3KQXA

Structure of a protease 1
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
molecule tags Hydrolase
source organism Plasmodium falciparum
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqxA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqxA02
2GREA 4AXVA 1TKJA 1IY7A 1DE4C 4DUKA 2XEIA 4NFRA 2AFUA 3KL9A 4OC3A 3IJ3A 3SJEA 3KASA 2V8HA 3L2NA 3D7HA 3GPGA 2CTCA 1HEEA 2AFWA 3BI0A 1BLLE 4JYWA 2EWBA 4KYBA 3FECA 4MCSA 3DGVA 1F2PA 5K8OA 2JBKA 3H8EA 1R43A 2NSMA 1ZG8A 4NGQA 4UF4A 4NJQA 4P4BA 2PRQA 1IGBA 3FJUA 4MCPA 4ZY1A 3K9TA 2PJ3A 4ZI6A 1GYTA 4OC4A 4JVVA 3D7FA 5K8PA 3IWWA 1YW6A 4K3NA 2O53A 3D7DA 4J4ZA 1TXRA 3PB7X 1YD9A 1Z5RA 2XEFA 5D29A 3V7ZA 3EJFA 1BPNA 4OC0A 1TY8A 4JZ0A 3GPQA 1ZLIA 2I3CA 3FVLA 4P10A 1XMBA 4PPZA 3NA6A 2FXKA 3ISXA 2V8DA 3B3VA 3RBUA 1SPVA 3H8GA 3IEHA 2AFCA 2EK8A 1AMPA 3B3SA 5LYIA 4P6YA 3KI9A 3HLPA 2WZNA 1TF9A 4PXCA 2LGRA 4F9VA 4NJRA 4EFDA 3PFOA 1YMEA 3PB9X 3T8WA 2CTBA 2RFHA 2GLFA 1HDUA 3MN8A 3V45A 1R3NA 2AFXA 5JGFA 1HDQA 4UEFA 5HOLA 4MCRA 4TU0A 2CF4A 3LWUA 4NGPA 3FMCA 3GQEA 4FAIA 4OIWA 2QJ8A 4YU9A 2NYQA 4P4JA 8CPAA 4FBEA 1XJOA 4OKOA 1ZR5A 5FSZA 3SI1A 1Z2LA 3SJXA 5HXDA 2EK9A 1YLOA 4P4EA 2V8GA 3GLJA 1ZG7A 1QQ9A 2DEAA 4F8ZA 3IIFA 3PRTA 2F8HA 4K0CA 5HIHA 4BD9A 6CPAA 2C6CA 2BOAA 4JLLA 3I1UA 3LMSA 4MHNA 1VHEA 4RUHA 4TNUA 3B35A 1VGYA 4J5SA 2IMOA 4IK2A 3CPAA 4MRIA 4Z65A 5K8NA 1FNOA 4WWVA 4A37A 3EJGA 2RB7A 1BAVA 2Q4ZA 5DS0A 3SIJA 2J9AA 4OMEA 2PJ0A 1LCPA 5E3BA 2PJ5A 2GU2A 3NH4A 2OR4A 2PJ6A 2AFZA 2ZEHA 4A39A 2WYRA 2FAVA 1JQGA 4ETKA 3N5FA 4OC2A 5J1QA 4ZY0A 3NFZA 5JM6A 4R76A 2PJBA 1LAMA 4NGSA 2C1CA 3NH8A 3CT9A 3SIGA 1ELLP 3SI2A 5FSVA 3JZTA 3PBBA 3EWQA 2V77A 2BFQA 3PFEA 5HVFA 5HVHA 2ZEFA 2QYVA 2ZEDA 4R7MA 1OBRA 4ZX8A 5FSXA 3D68A 4GUAA 4LQGA 3JRUA 5F09A 2HC9A 1FT7A 3TX8A 1ZR3A 1Y0RA 4OP4A 1TKHA 1CX8A 1CPSA 4X8IA 4PXBA 2FVGA 1M4LA 3CDXA 3BXMA 2PJ7A 3D66A 5D8NA 2QVPA 4JCAA 3EWRA 4WJBA 4CPAA 1LANA 3B3WA 4H2KA 2Q43A 1CG2A 3WC6A 3VARA 4ZY2A 4ETJA 3HUVA 4ONWA 4EMEA 3PB4X 3ETIA 4NGMA 3B3CA 2O4HA 4O23A 4ZYQA 1RTQA 4GVWA 3VATA 2JEWA 4A94A 3VH9A 2PJAA 3KQZA 3D67A 4D86A 2ZEOA 4J5RA 3WC7A 3GQOA 3Q71A 1EE3P 2L8RA 4DYOA 3FX6A 3KR4A 2PIYA 3EWPA 5ELYA 3IIBA 4GM5A 2CIJA 4X3RA 3B7IA 3FH4A 2PCUA 2PJ4A 5JH9A 4OC5A 4MMOA 2FG1A 2C6PA 1AYEA 1XRYA 3KZWA 2VRIA 1PYTB 4P4FA 3WABA 2IQ6A 4OC1A 1KWMA 3FF3A 2BCOA 3Q6ZA 1XFOA 4ZX9A 1ARMA 3SIIA 3TC8A 4JGKA 3IIDA 3BHXA 4J5QA 2POKA 4Q7AA 3KHXA 3GUXA 2F7VA 3SIHA 3CPXA 4MCQA 4W9YA 1CP7A 3SJFA 4PXDA 4X2TA 3RAMA 4P4IA 4ABLA 1Y0YA 4MHYA 3EWOA 4GVVA 1LFWA 4UEEA 2AFSA 4P44A 3SI0A 4TWEA 3DLJA 2VL1A 2V8VA 5LRJA 3IC1A 1VHOA 5AILA 4ABKA 1QMUA 3B2YA 3V2BA 2X47A 2BFRA 5CB5A 5FSYA 3PB8X 2XEGA 2HB6A 2ZEMA 2ZENA 3SJGA 3IFEA 3FEDA 4EWTA 3KR5A 2ZEPA 1F2OA 2PJ8A 3WT4A 2AFOA 2GLJA 2ABZA 3ISZA 4R8FA 2EEEA 1ELMP 2PVWA 1VHUA 4B6ZA 2DX6A 4YWYA 2C6GA 3K2KA 2ZOFA 5DUSA 2PJ2A 4NGRA 3NH5A 2ACFA 4IQYA 5CBMA 1ARLA 1PCAA 1DTDA 1YW4A 4FWUA 3RZAA 5FSUA 4IHMA 4P4DA 4MXUA 1XBUA 4UEZA 2AFMA 7CPAA 5I4MA 4DJLA 2OOTA 3S9LA 3D7GA 1TF8A 2JBJA 3IO1A 1CBXA 5CMSA 1BPMA 5K8MA 2XD7A 5THWA 4KSIA 4MHPA 3PB6X 5LYLA 4R6TA 2ZELA 1ZG9A 3FEEA 1H8LA 2ZEGA 4ESSA 3V38A 1TKFA 1Z8LA 5LRKA 2PJ9A 3H8FA 3EW5A 2ZEEA 4UMLA 2BO9A 1Q7LA 5LRGA 1LAPA 5CB3A 3KGQA 1UWYA 5LYDA 4OIDA 3WC5A 1ZLHA 5LYFA 1YSJA 3MRUA 3PEIA 3D4UA 1NSAA 2IJZA 2PVVA 1CP6A 1LOKA 2PJCA 3GB0A 5HVGA 3B3TA 4UIAA 4FUUA 1HJZA 4A38A 4F9UA 4IAVA 1TXZA 1VIXA 2ANPA 2G9DA 1Y7EA 2PIZA 2ZOGA 3BI1A 4PQAA 1NJRA 4P45A 3S9NA 3GPOA 3QNVA 5IB9A 4NGNA 2PJ1A 5CPAA 2PE3A 1F57A 4G1PA 4MHZA 3EKEA 2Q51A 3S9MA 3VFQA 3KQXA 3KHZA 4PXEA 3PBEA 2XEJA 1CPXA 4UIBA 4NGTA
