAVA 4ABKA 2OOTA 2NYQA 3BI0A 2F7VA 3GPOA 3IIBA 4NGNA 3EWQA 2VL1A 1VHEA 2XEGA 4UIBA 4NGQA 4UF4A 3KASA 4R7MA 1TXZA 2PJAA 5LYDA 4MHZA 1LFWA 3PFEA 4NGTA 1TKFA 1LOKA 3WC5A 4DUKA 1HJZA 1Y0YA 1FNOA 1GYTA 3K2KA 4TNUA 3FX6A 5JM6A 5I4MA 3B2YA 5E3BA 3D67A 1CX8A 2ZOFA 3EKEA 3CT9A 1R43A 1ARLA 5JH9A 4MRIA 1XRYA 3IJ3A 4EMEA 4X3RA 5LRJA 4P4JA 4P44A 3LWUA 1QMUA 2AFXA 2PE3A 8CPAA 4PXEA 4EFDA 3VFQA 5AILA 1Z5RA 2GREA 3B3TA 3FVLA 2AFSA 4NGPA 4JLLA 4A37A 5CMSA 4ONWA 2PJCA 2RB7A 4P4DA 4G1PA 1VHOA 1ZG9A 3FF3A 1Z2LA 4MCSA 3PEIA 4ZYQA 3V7ZA 1CG2A 2BCOA 1XBUA 3KGQA 1JQGA 3WC7A 5THWA 3ETIA 5IB9A 4GVWA 1XMBA 4NGMA 3FJUA 4OP4A 2WZNA 4O23A 5DS0A 3KR5A 5J1QA 3MRUA 5HOLA 5LYIA 2C1CA 3SIJA 7CPAA 4J5QA 3N5FA 2PIYA 3D68A 4PXBA 3PB8X 3VARA 1QQ9A 4A39A 3TX8A 2PJ9A 1VHUA 1CP7A 3IEHA 1AMPA 3EJGA 3PB6X 4B6ZA 1XJOA 2PCUA 2V8HA 2ZEMA 4J5SA 3Q6ZA 2Q43A 4UEFA 4GM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARM A;  4ABL A;  4FAI A;  3KL9 A;  1Y7E A;  2QVP A;  3H8G A;  5CB5 A;  3JRU A;  4GUA A;  2JBJ A;  5HVF A;  2EWB A;  3TC8 A;  1YD9 A;  2I3C A;  1CPX A;  2L8R A;  3PB9 X;  2OR4 A;  3FH4 A;  2PVW A;  4IHM A;  5ELY A;  5HXD A;  1NJR A;  4ETJ A;  2LGR A;  2EK9 A;  2V8G A;  3D7F A;  4R76 A;  2XEI A;  2V8D A;  2PJB A;  1TKJ A;  2JEW A;  5LYF A;  4WWV A;  2BFQ A;  2V77 A;  3KI9 A;  3GUX A;  4UML A;  4F8Z A;  1LAM A;  2POK A;  2X47 A;  2NSM A;  4MCP A;  1Y0R A;  3SI1 A;  2ZEN A;  1CPS A;  3PBB A;  4UEE A;  4TU0 A;  1HDU A;  1YW6 A;  4DJL A;  3HLP A;  3GB0 A;  2PJ4 A;  1OBR A;  1LAP A;  4PQA A;  3VAT A;  1F2O A;  3WC6 A;  3ISX A;  5DUS A;  2PJ7 A;  3RZA A;  3PB7 X;  1ZG7 A;  4TWE A;  4ZY0 A;  2HB6 A;  1AYE A;  1FT7 A;  1Q7L A;  1CBX A;  1LCP A;  3DGV A;  4MXU A;  1Z8L A;  2FAV A;  3BXM A;  1VGY A;  1DE4 C;  3RAM A;  4R6T A;  4NJR A;  4P4E A;  2BO9 A;  2Q4Z A;  2ABZ A;  3B3V A;  3L2N A;  2BFR A;  4X8I A;  3JZT A;  4OC5 A;  4P6Y A;  2PRQ A;  3CDX A;  1TF9 A;  2C6C A;  2GLF A;  3IIF A;  1IY7 A;  4YU9 A;  4OKO A;  4OC0 A;  2CIJ A;  2G9D A;  3NFZ A;  1F57 A;  4ZI6 A;  3SJF A;  3NH5 A;  2PJ6 A;  3RBU A;  2RFH A;  3PFO A;  3SI2 A;  3D66 A;  3QNV A;  3KQZ A;  2BOA A;  4Q7A A;  1ZLI A;  4JZ0 A;  4F9U A;  2PJ1 A;  3VH9 A;  4FBE A;  3PRT A;  4FUU A;  2GLJ A;  5K8O A;  4P45 A;  1PYT B;  5LRG A;  3KHX A;  3ISZ A;  1H8L A;  2FXK A;  3V2B A;  3NA6 A;  3I1U A;  3EWP A;  1SPV A;  1IGB A;  1ZR3 A;  3S9N A;  1HDQ A;  2GU2 A;  4WJB A;  3SIG A;  4NGS A;  3V45 A;  1EE3 P;  1HEE A;  2C6P A;  4OC3 A;  5D8N A;  3IID A;  1YW4 A;  2J9A A;  3EWO A;  4JGK A;  2AFM A;  3BI1 A;  4K3N A;  3T8W A;  3EJF A;  2EEE A;  4LQG A;  4CPA A;  2CTB A;  2XEJ A;  3SII A;  2EK8 A;  3IC1 A;  4X2T A;  4J4Z