chains in the Genus database with same CATH superfamily
3GY9A 4UBRA 2GREA 2Z3LA 4CGMA 4AXVA 1TKJA 4MFPA 1IY7A 3TO9A 4MY0A 1DE4C 2JLMA 4DUKA 1Z4RA 3CZXA 2XEIA 4KOSA 5AG6A 4NFRA 2AFUA 3KL9A 4NF1A 2VI7A 3T90A 4OC3A 5EMIA 3CXPA 3IJ3A 3W6XA 2R8VA 3SJEA 3KASA 4M6IA 2V8HA 3L2NA 3D7HA 3GPGA 2CTCA 1HEEA 2AFWA 2J8MA 1BLLE 3BI0A 4HKFA 2EWBA 4KYBA 4JYWA 3FECA 4MCSA 5E96A 3DGVA 1F2PA 1Z8TA 5K8OA 5H84A 2JBKA 3H8EA 1R43A 2NSMA 1ZG8A 4GS4A 1QSMA 4NGQA 4UF4A 4NJQA 4P4BA 2PRQA 4PSWA 1U6MA 1IGBA 2B4DA 2FE7A 3FIXA 3FJUA 3PP9A 4MCPA 4ZY1A 4OADA 3K9TA 2B5GB 2CY2A 4ZI6A 2PJ3A 3R9GA 1GYTA 4OC4A 4OAEA 4JVVA 3D7FA 5K8PA 2FXFA 3IWWA 1IU8A 1YW6A 4K3NA 3TO6A 2O53A 3D7DA 3ZJ0A 3N7ZA 4MFLA 4J4ZA 1TXRA 3PB7X 2C27A 1YD9A 1Z5RA 1JWQA 3FXTA 4CAFA 4CAVA 2XEFA 4MFQA 5D29A 4KOTA 4FD6A 3V7ZA 3EJFA 1BPNA 1XMTA 2VZZA 1TY8A 4OC0A 4JZ0A 4CAXA 1M4DA 2FIAA 2EO8A 3GPQA 3S6GA 1ZLIA 2I3CA 3FVLA 4P10A 2G0BA 4FD7A 4L8AA 1XMBA 3S6HA 4PPZA 3NA6A 3D8PA 3LD2A 1QSRA 4IUSA 2FXKA 5C82A 1I21A 3FYNA 1RO5A 2V8DA 3ISXA 3B3VA 3QAYA 2Q7SA 3RBUA 2BUEA 2REFA 3C26A 2EBJA 3GIUA 4QVTA 3TE4A 2AE6A 1SPVA 3H8GA 4XPDB 1S7KA 3IEHA 2AFCA 4CAWA 2EK8A 4FD4A 1AMPA 2VZYA 3B3SA 4CGLA 2JDCA 4CYPA 5LYIA 3W6SA 4P6YA 3E0KA 3KI9A 4Y49B 2G3AA 4XNHB 4KVOE 3HLPA 4KOYA 2WZNA 1TF9A 2OU2A 4R9MA 2OB0A 1IOIA 4C7HA 4PK3A 4PXCA 2LGRA 4F9VA 4NJRA 4EFDA 3PFOA 1YMEA 3PB9X 1Z4EA 4I49A 3T8WA 4M3SA 4EVYA 1AUGA 2CTBA 2RFHA 2GLFA 1HDUA 2PDOA 3EXNA 5G20A 3MN8A 3V45A 1R3NA 2BEIA 2AFXA 4RI1A 4OLLA 5JGFA 1HDQA 4UEFA 3TT2A 5HOLA 1MK4A 4MCRA 3IGRA 4TU0A 2CF4A 3D2PA 3LWUA 4NGPA 2Z3MA 3FMCA 5A27A 1QSTA 3GQEA 4E0AA 2FT0A 4FAIA 4B14A 3JTKA 4OIWA 2QJ8A 3LACA 3F5BA 1B6BA 4JXRA 4YU9A 2NYQA 4A2ZA 3TTHA 1PU9A 1Y9WA 4P4JA 2GFQA 4FBEA 8CPAA 1XJOA 4OKOA 4BINA 1ZR5A 5FSZA 1XE4A 2FSRA 2FS5A 3EC4A 1Z2LA 3SI1A 3SJXA 3WR7A 5HXDA 2EK9A 1YLOA 4KVXA 4P4EA 2V8GA 3GLJA 2GE3A 5EBVA 1ZG7A 1QQ9A 1YVOA 2DEAA 4F8ZA 3IIFA 3PRTA 4UCMA 2A4NA 2I79A 2F8HA 4K0CA 5HIHA 4B5PA 2JZFA 2C6CA 4BD9A 2BOAA 3F8KA 6CPAA 4XPLA 4JLLA 3FB3A 3I1UA 1BO4A 4M6HA 3LMSA 2HUZA 4FD5A 4MHNA 1VHEA 2VBQA 4RUHA 2BSWA 4RS2A 4TNUA 5C88A 3PGPA 3B35A 4KOWA 2OZUA 1VGYA 5AG7A 4J5SA 2HQYA 1MJ9A 5DWNA 5ISVA 3MGDA 2IMOA 2YNDA 1S5KA 2R1IA 3CPAA 4IK2A 1FNOA 4MRIA 1X10A 4WWVA 5AG5A 3TO7A 4A37A 5KTAA 3EJGA 5AG4A 1I12A 2J8NA 2RB7A 1BAVA 2Q4ZA 5DS0A 3SIJA 3IWEA 2J9AA 3D3SA 2WPXA 2PJ0A 4OMEA 1LCPA 5E3BA 1B87A 4UA3A 2PJ5A 3EY5A 2GU2A 3NH4A 2OR4A 2PJ6A 2JZDA 2AFZA 2GIVA 2ZEHA 3BJ7A 4KOXA 4CGPA 4YFJA 4A39A 2WYRA 4HNYB 1YX0A 2FAVA 1NE9A 3EFAA 1M44A 1JQGA 3IWGA 5G21A 4AVAA 4ETKA 2B58A 2R7HA 3N5FA 2WPWA 4MBUA 4OC2A 5J1QA 3IU2A 2PC1A 2ODFA 4ZY0A 2FL4A 2G3TA 2JDDA 4XNHC 4NSQA 3NFZA 4YRHA 3NE7A 4R76A 3TOAA 2WSAA 5JM6A 2PJBA 3KKWA 4KOVA 1LAMA 1S7NA 3S9NA 1Q2DA 5CNPA 3BLNA 4NGSA 3A9LA 2ZW5A 2C1CA 