A;  2FG1 A;  4ETK A;  2ZEF A;  2O4H A;  4MMO A;  3S9M A;  2IMO A;  2ANP A;  4JCA A;  4OIW A;  3IWW A;  4BD9 A;  2QJ8 A;  2ZEE A;  1BPM A;  2O53 A;  2ZEG A;  3IO1 A;  4ZX9 A;  3K9T A;  1KWM A;  2CF4 A;  4ZY1 A;  4PXD A;  1YSJ A;  4PPZ A;  4F9V A;  1ZG8 A;  5K8N A;  1TF8 A;  4EWT A;  4UIA A;  1VIX A;  3H8E A;  5LYL A;  1TY8 A;  1YME A;  4W9Y A;  3BHX A;  5FSY A;  5K8M A;  3SIH A;  3IFE A;  1NSA A;  3KZW A;  4ZY2 A;  5HVH A;  1RTQ A;  4NGR A;  4UEZ A;  3CPA A;  4JYW A;  4AXV A;  3MN8 A;  4IQY A;  1F2P A;  2ACF A;  2VRI A;  3WAB A;  2AFU A;  4RUH A;  2JBK A;  1UWY A;  2IJZ A;  1R3N A;  2DEA A;  1ELL P;  3GQE A;  3KR4 A;  3NH4 A;  4A38 A;  2ZEP A;  1M4L A;  3EWR A;  3CPX A;  2WYR A;  3D7D A;  4OC4 A;  2HC9 A;  2IQ6 A;  4KSI A;  3WT4 A;  3SJG A;  4NJQ A;  4P4B A;  5CBM A;  2AFO A;  2XEF A;  4MCR A;  2PJ3 A;  1BLL E;  3FED A;  5FSU A;  3D4U A;  4JVV A;  4FWU A;  4MCQ A;  5HIH A;  5JGF A;  3DLJ A;  3KQX A;  2ZOG A;  2PIZ A;  5CPA A;  2AFW A;  4R8F A;  4OID A;  2ZED A;  4K0C A;  2AFZ A;  5CB3 A;  2ZEH A;  1YLO A;  3Q71 A;  1BAV A;  3PBE A;  4OME A;  4PXC A;  4MHY A;  3B35 A;  3GPQ A;  2PJ8 A;  3KHZ A;  5FSX A;  4NFR A;  3B3W A;  2ZEL A;  3EW5 A;  2ZEO A;  2DX6 A;  6CPA A;  4J5R A;  3GPG A;  1CP6 A;  4MHN A;  3D7G A;  5K8P A;  1TXR A;  2C6G A;  2Q51 A;  4IK2 A;  4P4I A;  4OC2 A;  3GQO A;  2QYV A;  3FMC A;  1LAN A;  3D7H A;  2AFC A;  3FEE A;  2FVG A;  5D29 A;  3SJE A;  5LRK A;  3S9L A;  3SJX A;  3B3S A;  3SI0 A;  4ZX8 A;  2V8V A;  4D86 A;  1DTD A;  4H2K A;  4OC1 A;  4ESS A;  1ZR5 A;  3V38 A;  1ZLH A;  4GVV A;  1XFO A;  5F09 A;  3B7I A;  3FEC A;  4YWY A;  4DYO A;  4P10 A;  3H8F A;  4Z65 A;  5FSZ A;  2CTC A;  4KYB A;  2PJ5 A;  2PJ2 A;  5FSV A;  1BPN A;  3PB4 X;  3NH8 A;  4A94 A;  2F8H A;  2XD7 A;  1TKH A;  4P4F A;  3LMS A;  2PJ0 A;  3B3C A;  2PVV A;  4MHP A;  3HUV A;  3GLJ A;  5HVG A;  1ELM P;  1PCA A;  4IAV A;  4ABK A;  2OOT A;  2NYQ A;  3BI0 A;  2F7V A;  3GPO A;  3IIB A;  4NGN A;  3EWQ A;  2VL1 A;  1VHE A;  2XEG A;  4UIB A;  4NGQ A;  4UF4 A;  3KAS A;  4R7M A;  1TXZ A;  2PJA A;  5LYD A;  4MHZ A;  1LFW A;  3PFE A;  4NGT A;  1TKF A;  1LOK A;  3WC5 A;  4DUK A;  1HJZ A;  1Y0Y A;  1FNO A;  1GYT A;  3K2K A;  4TNU A;  3FX6 A;  5JM6 A;  5I4M A;  3B2Y A;  5E3B A;  3D67 A;  1CX8 A;  2ZOF A;  3EKE A;  3CT9 A;  1R43 A;  1ARL A;  5JH9 A;  4MRI A;  1XRY A;  3IJ3 A;  4EME A;  4X3R A;  5LRJ A;  4P4J A;  4P44 A;  3LWU A;  1QMU A;  2AFX A;  2PE3 A;  8CPA A;  4PXE A;  4EFD A;  3VFQ A;  5AIL A;  1Z5R A;  2GRE A;  3B3T A;  3FVL A;  2AFS A;  4NGP A;  4JLL A;  4A37 A;  5CMS A;  4ONW A;  2PJC A;  2RB7 A;  4P4D A;  4G1P A;  1VHO A;  1ZG9 A;  3FF3 A;  