3NH8A 1N71A 3CT9A 3SIGA 1ELLP 2K5TA 1M4GA 2CNSA 4LX9A 3SI2A 1LRZA 4Y49C 4Q36A 5FSVA 3R95A 3GYAA 4U9YA 3JZTA 3SHPA 1IICA 3PBBA 4JLYA 3EWQA 3VWDA 2V77A 4BBHA 4CYQA 2Q4VA 2BFQA 2PRBA 4UCPA 3SXNA 3PFEA 5HVFA 5HVHA 2ZEFA 4IF5A 2QYVA 2ZEDA 4R7MA 1OBRA 4ZX8A 5KTCA 4AVCA 2Z3NA 2Z3OA 5FSXA 3D68A 4GUAA 4LQGA 2EUIA 4R3LA 3JRUA 5F09A 2HC9A 1FT7A 1A2ZA 2VXKA 1ZR3A 4MFKA 4UWIA 3TX8A 4Z65A 1V0CA 3QAHA 1Y0RA 2PSWA 4OP4A 1TKHA 2J8RA 1CX8A 1MJBA 5H86A 1CPSA 4X8IA 4PXBA 4K30A 1VKCA 2FVGA 4QB9A 1M4LA 3CDXA 3BXMA 4A95A 3FBUA 2PJ7A 2OZGA 5D8NA 2Y0MA 3BJ8A 3D66A 4KSFA 4JWPA 5J8FA 1IYKA 2D4PA 2QVPA 4JCAA 2DPSA 2RNKA 3EWRA 3GKRA 2KCWA 4WJBA 5F49A 4CPAA 4CYOA 4DNCA 1XEBA 1LANA 2Z11A 2Q04A 3EO4A 5A28A 3B3WA 4H2KA 1R57A 2Q43A 1CG2A 3WC6A 3VARA 4ZY2A 4ETJA 2ZPAA 3HUVA 2Q44A 4ONWA 3JUWA 4EMEA 2QECA 3PB4X 3ETIA 1GHEA 4R87A 1ZO0A 1MJAA 1Z8XA 2HV2A 3B3CA 4KOUA 2O28A 2B3UA 4NGMA 4AG7A 2O4HA 4O23A 4AG9A 2FIWA 1YLEA 4ZYQA 1XIXA 4GVWA 1RTQA 3VATA 1IOFA 2JEWA 2B5GA 5JQ4A 4JXQA 4ZBGA 4HPSA 3VH9A 4A94A 5K8NA 1S60A 2PJAA 3KQZA 2Q4YA 3D67A 4LQ6A 4CS0B 4D86A 2ZEOA 3K9UA 4J5RA 4Q38A 3WC7A 3GQOA 5HMNA 3RNZA 3Q71A 1X12A 1EE3P 2L8RA 4DYOA 3FX6A 3KR4A 2PIYA 3EWPA 2GANA 5ELYA 3IIBA 4GM5A 2CIJA 4X3RA 4XPKA 3B7IA 1KUVA 2OH1A 3FH4A 4GXHA 3NE8A 5KTDA 2PCUA 2PJ4A 4U9ZA 4M85A 1OZPA 5JH9A 4OC5A 4MMOA 2FG1A 2C6PA 1YVKA 1QSNA 4KLVA 1AYEA 1RXTA 1XRYA 3KZWA 2Z3PA 2ZW4A 2ZW7A 4H6ZA 4UFWA 5F47A 3DR8A 3H4QA 3TCVA 2VEZA 4UIBA 5IX3A 2VRIA 1PYTB 4P4FA 4PV6A 3WABA 1WWZA 3UY5A 1S7LA 2IQ6A 3F0AA 4MY3A 4OC1A 1KWMA 3FF3A 3VWEA 1Z9UA 2BCOA 3DNSA 3Q6ZA 5JPHA 1XFOA 5IB0A 4ZX9A 4R57A 5BWAB 1ARMA 3SIIA 2Z0ZA 3TC8A 4JGKA 3ZZIA 4A32A 4KUBA 3IIDA 3D2MA 4MFZA 3BHXA 3TFYA 4J5QA 2YNCA 1CM0A 2POKA 4Q7AA 3I3GA 1NMTA 5J8CA 3RYOA 3KHXA 4XPDC 4MI4A 3SXOA 3R9FA 2H5MA 4F6AA 4PK2A 3GUXA 4PSXA 2I00A 2F7VA 3SIHA 3JVNA 4E2AA 5I0CA 3CPXA 4MCQA 3R96A 4W9YA 1CP7A 3SJFA 5G22A 4PXDA 4X2TA 1S3ZA 2B3VA 4P4IA 4ABLA 1Y0YA 4MHYA 3RAMA 2NMTA 3LODA 5IV0A 1QSOA 3EWOA 4GVVA 4ONUA 1LFWA 2OZHA 4UEEA 2AFSA 2B4BA 4P44A 3SI0A 1YR0A 4RN7A 4TWEA 3DLJA 1KUYA 2VL1A 4R3KA 2V8VA 1VHSA 3IC1A 1VHOA 5LRJA 1YQEA 3S6KA 5AILA 4ABKA 1QMUA 3B2YA 2PQ8A 3V2BA 1IB1E 2X47A 2BFRA 3I9SA 5CB5A 5FSYA 3PB8X 5FVJA 2XEGA 2HB6A 1S7FA 2CNMA 2ZEMA 2ZENA 3SJGA 1P4NA 5DWMA 2QMLA 3IFEA 4KVME 4AB7A 3FEDA 1PUAA 4JD6A 4B10A 4NXYA 4E8OA 1YREA 4EWTA 3KR5A 2ZEPA 2JEVA 2Z10A 3DSBA 1F2OA 4KUAA 4B12A 2PJ8A 3WT4A 2AFOA 2GLJA 3P2FA 2ABZA 3ISZA 4R8FA 2IL4A 1XF8A 2EEEA 1ELMP 2PVWA 1VHUA 4KZTA 5G1ZA 4B11A 4B6ZA 3CXQA 2DX6A 2X7BA 2C6GA 3K2KA 2ZOFA 4NEXA 4YWYA 5DUSA 3G8WA 2PJ2A 4H6UA 4NGRA 3RO0A 3NH5A 3H5ZA 3V8IA 2ACFA 4IQYA 4A31A 1CJWA 4X5KA 4NCZA 4B5PB 4L89A 5CBMA 1ARLA 1K4JA 1PCAA 1DTDA 2DF5A 3PZJA 1YW4A 1Q2CA 4FWUA 2ATRA 2VQYA 1FY7A 3RZAA 5FSUA 4IHMA 1P0HA 2Q0YA 4P4DA 2FCKA 4LUAA 4MXUA 4F0XA 5GCNA 4MHDA 5F48A 4A30A 2KQVA 1XBUA 4UEZA 2AFMA 2RC4A 7CPAA 5I4MA 4DJLA 2OOTA 3S9LA 4KORA 3P2HA 4QBJA 3D7GA 2F5IA 4A33A 2ZW6A 2P6GA 3R9EA 1TF8A 2D4OA 4CRZB 2QIRA 3DR6A 2JBJA 2PR1A 4KS9A 3IO1A 4CAEA 1WK4A 2P0WA 4QC6A 1CBXA 5CMSA 3CXSA 1BPMA 2Z3KA 3G3SA 3W91A 4C68A 2DXQA 3FRMA 3OWCA 5K8MA 4II9A 2XD7A 2WCTA 1Z8WA 2YGWA 4JJXA 5THWA 4KSIA 1BOBA 4C2YA 4UFVA 1L0CA 4B13A 2JZEA 4MHPA 4QUSA 3PB6X 5LYLA 3R1KA 4R6TA 2ZELA 1ZG9A 3FEEA 1H8LA 4ORFA 2ZEGA 4ESSA 3QB8A 3V38A 3B8GA 4F0YA 1TKFA 1Z8LA 2ARHA 5LRKA 4MFJA 2PJ9A 3H8FA 3EW5A 1KUXA 2ZEEA 1XOVA 4UMLA 1J4JA 4M6GA 2BO9A 1Q7LA 2EVNA 4B5OA 4AVBA 5LRGA 1YK3A 4BMHA 1LAPA 3TOBA 2BL1A 5CB3A 3KGQA 1UWYA 5LYDA 4OIDA 2YNEA 3WC5A 5AGEA 1ZLHA 4C2XA 5LYFA 4YGOA 2PR8A 1M1DA 3IU1A 1YSJA 4J3GA 4CRYB 3MRUA 2B4DB 3PEIA 2WUUA 3D4UA 3DDDA 4MJ8A 1NSAA 2IJZA 2P6EA 2PVVA 1CP6A 4CGNA 1LOKA 2PJCA 2YNCC 2ZXVA 3GB0A 4CYNA 4C7IA 2P6FA 5HVGA 2DPTA 4HNXB 3B3TA 4HNWB 4UIAA 2REEA 1HJZA 4FUUA 4A38A 4F9UA 3S6FA 4IAVA 1Y9KA 1TXZA 4KLWA 1VIXA 2ANPA 2G9DA 4H89A 1Y7EA 4U5YA 2CXAA 1YGHA 2PIZA 2ZOGA 4ZGYB 3BI1A 4PQAA 1NJRA 1TIQA 4C2ZA 2Q7BA 5F46A 4P45A 1NSLA 4UWJA 3GPOA 1SQHA 1KZFA 1Q2YA 3FNCA 3QNVA 2W2GA 1IYLA 5IB9A 4NGNA 3T9YA 4UFXA 2PJ1A 5EC4A 1UFHA 1I1DA 4PXEA 4CGOA 2R98A 1ON0A 5CPAA 1IIDA 1F57A 2PE3A 1Y7RA 4G1PA 4MHZA 3EKEA 2Q51A 2CNTA 4KSAA 5HH1A 3S9MA 3VFQA 3KQXA 2AJ6A 3KHZA 4UCNA 3PBEA 2XEJA 1CPXA 1M4IA 4NGTA
chains in the Genus database with same CATH topology
2GREA 4AXVA 1TKJA 1IY7A 1DE4C 4DUKA 2XEIA 4NFRA 2AFUA 3KL9A 4OC3A 3IJ3A 3SJEA 3KASA 2V8HA 3L2NA 3D7HA 3GPGA 2CTCA 1HEEA 2AFWA 3BI0A 1BLLE 4JYWA 2EWBA 4KYBA 3FECA 4MCSA 3DGVA 1F2PA 5K8OA 2JBKA 3H8EA 1R43A 2NSMA 1ZG8A 4NGQA 4UF4A 4NJQA 4P4BA 2PRQA 1IGBA 3FJUA 4MCPA 4ZY1A 3K9TA 2PJ3A 4ZI6A 1GYTA 4OC4A 4JVVA 3D7FA 5K8PA 3IWWA 1YW6A 4K3NA 2O53A 3D7DA 4J4ZA 1TXRA 3PB7X 1YD9A 1Z5RA 2XEFA 5D29A 3V7ZA 3EJFA 1BPNA 4OC0A 1TY8A 4JZ0A 3GPQA 1ZLIA 2I3CA 3FVLA 4P10A 1XMBA 4PPZA 3NA6A 2FXKA 3ISXA 2V8DA 3B3VA 3RBUA 1SPVA 3H8GA 3IEHA 2AFCA 2EK8A 1AMPA 3B3SA 5LYIA 4P6YA 3KI9A 3HLPA 2WZNA 1TF9A 4PXCA 2LGRA 4F9VA 4NJRA 4EFDA 3PFOA 1YMEA 3PB9X 3T8WA 2CTBA 2RFHA 2GLFA 1HDUA 3MN8A 3V45A 1R3NA 2AFXA 5JGFA 1HDQA 4UEFA 5HOLA 4MCRA 4TU0A 2CF4A 3LWUA 4NGPA 3FMCA 3GQEA 4FAIA 4OIWA 2QJ8A 4YU9A 2NYQA 4P4JA 8CPAA 4FBEA 1XJOA 4OKOA 1ZR5A 5FSZA 3SI1A 1Z2LA 3SJXA 5HXDA 2EK9A 1YLOA 4P4EA 2V8GA 3GLJA 1ZG7A 1QQ9A 2DEAA 4F8ZA 3IIFA 3PRTA 2F8HA 4K0CA 5HIHA 4BD9A 6CPAA 2C6CA 2BOAA 4JLLA 3I1UA 3LMSA 4MHNA 1VHEA 4RUHA 4TNUA 3B35A 1VGYA 4J5SA 2IMOA 4IK2A 3CPAA 4MRIA 4Z65A 5K8NA 1FNOA 4WWVA 4A37A 3EJGA 2RB7A 1BAVA 2Q4ZA 5DS0A 3SIJA 2J9AA 4OMEA 2PJ0A 1LCPA 5E3BA 2PJ5A 2GU2A 3NH4A 2OR4A 2PJ6A 2AFZA 2ZEHA 4A39A 2WYRA 2FAVA 1JQGA 4ETKA 3N5FA 4OC2A 5J1QA 4ZY0A 3NFZA 5JM6A 4R76A 2PJBA 1LAMA 4NGSA 2C1CA 3NH8A 3CT9A 3SIGA 1ELLP 3SI2A 5FSVA 3JZTA 3PBBA 3EWQA 2V77A 2BFQA 3PFEA 5HVFA 5HVHA 2ZEFA 2QYVA 2ZEDA 4R7MA 1OBRA 4ZX8A 5FSXA 3D68A 4GUAA 4LQGA 3JRUA 5F09A 2HC9A 1FT7A 3TX8A 1ZR3A 1Y0RA 4OP4A 1TKHA 1CX8A 1CPSA 4X8IA 4PXBA 2FVGA 1M4LA 3CDXA 3BXMA 2PJ7A 3D66A 5D8NA 2QVPA 4JCAA 3EWRA 4WJBA 4CPAA 1LANA 3B3WA 4H2KA 2Q43A 1CG2A 3WC6A 3VARA 4ZY2A 4ETJA 3HUVA 4ONWA 4EMEA 3PB4X 3ETIA 4NGMA 3B3CA 2O4HA 4O23A 4ZYQA 1RTQA 4GVWA 3VATA 2JEWA 4A94A 3VH9A 2PJAA 3KQZA 3D67A 4D86A 2ZEOA 4J5RA 3WC7A 3GQOA 3Q71A 1EE3P 2L8RA 4DYOA 3FX6A 3KR4A 2PIYA 3EWPA 5ELYA 3IIBA 4GM5A 2CIJA 4X3RA 3B7IA 3FH4A 2PCUA 2PJ4A 5JH9A 4OC5A 4MMOA 2FG1A 2C6PA 1AYEA 1XRYA 3KZWA 2VRIA 1PYTB 4P4FA 3WABA 2IQ6A 4OC1A 1KWMA 3FF3A 2BCOA 3Q6ZA 1XFOA 4ZX9A 1ARMA 3SIIA 3TC8A 