1Z2L A;  4MCS A;  3PEI A;  4ZYQ A;  3V7Z A;  1CG2 A;  2BCO A;  1XBU A;  3KGQ A;  1JQG A;  3WC7 A;  5THW A;  3ETI A;  5IB9 A;  4GVW A;  1XMB A;  4NGM A;  3FJU A;  4OP4 A;  2WZN A;  4O23 A;  5DS0 A;  3KR5 A;  5J1Q A;  3MRU A;  5HOL A;  5LYI A;  2C1C A;  3SIJ A;  7CPA A;  4J5Q A;  3N5F A;  2PIY A;  3D68 A;  4PXB A;  3PB8 X;  3VAR A;  1QQ9 A;  4A39 A;  3TX8 A;  2PJ9 A;  1VHU A;  1CP7 A;  3IEH A;  1AMP A;  3EJG A;  3PB6 X;  4B6Z A;  1XJO A;  2PCU A;  2V8H A;  2ZEM A;  4J5S A;  3Q6Z A;  2Q43 A;  4UEF A;  4GM5 A; 
#chains in the Genus database with same CATH topology
 1ARM A;  1AUG A;  4ABL A;  3TCV A;  3QB8 A;  1XMT A;  4KSF A;  4FAI A;  3S6F A;  2PQ8 A;  3KL9 A;  1Y7E A;  2QVP A;  3H8G A;  4HNX B;  5CB5 A;  3JRU A;  4GUA A;  2JBJ A;  2VI7 A;  4B13 A;  1YR0 A;  5HVF A;  2EWB A;  3TC8 A;  1YD9 A;  2I3C A;  4F0X A;  1CPX A;  2L8R A;  3PB9 X;  2OR4 A;  4OAE A;  1IB1 E;  2PVW A;  3FH4 A;  4IHM A;  5ELY A;  3T90 A;  5HXD A;  5C82 A;  1NJR A;  2DF5 A;  4ETJ A;  4KOS A;  4UWI A;  2VZY A;  3R96 A;  2LGR A;  2EK9 A;  3IWE A;  5CNP A;  2V8G A;  3KKW A;  3D7F A;  4R76 A;  4KUB A;  4PV6 A;  4QB9 A;  2XEI A;  2V8D A;  2Q44 A;  3BJ8 A;  4MFL A;  4C7I A;  2PJB A;  3SHP A;  4JXQ A;  4MY3 A;  1S60 A;  4LUA A;  4XNH C;  1L0C A;  1XF8 A;  1TKJ A;  2JEW A;  4UWJ A;  5LYF A;  3IU1 A;  4WWV A;  2BFQ A;  2V77 A;  4M6I A;  3KI9 A;  3EO4 A;  4CGN A;  4CGP A;  3GUX A;  4UML A;  1KZF A;  4C2X A;  4F8Z A;  1LAM A;  2POK A;  1P0H A;  2ZW4 A;  2X47 A;  2NSM A;  4MCP A;  1Y0R A;  3SI1 A;  2ZEN A;  4B5P B;  4CGO A;  1CPS A;  2JEV A;  2A4N A;  2Q0Y A;  3PBB A;  2Q4V A;  4TU0 A;  1HDU A;  1YW6 A;  4UEE A;  4DJL A;  4H89 A;  3HLP A;  4RN7 A;  4CYO A;  2J8R A;  3GB0 A;  2PJ4 A;  1OBR A;  1IYK A;  1LAP A;  2Z11 A;  2ZW6 A;  4PQA A;  4I49 A;  1NMT A;  5AG7 A;  1F2O A;  2W2G A;  3RYO A;  1OZP A;  2B58 A;  3VAT A;  2EUI A;  2OB0 A;  5F47 A;  3WC6 A;  3ISX A;  5H84 A;  5DUS A;  4Y49 C;  5KTA A;  3K9U A;  3PGP A;  2PR1 A;  2PJ7 A;  2RC4 A;  3PB7 X;  3RZA A;  3EXN A;  2K5T A;  2Q7B A;  4J5S A;  1ZG7 A;  2DXQ A;  4TWE A;  4F0Y A;  4ZY0 A;  1Q2C A;  5IX3 A;  3A9L A;  2EO8 A;  1AYE A;  2EVN A;  1FT7 A;  2HB6 A;  1Q7L A;  1CBX A;  1LCP A;  1QSR A;  2OU2 A;  1Z8L A;  3DGV A;  4MXU A;  4ZBG A;  4A33 A;  2FAV A;  1XE4 A;  3BXM A;  1VGY A;  1DE4 C;  3D8P A;  3RAM A;  5H86 A;  4R6T A;  4CYP A;  4NJR A;  5EBV A;  1WK4 A;  1M4G A;  5EMI A;  1Z8X A;  4P4E A;  2BO9 A;  2G0B A;  2Q4Z A;  3GY9 A;  1VHS A;  2ABZ A;  3B3V A;  3L2N A;  4NCZ A;  2ZW5 A;  3JVN A;  2BFR A;  4X8I A;  3JZT A;  4OC5 A;  4P6Y A;  2PRQ A;  2P6F A;  3R1K A;  3W6X A;  2B4D A;  4CYQ A;  3CDX A;  1TF9 A;  2ZW7 