4JGKA 3IIDA 3BHXA 4J5QA 2POKA 4Q7AA 3KHXA 3GUXA 2F7VA 3SIHA 3CPXA 4MCQA 4W9YA 1CP7A 3SJFA 4PXDA 4X2TA 3RAMA 4P4IA 4ABLA 1Y0YA 4MHYA 3EWOA 4GVVA 1LFWA 4UEEA 2AFSA 4P44A 3SI0A 4TWEA 3DLJA 2VL1A 2V8VA 5LRJA 3IC1A 1VHOA 5AILA 4ABKA 1QMUA 3B2YA 3V2BA 2X47A 2BFRA 5CB5A 5FSYA 3PB8X 2XEGA 2HB6A 2ZEMA 2ZENA 3SJGA 3IFEA 3FEDA 4EWTA 3KR5A 2ZEPA 1F2OA 2PJ8A 3WT4A 2AFOA 2GLJA 2ABZA 3ISZA 4R8FA 2EEEA 1ELMP 2PVWA 1VHUA 4B6ZA 2DX6A 4YWYA 2C6GA 3K2KA 2ZOFA 5DUSA 2PJ2A 4NGRA 3NH5A 2ACFA 4IQYA 5CBMA 1ARLA 1PCAA 1DTDA 1YW4A 4FWUA 3RZAA 5FSUA 4IHMA 4P4DA 4MXUA 1XBUA 4UEZA 2AFMA 7CPAA 5I4MA 4DJLA 2OOTA 3S9LA 3D7GA 1TF8A 2JBJA 3IO1A 1CBXA 5CMSA 1BPMA 5K8MA 2XD7A 5THWA 4KSIA 4MHPA 3PB6X 5LYLA 4R6TA 2ZELA 1ZG9A 3FEEA 1H8LA 2ZEGA 4ESSA 3V38A 1TKFA 1Z8LA 5LRKA 2PJ9A 3H8FA 3EW5A 2ZEEA 4UMLA 2BO9A 1Q7LA 5LRGA 1LAPA 5CB3A 3KGQA 1UWYA 5LYDA 4OIDA 3WC5A 1ZLHA 5LYFA 1YSJA 3MRUA 3PEIA 3D4UA 1NSAA 2IJZA 2PVVA 1CP6A 1LOKA 2PJCA 3GB0A 5HVGA 3B3TA 4UIAA 4FUUA 1HJZA 4A38A 4F9UA 4IAVA 1TXZA 1VIXA 2ANPA 2G9DA 1Y7EA 2PIZA 2ZOGA 3BI1A 4PQAA 1NJRA 4P45A 3S9NA 3GPOA 3QNVA 5IB9A 4NGNA 2PJ1A 5CPAA 2PE3A 1F57A 4G1PA 4MHZA 3EKEA 2Q51A 3S9MA 3VFQA 3KQXA 3KHZA 4PXEA 3PBEA 2XEJA 1CPXA 4UIBA 4NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRE A;  4AXV A;  1TKJ A;  1IY7 A;  1DE4 C;  4DUK A;  2XEI A;  4NFR A;  2AFU A;  3KL9 A;  4OC3 A;  3IJ3 A;  3SJE A;  3KAS A;  2V8H A;  3L2N A;  3D7H A;  3GPG A;  2CTC A;  1HEE A;  2AFW A;  3BI0 A;  1BLL E;  4JYW A;  2EWB A;  4KYB A;  3FEC A;  4MCS A;  3DGV A;  1F2P A;  5K8O A;  2JBK A;  3H8E A;  1R43 A;  2NSM A;  1ZG8 A;  4NGQ A;  4UF4 A;  4NJQ A;  4P4B A;  2PRQ A;  1IGB A;  3FJU A;  4MCP A;  4ZY1 A;  3K9T A;  2PJ3 A;  4ZI6 A;  1GYT A;  4OC4 A;  4JVV A;  3D7F A;  5K8P A;  3IWW A;  1YW6 A;  4K3N A;  2O53 A;  3D7D A;  4J4Z A;  1TXR A;  3PB7 X;  1YD9 A;  1Z5R A;  2XEF A;  5D29 A;  3V7Z A;  3EJF A;  1BPN A;  4OC0 A;  1TY8 A;  4JZ0 A;  3GPQ A;  1ZLI A;  2I3C A;  3FVL A;  4P10 A;  1XMB A;  4PPZ A;  3NA6 A;  2FXK A;  3ISX A;  2V8D A;  3B3V A;  3RBU A;  1SPV A;  3H8G A;  3IEH A;  2AFC A;  2EK8 A;  1AMP A;  3B3S A;  5LYI A;  4P6Y A;  3KI9 A;  3HLP A;  2WZN A;  1TF9 A;  4PXC A;  2LGR A;  4F9V A;  4NJR A;  4EFD A;  3PFO A;  1YME A;  3PB9 X;  3T8W A;  2CTB A;  2RFH A;  2GLF A;  1HDU A;  3MN8 A;  3V45 A;  1R3N A;  2AFX A;  5JGF A;  1HDQ A;  4UEF A;  5HOL A;  4MCR A;  4TU0 A;  2CF4 A;  3LWU A;  4NGP A;  3FMC A;  3GQE A;  4FAI A;  4OIW A;  2QJ8 A;  4YU9 A;  2NYQ A;  4P4J A;  8CPA A;  4FBE A;  1XJO A;  4OKO A;  1ZR5 A;  5FSZ A;  3SI1 A;  1Z2L A;  3SJX A;  5HXD A;  2EK9 A;  1YLO A;  4P4E A;  2V8G A;  3GLJ A;  1ZG7 A;  1QQ9 A;  2DEA A;  4F8Z A;  3IIF A;  3PRT A;  2F8H A;  4K0C A;  5HIH A;  4BD9 A;  6CPA A;  2C6C A;  2BOA A;  4JLL A;  3I1U A;  3LMS A;  4MHN A;  1VHE A;  4RUH A;  4TNU A;  3B35 A;  1VGY A;  4J5S A;  2IMO A;  4IK2 A;  3CPA A;  4MRI A;  4Z65 A;  5K8N A;  1FNO A;  4WWV A;  4A37 A;  3EJG A;  2RB7 A;  1BAV A;  2Q4Z A;  5DS0 A;  3SIJ A;  2J9A A;  4OME A;  2PJ0 A;  1LCP A;  5E3B A;  2PJ5 A;  2GU2 A;  3NH4 A;  2OR4 A;  2PJ6 A;  2AFZ A;  2ZEH A;  4A39 A;  2WYR A;  2FAV A;  1JQG A;  4ETK A;  3N5F A;  4OC2 A;  5J1Q A;  4ZY0 A;  3NFZ A;  5JM6 A;  4R76 A;  2PJB A;  1LAM A;  4NGS A;  2C1C A;  3NH8 A;  3CT9 A;  3SIG A;  1ELL P;  3SI2 A;  5FSV A;  3JZT A;  3PBB A;  3EWQ A;  2V77 A;  2BFQ A;  3PFE A;  5HVF A;  5HVH A;  2ZEF A;  2QYV A;  2ZED A;  4R7M A;  1OBR A;  4ZX8 A;  5FSX A;  3D68 A;  4GUA A;  4LQG A;  3JRU A;  5F09 A;  2HC9 A;  1FT7 A;  3TX8 A;  1ZR3 A;  1Y0R A;  4OP4 A;  1TKH A;  1CX8 A;  1CPS A;  4X8I A;  4PXB A;  2FVG A;  1M4L A;  3CDX A;  3BXM A;  2PJ7 A;  3D66 A;  5D8N A;  2QVP A;  4JCA A;  3EWR A;  4WJB A;  4CPA A;  1LAN A;  3B3W A;  4H2K A;  2Q43 A;  1CG2 A;  3WC6 A;  3VAR A;  4ZY2 A;  4ETJ A;  3HUV A;  4ONW A;  4EME A;  3PB4 X;  3ETI A;  4NGM A;  3B3C A;  2O4H A;  4O23 A;  4ZYQ A;  1RTQ A;  4GVW A;  3VAT A;  2JEW A;  4A94 A;  3VH9 A;  2PJA A;  3KQZ A;  3D67 A;  4D86 A;  2ZEO A;  4J5R A;  3WC7 A;  3GQO A;  3Q71 A;  1EE3 P;  2L8R A;  4DYO A;  3FX6 A;  3KR4 A;  2PIY A;  3EWP A;  5ELY A;  3IIB A;  4GM5 A;  2CIJ A;  4X3R A;  3B7I A;  3FH4 A;  2PCU A;  2PJ4 A;  5JH9 A;  4OC5 A;  4MMO A;  2FG1 A;  2C6P A;  1AYE A;  1XRY A;  3KZW A;  2VRI A;  1PYT B;  4P4F A;  3WAB A;  2IQ6 A;  4OC1 A;  1KWM A;  3FF3 A;  2BCO A;  3Q6Z A;  1XFO A;  4ZX9 A;  1ARM A;  3SII A;  3TC8 A;  4JGK A;  3IID A;  3BHX A;  4J5Q A;  2POK A;  4Q7A A;  3KHX A;  3GUX A;  2F7V A;  3SIH A;  3CPX A;  4MCQ A;  4W9Y A;  1CP7 A;  3SJF A;  4PXD A;  4X2T A;  3RAM A;  4P4I A;  4ABL A;  1Y0Y A;  4MHY A;  3EWO A;  4GVV A;  1LFW A;  4UEE A;  2AFS A;  4P44 A;  3SI0 A;  4TWE A;  3DLJ A;  2VL1 A;  2V8V A;  5LRJ A;  3IC1 A;  1VHO A;  5AIL A;  4ABK A;  1QMU A;  3B2Y A;  3V2B A;  2X47 A;  2BFR A;  5CB5 A;  5FSY A;  3PB8 X;  2XEG A;  2HB6 A;  2ZEM A;  2ZEN A;  3SJG A;  3IFE A;  3FED A;  4EWT A;  3KR5 A;  2ZEP A;  1F2O A;  2PJ8 A;  3WT4 A;  2AFO A;  2GLJ A;  2ABZ A;  3ISZ A;  4R8F A;  2EEE A;  1ELM P;  2PVW A;  1VHU A;  4B6Z A;  2DX6 A;  4YWY A;  2C6G A;  3K2K A;  2ZOF A;  5DUS A;  2PJ2 A;  4NGR A;  3NH5 A;  2ACF A;  4IQY A;  5CBM A;  1ARL A;  1PCA A;  1DTD A;  1YW4 A;  4FWU A;  3RZA A;  5FSU A;  4IHM A;  4P4D A;  4MXU A;  1XBU A;  4UEZ A;  2AFM A;  7CPA A;  5I4M A;  4DJL A;  2OOT A;  3S9L A;  3D7G A;  1TF8 A;  2JBJ A;  3IO1 A;  1CBX A;  5CMS A;  1BPM A;  5K8M A;  2XD7 A;  5THW A;  4KSI A;  4MHP A;  3PB6 X;  5LYL A;  4R6T A;  2ZEL A;  1ZG9 A;  3FEE A;  1H8L A;  2ZEG A;  4ESS A;  3V38 A;  1TKF A;  1Z8L A;  5LRK A;  2PJ9 A;  3H8F A;  3EW5 A;  2ZEE A;  4UML A;  2BO9 A;  1Q7L A;  5LRG A;  1LAP A;  5CB3 A;  3KGQ A;  1UWY A;  5LYD A;  4OID A;  3WC5 A;  1ZLH A;  5LYF A;  1YSJ A;  3MRU A;  3PEI A;  3D4U A;  1NSA A;  2IJZ A;  2PVV A;  1CP6 A;  1LOK A;  2PJC A;  3GB0 A;  5HVG A;  3B3T A;  4UIA A;  4FUU A;  1HJZ A;  4A38 A;  4F9U A;  4IAV A;  1TXZ A;  1VIX A;  2ANP A;  2G9D A;  1Y7E A;  2PIZ A;  2ZOG A;  3BI1 A;  4PQA A;  1NJR A;  4P45 A;  3S9N A;  3GPO A;  3QNV A;  5IB9 A;  4NGN A;  2PJ1 A;  5CPA A;  2PE3 A;  1F57 A;  4G1P A;  4MHZ A;  3EKE A;  2Q51 A;  3S9M A;  3VFQ A;  3KQX A;  3KHZ A;  4PXE A;  3PBE A;  2XEJ A;  1CPX A;  4UIB A;  4NGT A; 
#chains in the Genus database with same CATH topology