A;  5AG6 A;  1QSM A;  2C6C A;  2GLF A;  3IIF A;  2Z10 A;  2FCK A;  3I3G A;  1IY7 A;  2BUE A;  4YU9 A;  3LAC A;  1I1D A;  4OKO A;  2CIJ A;  2G9D A;  2RNK A;  4OC0 A;  3NFZ A;  4AVB A;  1F57 A;  2YNC A;  4ZI6 A;  2P0W A;  3FIX A;  3SJF A;  3NH5 A;  1S3Z A;  2YNC C;  2D4P A;  4AG7 A;  5I0C A;  2PJ6 A;  4FD5 A;  2RFH A;  3PFO A;  3RBU A;  4RS2 A;  3SI2 A;  3D66 A;  2BEI A;  3QNV A;  3KQZ A;  2BOA A;  5KTD A;  4Q7A A;  1ZLI A;  4JZ0 A;  4F9U A;  4MFJ A;  3TE4 A;  2PJ1 A;  3FYN A;  1Y9W A;  3VH9 A;  4E2A A;  4FBE A;  4FD7 A;  4NEX A;  2OZG A;  3PRT A;  4FUU A;  4AVC A;  2GLJ A;  5A27 A;  5K8O A;  4P45 A;  1PYT B;  1QSO A;  5LRG A;  4J3G A;  4B14 A;  2J8M A;  3KHX A;  2NMT A;  3ISZ A;  1H8L A;  2H5M A;  3MGD A;  3T9Y A;  2FXK A;  3V2B A;  3NA6 A;  3I1U A;  4NSQ A;  2FXF A;  4C2Y A;  4M85 A;  2B4B A;  2Z3N A;  3EWP A;  2F5I A;  4R57 A;  5IV0 A;  1SPV A;  1IGB A;  1ZR3 A;  3S9N A;  3PP9 A;  4KZT A;  1WWZ A;  3TO6 A;  4HKF A;  1HDQ A;  2GU2 A;  4WJB A;  3SIG A;  2QEC A;  4R9M A;  3NE8 A;  4NGS A;  3V45 A;  1EE3 P;  5A28 A;  1HEE A;  3ZZI A;  5HMN A;  2X7B A;  2C6P A;  3G8W A;  4PSW A;  4R87 A;  4OC3 A;  5D8N A;  1XEB A;  1BO4 A;  4MFQ A;  4KVX A;  3IID A;  2JZF A;  1YW4 A;  2J9A A;  3EWO A;  4JGK A;  2PC1 A;  3FBU A;  4CYN A;  2AFM A;  4HNW B;  4UA3 A;  3BI1 A;  4K3N A;  3T8W A;  4YRH A;  4MFZ A;  3EJF A;  2AJ6 A;  2EEE A;  3V8I A;  4LQG A;  3S6K A;  2CTB A;  4UCN A;  4CPA A;  2I00 A;  4B12 A;  2XEJ A;  3SII A;  1YVK A;  2EK8 A;  3R95 A;  3IC1 A;  3VWE A;  2OZU A;  4X2T A;  4XPK A;  4OLL A;  4J4Z A;  2GFQ A;  1NSL A;  4A30 A;  2ZPA A;  2FG1 A;  4ETK A;  4R3K A;  1IU8 A;  1GHE A;  2CNM A;  2O4H A;  2ZEF A;  4MJ8 A;  4MMO A;  3S9M A;  2IMO A;  2ANP A;  4JCA A;  4OIW A;  1RXT A;  4JJX A;  5AG5 A;  2FS5 A;  4XPD C;  2B4D B;  2FIA A;  2FL4 A;  3IWW A;  1B6B A;  2Q7S A;  4LQ6 A;  2P6G A;  4PK3 A;  4XPL A;  2QJ8 A;  3R9E A;  1VKC A;  2ZEE A;  3SXN A;  1BPM A;  2O53 A;  2ZEG A;  4ZGY B;  3IO1 A;  4ZX9 A;  1YX0 A;  3K9T A;  1UFH A;  2FSR A;  2PR8 A;  3S6H A;  3SXO A;  2REF A;  4YFJ A;  1KWM A;  2CF4 A;  4ZY1 A;  3CXS A;  1YSJ A;  3GYA A;  4MFK A;  4PPZ A;  4PXD A;  4F9V A;  1ZG8 A;  3PZJ A;  3LOD A;  3FNC A;  3TT2 A;  2CNT A;  3W91 A;  5K8N A;  4B10 A;  1TF8 A;  4EWT A;  4UIA A;  1VIX A;  2AE6 A;  3H8E A;  2VEZ A;  1TY8 A;  1YME A;  5LYL A;  4KOW A;  2YNE A;  4W9Y A;  4GXH A;  3BHX A;  2GE3 A;  1IID A;  5FSY A;  3IGR A;  5K8M A;  2Q04 A;  3SIH A;  3IFE A;  2B3V A;  1NSA A;  3KZW A;  4ZY2 A;  5HVH A;  4A32 A;  4B11 A;  2WPX A;  1RTQ A;  2KQV A;  4NGR A;  1P4N A;  1FY7 A;  4UBR A;  3CPA A;  2I79 A;  2G3T A;  3F5B A;  4UEZ A;  4UFV A;  4JYW A;  3S6G A;  2B5G B;  5G21 A;  4E8O A;  1V0C A;  4FD4 A;  4UFX A;  4AXV A;  5JQ4 A;  3MN8 A;  4IQY A;  2HV2 A;  1F2P A;  4MHD A;  2BSW A;  3DR8 A;  4KOX A;  4GS4 A;  2ACF A;  2VRI A;  3WAB A;  1YVO A;  3OWC A;  3F0A A;  4K30 A;  2AFU A;  4RUH A;  2JBK A;  1Q2D A;  1YGH A;  1UWY A;  4OAD A;  1R3N A;  2IJZ A;  2DPS A;  2DEA A;  4Q38 A;  5JPH A;  1ELL P;  3GQE A;  3KR4 A;  2CY2 A;  3NH4 A;  2ZEP A;  4MFP A;  4A38 A;  1M4L A;  3EWR A;  4U9Z A;  1CM0 A;  4CAE A;  3CPX A;  2WYR A;  3D7D A;  1PUA A;  4OC4 A;  2HC9 A;  5GCN A;  4AB7 A;  2YGW A;  1Y9K A;  1MJB A;  1J4J A;  4KSI A;  2IQ6 A;  2BL1 A;  4YGO A;  3SJG A;  4PK2 A;  3WT4 A;  4BIN A;  4NJQ A;  4P4B A;  5CBM A;  2JZE A;  1IIC A;  4Q36 A;  2AFO A;  3CXQ A;  1M1D A;  2XEF A;  2HQY A;  3TTH A;  2FIW A;  2PJ3 A;  1BLL E;  3FED A;  4MCR A;  3RNZ A;  5FSU A;  4JLY A;  4C7H A;  1Z8W A;  4JVV A;  3D4U A;  4FWU A;  2IL4 A;  4MCQ A;  5HIH A;  5JGF A;  3DLJ A;  3KQX A;  2ZOG A;  1X12 A;  4C2Z A;  1MK4 A;  2EBJ A;  2PIZ A;  4H6Z A;  5CPA A;  1K4J A;  1YQE A;  2AFW A;  3DR6 A;  4R8F A;  4LX9 A;  4XNH B;  1B87 A;  4OID A;  2ZED A;  2ZXV A;  4MI4 A;  4K0C A;  1BOB A;  2AFZ A;  5CB3 A;  1IYL A;  4ONU A;  2ZEH A;  1YLO A;  5J8F A;  2Z3K A;  3C26 A;  3GIU A;  3Q71 A;  2GAN A;  1RO5 A;  1BAV A;  2VZZ A;  3N7Z A;  1Z9U A;  3PBE A;  1Y7R A;  4OME A;  4PXC A;  4MHY A;  3B35 A;  3GPQ A;  1IOF A;  2D4O A;  2HUZ A;  2PJ8 A;  5FSX A;  3KHZ A;  4KS9 A;  3B3W A;  1S7L A;  2ZEL A;  4NFR A;  2R98 A;  3R9G A;  4BBH A;  3EW5 A;  2ZEO A;  2DX6 A;  4CAF A;  4Y49 B;  2WCT A;  4J5R A;  2R8V A;  4NXY A;  6CPA A;  3GPG A;  1CP6 A;  1S7N A;  4MHN A;  3W6S A;  1YLE A;  3G3S A;  5IB0 A;  4A2Z A;  2CNS A;  2Q4Y A;  1M4D A;  3D7G A;  4CAW A;  5K8P A;  4HPS A;  4AVA A;  1TXR A;  1XOV A;  2C6G A;  2Q51 A;  4IK2 A;  4P4I A;  1Z4E A;  4C68 A;  4OC2 A;  3GQO A;  4KUA A;  1KUX A;  2QYV A;  4L89 A;  2R7H A;  3EC4 A;  3FMC A;  1LAN A;  1YRE A;  3D7H A;  2AFC A;  3FEE A;  2FVG A;  4H6U A;  5D29 A;  3SJE A;  4KOT A;  5LRK A;  3S9L A;  4QUS A;  3B3S A;  3SJX A;  3SI0 A;  2KCW A;  3QAH A;  2PRB A;  4ZX8 A;  1ZO0 A;  2V8V A;  1MJA A;  4D86 A;  1DTD A;  2Z3M A;  4H2K A;  1TIQ A;  4IF5 A;  2OH1 A;  4OC1 A;  5G20 A;  4KOR A;  5F46 A;  4ESS A;  1ZR5 A;  3V38 A;  3CXP A;  1ZLH A;  4GVV A;  4MY0 A;  4A31 A;  1XFO A;  2ATR A;  2Z3P A;  2G3A A;  3B7I A;  3FEC A;  4YWY A;  3VWD A;  5F09 A;  4IUS A;  4DYO A;  1KUV A;  1S7F A;  5G1Z A;  4P10 A;  3H8F A;  2Y0M A;  4Z65 A;  5FSZ A;  2CTC A;  2O28 A;  4KVM E;  4CGL A;  4KYB A;  2PJ5 A;  2PJ2 A;  4CRZ B;  5FSV A;  1BPN A;  5ISV A;  3PB4 X;  4U5Y A;  1X10 A;  3NH8 A;  5EC4 A;  4A94 