 3GY9 A;  4UBR A;  2GRE A;  2Z3L A;  4CGM A;  4AXV A;  1TKJ A;  4MFP A;  1IY7 A;  3TO9 A;  4MY0 A;  1DE4 C;  2JLM A;  4DUK A;  1Z4R A;  3CZX A;  2XEI A;  4KOS A;  5AG6 A;  4NFR A;  2AFU A;  3KL9 A;  4NF1 A;  2VI7 A;  3T90 A;  4OC3 A;  5EMI A;  3CXP A;  3IJ3 A;  3W6X A;  2R8V A;  3SJE A;  3KAS A;  4M6I A;  2V8H A;  3L2N A;  3D7H A;  3GPG A;  2CTC A;  1HEE A;  2AFW A;  2J8M A;  1BLL E;  3BI0 A;  4HKF A;  2EWB A;  4KYB A;  4JYW A;  3FEC A;  4MCS A;  5E96 A;  3DGV A;  1F2P A;  1Z8T A;  5K8O A;  5H84 A;  2JBK A;  3H8E A;  1R43 A;  2NSM A;  1ZG8 A;  4GS4 A;  1QSM A;  4NGQ A;  4UF4 A;  4NJQ A;  4P4B A;  2PRQ A;  4PSW A;  1U6M A;  1IGB A;  2B4D A;  2FE7 A;  3FIX A;  3FJU A;  3PP9 A;  4MCP A;  4ZY1 A;  4OAD A;  3K9T A;  2B5G B;  2CY2 A;  4ZI6 A;  2PJ3 A;  3R9G A;  1GYT A;  4OC4 A;  4OAE A;  4JVV A;  3D7F A;  5K8P A;  2FXF A;  3IWW A;  1IU8 A;  1YW6 A;  4K3N A;  3TO6 A;  2O53 A;  3D7D A;  3ZJ0 A;  3N7Z A;  4MFL A;  4J4Z A;  1TXR A;  3PB7 X;  2C27 A;  1YD9 A;  1Z5R A;  1JWQ A;  3FXT A;  4CAF A;  4CAV A;  2XEF A;  4MFQ A;  5D29 A;  4KOT A;  4FD6 A;  3V7Z A;  3EJF A;  1BPN A;  1XMT A;  2VZZ A;  1TY8 A;  4OC0 A;  4JZ0 A;  4CAX A;  1M4D A;  2FIA A;  2EO8 A;  3GPQ A;  3S6G A;  1ZLI A;  2I3C A;  3FVL A;  4P10 A;  2G0B A;  4FD7 A;  4L8A A;  1XMB A;  3S6H A;  4PPZ A;  3NA6 A;  3D8P A;  3LD2 A;  1QSR A;  4IUS A;  2FXK A;  5C82 A;  1I21 A;  3FYN A;  1RO5 A;  2V8D A;  3ISX A;  3B3V A;  3QAY A;  2Q7S A;  3RBU A;  2BUE A;  2REF A;  3C26 A;  2EBJ A;  3GIU A;  4QVT A;  3TE4 A;  2AE6 A;  1SPV A;  3H8G A;  4XPD B;  1S7K A;  3IEH A;  2AFC A;  4CAW A;  2EK8 A;  4FD4 A;  1AMP A;  2VZY A;  3B3S A;  4CGL A;  2JDC A;  4CYP A;  5LYI A;  3W6S A;  4P6Y A;  3E0K A;  3KI9 A;  4Y49 B;  2G3A A;  4XNH B;  4KVO E;  3HLP A;  4KOY A;  2WZN A;  1TF9 A;  2OU2 A;  4R9M A;  2OB0 A;  1IOI A;  4C7H A;  4PK3 A;  4PXC A;  2LGR A;  4F9V A;  4NJR A;  4EFD A;  3PFO A;  1YME A;  3PB9 X;  1Z4E A;  4I49 A;  3T8W A;  4M3S A;  4EVY A;  1AUG A;  2CTB A;  2RFH A;  2GLF A;  1HDU A;  2PDO A;  3EXN A;  5G20 A;  3MN8 A;  3V45 A;  1R3N A;  2BEI A;  2AFX A;  4RI1 A;  4OLL A;  5JGF A;  1HDQ A;  4UEF A;  3TT2 A;  5HOL A;  1MK4 A;  4MCR A;  3IGR A;  4TU0 A;  2CF4 A;  3D2P A;  3LWU A;  4NGP A;  2Z3M A;  3FMC A;  5A27 A;  1QST A;  3GQE A;  4E0A A;  2FT0 A;  4FAI A;  4B14 A;  3JTK A;  4OIW A;  2QJ8 A;  3LAC A;  3F5B A;  1B6B A;  4JXR A;  4YU9 A;  2NYQ A;  4A2Z A;  3TTH A;  1PU9 A;  1Y9W A;  4P4J A;  2GFQ A;  4FBE A;  8CPA A;  1XJO A;  4OKO A;  4BIN A;  1ZR5 A;  5FSZ A;  1XE4 A;  2FSR A;  2FS5 A;  3EC4 A;  1Z2L A;  3SI1 A;  3SJX A;  3WR7 A;  5HXD A;  2EK9 A;  1YLO A;  4KVX A;  4P4E A;  2V8G A;  3GLJ A;  2GE3 A;  5EBV A;  1ZG7 A;  1QQ9 A;  1YVO A;  2DEA A;  4F8Z A;  3IIF A;  3PRT A;  4UCM A;  2A4N A;  2I79 A;  2F8H A;  4K0C A;  5HIH A;  4B5P A;  2JZF A;  2C6C A;  4BD9 A;  2BOA A;  3F8K A;  6CPA A;  4XPL A;  4JLL A;  3FB3 A;  3I1U A;  1BO4 A;  4M6H A;  3LMS A;  2HUZ A;  4FD5 A;  4MHN A;  1VHE A;  2VBQ A;  4RUH A;  2BSW A;  4RS2 A;  4TNU A;  5C88 A;  3PGP A;  3B35 A;  4KOW A;  2OZU A;  1VGY A;  5AG7 A;  4J5S A;  2HQY A;  1MJ9 A;  5DWN A;  5ISV A;  3MGD A;  2IMO A;  2YND A;  1S5K A;  2R1I A;  3CPA A;  4IK2 A;  1FNO A;  4MRI A;  