A;  2F8H A;  2XD7 A;  1TKH A;  5AGE A;  4P4F A;  3LMS A;  2PJ0 A;  3B3C A;  2PVV A;  2VXK A;  3P2H A;  4MHP A;  3HUV A;  4EVY A;  2QIR A;  3GLJ A;  5HVG A;  1ELM P;  1ON0 A;  1PCA A;  5KTC A;  3B8G A;  3TOA A;  4IAV A;  4R3L A;  4ABK A;  2ARH A;  5DWM A;  2OOT A;  2NYQ A;  3BI0 A;  2F7V A;  1R57 A;  1U6M A;  2FE7 A;  4DNC A;  3EY5 A;  3GPO A;  2VQY A;  3IIB A;  3TOB A;  3D3S A;  4CAX A;  3P2F A;  4KVO E;  3FXT A;  4JXR A;  4NGN A;  3EWQ A;  3R9F A;  3TO7 A;  1M4I A;  3CZX A;  2VL1 A;  4A95 A;  3I9S A;  1A2Z A;  1VHE A;  2XEG A;  3FB3 A;  2REE A;  4MBU A;  4UIB A;  5E96 A;  4NGQ A;  4UF4 A;  2WSA A;  3H4Q A;  3KAS A;  4R7M A;  4CGM A;  1TXZ A;  2PJA A;  5LYD A;  4MHZ A;  2DPT A;  1LFW A;  3PFE A;  4UFW A;  3BLN A;  4NGT A;  1NE9 A;  1TKF A;  2B3U A;  2VBQ A;  5HH1 A;  4KOU A;  1LOK A;  3EFA A;  5J8C A;  3JUW A;  3WC5 A;  4DUK A;  2JDC A;  1HJZ A;  1Y0Y A;  1S5K A;  4RI1 A;  3WR7 A;  2Z3O A;  1FNO A;  1PU9 A;  3LD2 A;  4KOY A;  4KOV A;  3IU2 A;  4UCM A;  1GYT A;  2OZH A;  4HNY B;  3DNS A;  1M44 A;  3K2K A;  4KLV A;  2JZD A;  4TNU A;  3FX6 A;  5JM6 A;  4AG9 A;  5I4M A;  2C27 A;  3F8K A;  3B2Y A;  5E3B A;  3D67 A;  1CX8 A;  1I12 A;  3DDD A;  4UCP A;  2J8N A;  1I21 A;  1Z4R A;  1QST A;  3IWG A;  2ZOF A;  3EKE A;  3CT9 A;  1R43 A;  1ARL A;  5G22 A;  1IOI A;  3ZJ0 A;  5JH9 A;  4MRI A;  4L8A A;  1XRY A;  3IJ3 A;  1XIX A;  4EME A;  4X3R A;  5LRJ A;  4M6H A;  1YK3 A;  4P44 A;  4P4J A;  3LWU A;  4XPD B;  5DWN A;  1QMU A;  2AFX A;  1N71 A;  2PE3 A;  8CPA A;  4PXE A;  4M6G A;  4KSA A;  4EFD A;  2P6E A;  4QC6 A;  3VFQ A;  4X5K A;  3UY5 A;  2CXA A;  5AIL A;  1Z5R A;  2GRE A;  3B3T A;  3E0K A;  3FVL A;  2AFS A;  4M3S A;  3D2P A;  4ORF A;  2QML A;  4JLL A;  4NGP A;  4FD6 A;  4A37 A;  2Z3L A;  5CMS A;  4BMH A;  4ONW A;  5BWA B;  2PJC A;  2RB7 A;  3FRM A;  4G1P A;  4P4D A;  4E0A A;  2WUU A;  3H5Z A;  4II9 A;  1VHO A;  2R1I A;  1ZG9 A;  3DSB A;  4CS0 B;  3FF3 A;  1Z2L A;  4MCS A;  4B5P A;  3PEI A;  1MJ9 A;  4ZYQ A;  2GIV A;  4PSX A;  4QVT A;  3V7Z A;  1CG2 A;  4QBJ A;  3QAY A;  4NF1 A;  2BCO A;  1XBU A;  3KGQ A;  5F48 A;  4B5O A;  5AG4 A;  5F49 A;  1JQG A;  3RO0 A;  3WC7 A;  2Z0Z A;  1KUY A;  1SQH A;  3JTK A;  2PSW A;  3ETI A;  5THW A;  5IB9 A;  2JLM A;  4GVW A;  1XMB A;  4NGM A;  3FJU A;  4OP4 A;  2YND A;  4CRY B;  2WZN A;  4O23 A;  5DS0 A;  3KR5 A;  5J1Q A;  3MRU A;  5HOL A;  3TO9 A;  4F6A A;  3GKR A;  2ODF A;  2C1C A;  5LYI A;  3SIJ A;  2FT0 A;  4J5Q A;  3N5F A;  7CPA A;  1QSN A;  2B5G A;  2PIY A;  3D2M A;  3D68 A;  1JWQ A;  4PXB A;  2PDO A;  3PB8 X;  3VAR A;  4CAV A;  1QQ9 A;  4U9Y A;  2JDD A;  4A39 A;  1S7K A;  3BJ7 A;  1Q2Y A;  3TX8 A;  2WPW A;  2PJ9 A;  1VHU A;  1CP7 A;  1LRZ A;  1AMP A;  3IEH A;  3TFY A;  1CJW A;  3EJG A;  3PB6 X;  4BD9 A;  4B6Z A;  1XJO A;  2PCU A;  5FVJ A;  2V8H A;  2ZEM A;  4JD6 A;  4KLW A;  5C88 A;  3NE7 A;  1Z8T A;  3Q6Z A;  2Q43 A;  4UEF A;  4JWP A;  4GM5 A; 
#chains in the Genus database with same CATH homology
 1ARM A;  4ABL A;  4FAI A;  3KL9 A;  1Y7E A;  2QVP A;  3H8G A;  5CB5 A;  3JRU A;  4GUA A;  2JBJ A;  5HVF A;  2EWB A;  3TC8 A;  1YD9 A;  2I3C A;  1CPX A;  2L8R A;  3PB9 X;  2OR4 A;  3FH4 A;  2PVW A;  4IHM A;  5ELY A;  5HXD A;  1NJR A;  4ETJ A;  2LGR A;  2EK9 A;  2V8G A;  3D7F A;  4R76 A;  2XEI A;  2V8D A;  2PJB A;  1TKJ A;  2JEW A;  5LYF A;  4WWV A;  2BFQ A;  2V77 A;  3KI9 A;  3GUX A;  4UML A;  4F8Z A;  1LAM A;  2POK A;  2X47 A;  2NSM A;  4MCP A;  1Y0R A;  3SI1 A;  2ZEN A;  1CPS A;  3PBB A;  4UEE A;  4TU0 A;  1HDU A;  1YW6 A;  4DJL A;  3HLP A;  3GB0 A;  2PJ4 A;  1OBR A;  1LAP A;  4PQA A;  3VAT A;  1F2O A;  3WC6 A;  3ISX A;  5DUS A;  2PJ7 A;  3RZA A;  3PB7 X;  1ZG7 A;  4TWE A;  4ZY0 A;  2HB6 A;  1AYE A;  1FT7 A;  1Q7L A;  1CBX A;  1LCP A;  3DGV A;  4MXU A;  1Z8L A;  2FAV A;  3BXM A;  1VGY A;  1DE4 C;  3RAM A;  4R6T A;  4NJR A;  4P4E A;  2BO9 A;  2Q4Z A;  2ABZ A;  3B3V A;  3L2N A;  2BFR A;  4X8I A;  3JZT A;  4OC5 A;  4P6Y A;  2PRQ A;  3CDX A;  1TF9 A;  2C6C A;  2GLF A;  3IIF A;  1IY7 A;  4YU9 A;  4OKO A;  4OC0 A;  2CIJ A;  2G9D A;  3NFZ A;  1F57 A;  4ZI6 A;  3SJF A;  3NH5 A;  2PJ6 A;  3RBU A;  2RFH A;  3PFO A;  3SI2 A;  3D66 A;  3QNV A;  3KQZ A;  2BOA A;  4Q7A A;  1ZLI A;  4JZ0 A;  4F9U A;  2PJ1 A;  3VH9 A;  4FBE A;  3PRT A;  4FUU A;  2GLJ A;  5K8O A;  4P45 A;  1PYT B;  5LRG A;  3KHX A;  3ISZ A;  1H8L A;  2FXK A;  3V2B A;  3NA6 A;  3I1U A;  3EWP A;  1SPV A;  1IGB A;  1ZR3 A;  3S9N A;  1HDQ A;  2GU2 A;  4WJB A;  3SIG A;  4NGS A;  3V45 A;  1EE3 P;  1HEE A;  2C6P A;  4OC3 A;  5D8N A;  3IID A;  1YW4 A;  2J9A A;  3EWO A;  4JGK A;  2AFM A;  3BI1 A;  4K3N A;  3T8W A;  3EJF A;  2EEE A;  4LQG A;  4CPA A;  2CTB A;  2XEJ A;  3SII A;  2EK8 A;  3IC1 A;  4X2T A;  4J4Z A;  2FG1 A;  4ETK A;  2ZEF A;  2O4H A;  4MMO A;  3S9M A;  2IMO A;  2ANP A;  4JCA A;  4OIW A;  3IWW A;  4BD9 A;  2QJ8 A;  2ZEE A;  1BPM A;  2O53 A;  2ZEG A;  3IO1 A;  4ZX9 A;  3K9T A;  1KWM A;  2CF4 A;  4ZY1 A;  4PXD A;  1YSJ A;  4PPZ A;  4F9V A;  1ZG8 A;  5K8N A;  1TF8 A;  4EWT A;  4UIA A;  1VIX A;  3H8E A;  5LYL A;  1TY8 A;  1YME A;  4W9Y A;  3BHX A;  5FSY A;  5K8M A;  3SIH A;  3IFE A;  1NSA A;  3KZW A;  4ZY2 A;  5HVH A;  1RTQ A;  4NGR A;  4UEZ A;  3CPA A;  4JYW A;  4AXV A;  3MN8 A;  4IQY A;  1F2P A;  2ACF A;  2VRI A;  3WAB A;  2AFU A;  4RUH A;  2JBK A;  1UWY A;  2IJZ A;  1R3N A;  2DEA A;  1ELL P;  3GQE A;  3KR4 A;  3NH4 A;  4A38 A;  2ZEP A;  1M4L A;  3EWR A;  3CPX A;  2WYR A;  3D7D A;  4OC4 A;  2HC9 A;  2IQ6 A;  4KSI A;  3WT4 A;  3SJG A;  4NJQ A;  4P4B A;  5CBM A;  2AFO A;  2XEF A;  4MCR A;  2PJ3 A;  1BLL E;  3FED A;  5FSU A;  3D4U A;  4JVV A;  4FWU A;  4MCQ A;  5HIH A;  5JGF A;  3DLJ A;  3KQX A;  2ZOG A;  2PIZ A;  5CPA A;  2AFW A;  4R8F A;  4OID A;  2ZED A;  4K0C A;  2AFZ A;  5CB3 A;  2ZEH A;  1YLO A;  3Q71 A;  1BAV A;  3PBE A;  4OME A;  4PXC A;  4MHY A;  3B35 A;  3GPQ A;  2PJ8 A;  3KHZ A;  5FSX A;  4NFR A;  3B3W A;  2ZEL A;  3EW5 A;  2ZEO A;  2DX6 A;  6CPA A;  4J5R A;  3GPG A;  1CP6 A;  4MHN A;  3D7G A;  5K8P A;  1TXR A;  2C6G A;  2Q51 A;  4IK2 A;  4P4I A;  4OC2 A;  3GQO A;  2QYV A;  3FMC A;  1LAN A;  3D7H A;  2AFC A;  3FEE A;  2FVG A;  5D29 A;  3SJE A;  5LRK A;  3S9L A;  3SJX A;  3B3S A;  3SI0 A;  4ZX8 A;  2V8V A;  4D86 A;  1DTD A;  4H2K A;  4OC1 A;  4ESS A;  1ZR5 A;  3V38 A;  1ZLH A;  4GVV A;  1XFO A;  5F09 A;  3B7I A;  3FEC A;  4YWY A;  4DYO A;  4P10 A;  3H8F A;  4Z65 A;  5FSZ A;  2CTC A;  4KYB A;  2PJ5 A;  2PJ2 A;  5FSV A;  1BPN A;  3PB4 X;  3NH8 A;  4A94 A;  2F8H A;  2XD7 A;  1TKH A;  4P4F A;  3LMS A;  2PJ0 A;  3B3C A;  2PVV A;  4MHP A;  3HUV A;  3GLJ A;  5HVG A;  1ELM P;  1PCA A;  4IAV A;  4ABK A;  2OOT A;  2NYQ A;  3BI0 A;  2F7V A;  3GPO A;  3IIB A;  4NGN A;  3EWQ A;  2VL1 A;  1VHE A;  2XEG A;  4UIB A;  4NGQ A;  4UF4 A;  3KAS A;  4R7M A;  1TXZ A;  2PJA A;  5LYD A;  4MHZ A;  1LFW A;  3PFE A;  4NGT A;  1TKF A;  1LOK A;  3WC5 A;  4DUK A;  1HJZ A;  1Y0Y A;  1FNO A;  1GYT A;  3K2K A;  4TNU A;  3FX6 A;  5JM6 A;  5I4M A;  3B2Y A;  5E3B A;  3D67 A;  1CX8 A;  2ZOF A;  3EKE A;  3CT9 A;  1R43 A;  1ARL A;  5JH9 A;  4MRI A;  1XRY A;  3IJ3 A;  4EME A;  4X3R A;  5LRJ A;  4P4J A;  4P44 A;  3LWU A;  1QMU A;  2AFX A;  2PE3 A;  8CPA A;  4PXE A;  4EFD A;  3VFQ A;  5AIL A;  1Z5R A;  2GRE A;  3B3T A;  3FVL A;  2AFS A;  4NGP A;  4JLL A;  4A37 A;  5CMS A;  4ONW A;  2PJC A;  2RB7 A;  4P4D A;  4G1P A;  1VHO A;  1ZG9 A;  3FF3 A;  1Z2L A;  4MCS A;  3PEI A;  4ZYQ A;  3V7Z A;  1CG2 A;  2BCO A;  1XBU A;  3KGQ A;  1JQG A;  3WC7 A;  5THW A;  3ETI A;  5IB9 A;  4GVW A;  1XMB A;  4NGM A;  3FJU A;  4OP4 A;  2WZN A;  4O23 A;  5DS0 A;  3KR5 A;  5J1Q A;  3MRU A;  5HOL A;  5LYI A;  2C1C A;  3SIJ A;  7CPA A;  4J5Q A;  3N5F A;  2PIY A;  3D68 A;  4PXB A;  3PB8 X;  3VAR A;  1QQ9 A;  4A39 A;  3TX8 A;  2PJ9 A;  1VHU A;  1CP7 A;  3IEH A;  1AMP A;  3EJG A;  3PB6 X;  4B6Z A;  1XJO A;  2PCU A;  2V8H A;  2ZEM A;  4J5S A;  3Q6Z A;  2Q43 A;  4UEF A;  4GM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...