1X10 A;  4WWV A;  5AG5 A;  3TO7 A;  4A37 A;  5KTA A;  3EJG A;  5AG4 A;  1I12 A;  2J8N A;  2RB7 A;  1BAV A;  2Q4Z A;  5DS0 A;  3SIJ A;  3IWE A;  2J9A A;  3D3S A;  2WPX A;  2PJ0 A;  4OME A;  1LCP A;  5E3B A;  1B87 A;  4UA3 A;  2PJ5 A;  3EY5 A;  2GU2 A;  3NH4 A;  2OR4 A;  2PJ6 A;  2JZD A;  2AFZ A;  2GIV A;  2ZEH A;  3BJ7 A;  4KOX A;  4CGP A;  4YFJ A;  4A39 A;  2WYR A;  4HNY B;  1YX0 A;  2FAV A;  1NE9 A;  3EFA A;  1M44 A;  1JQG A;  3IWG A;  5G21 A;  4AVA A;  4ETK A;  2B58 A;  2R7H A;  3N5F A;  2WPW A;  4MBU A;  4OC2 A;  5J1Q A;  3IU2 A;  2PC1 A;  2ODF A;  4ZY0 A;  2FL4 A;  2G3T A;  2JDD A;  4XNH C;  4NSQ A;  3NFZ A;  4YRH A;  3NE7 A;  4R76 A;  3TOA A;  2WSA A;  5JM6 A;  2PJB A;  3KKW A;  4KOV A;  1LAM A;  1S7N A;  3S9N A;  1Q2D A;  5CNP A;  3BLN A;  4NGS A;  3A9L A;  2ZW5 A;  2C1C A;  3NH8 A;  1N71 A;  3CT9 A;  3SIG A;  1ELL P;  2K5T A;  1M4G A;  2CNS A;  4LX9 A;  3SI2 A;  1LRZ A;  4Y49 C;  4Q36 A;  5FSV A;  3R95 A;  3GYA A;  4U9Y A;  3JZT A;  3SHP A;  1IIC A;  3PBB A;  4JLY A;  3EWQ A;  3VWD A;  2V77 A;  4BBH A;  4CYQ A;  2Q4V A;  2BFQ A;  2PRB A;  4UCP A;  3SXN A;  3PFE A;  5HVF A;  5HVH A;  2ZEF A;  4IF5 A;  2QYV A;  2ZED A;  4R7M A;  1OBR A;  4ZX8 A;  5KTC A;  4AVC A;  2Z3N A;  2Z3O A;  5FSX A;  3D68 A;  4GUA A;  4LQG A;  2EUI A;  4R3L A;  3JRU A;  5F09 A;  2HC9 A;  1FT7 A;  1A2Z A;  2VXK A;  1ZR3 A;  4MFK A;  4UWI A;  3TX8 A;  4Z65 A;  1V0C A;  3QAH A;  1Y0R A;  2PSW A;  4OP4 A;  1TKH A;  2J8R A;  1CX8 A;  1MJB A;  5H86 A;  1CPS A;  4X8I A;  4PXB A;  4K30 A;  1VKC A;  2FVG A;  4QB9 A;  1M4L A;  3CDX A;  3BXM A;  4A95 A;  3FBU A;  2PJ7 A;  2OZG A;  5D8N A;  2Y0M A;  3BJ8 A;  3D66 A;  4KSF A;  4JWP A;  5J8F A;  1IYK A;  2D4P A;  2QVP A;  4JCA A;  2DPS A;  2RNK A;  3EWR A;  3GKR A;  2KCW A;  4WJB A;  5F49 A;  4CPA A;  4CYO A;  4DNC A;  1XEB A;  1LAN A;  2Z11 A;  2Q04 A;  3EO4 A;  5A28 A;  3B3W A;  4H2K A;  1R57 A;  2Q43 A;  1CG2 A;  3WC6 A;  3VAR A;  4ZY2 A;  4ETJ A;  2ZPA A;  3HUV A;  2Q44 A;  4ONW A;  3JUW A;  4EME A;  2QEC A;  3PB4 X;  3ETI A;  1GHE A;  4R87 A;  1ZO0 A;  1MJA A;  1Z8X A;  2HV2 A;  3B3C A;  4KOU A;  2O28 A;  2B3U A;  4NGM A;  4AG7 A;  2O4H A;  4O23 A;  4AG9 A;  2FIW A;  1YLE A;  4ZYQ A;  1XIX A;  4GVW A;  1RTQ A;  3VAT A;  1IOF A;  2JEW A;  2B5G A;  5JQ4 A;  4JXQ A;  4ZBG A;  4HPS A;  3VH9 A;  4A94 A;  5K8N A;  1S60 A;  2PJA A;  3KQZ A;  2Q4Y A;  3D67 A;  4LQ6 A;  4CS0 B;  4D86 A;  2ZEO A;  3K9U A;  4J5R A;  4Q38 A;  3WC7 A;  3GQO A;  5HMN A;  3RNZ A;  3Q71 A;  1X12 A;  1EE3 P;  2L8R A;  4DYO A;  3FX6 A;  3KR4 A;  2PIY A;  3EWP A;  2GAN A;  5ELY A;  3IIB A;  4GM5 A;  2CIJ A;  4X3R A;  4XPK A;  3B7I A;  1KUV A;  2OH1 A;  3FH4 A;  4GXH A;  3NE8 A;  5KTD A;  2PCU A;  2PJ4 A;  4U9Z A;  4M85 A;  1OZP A;  5JH9 A;  4OC5 A;  4MMO A;  2FG1 A;  2C6P A;  1YVK A;  1QSN A;  4KLV A;  1AYE A;  1RXT A;  1XRY A;  3KZW A;  2Z3P A;  2ZW4 A;  2ZW7 A;  4H6Z A;  4UFW A;  5F47 A;  3DR8 A;  3H4Q A;  3TCV A;  2VEZ A;  4UIB A;  5IX3 A;  2VRI A;  1PYT B;  4P4F A;  4PV6 A;  3WAB A;  1WWZ A;  3UY5 A;  1S7L A;  2IQ6 A;  3F0A A;  4MY3 A;  4OC1 A;  1KWM A;  3FF3 A;  3VWE A;  1Z9U A;  2BCO A;  3DNS A;  3Q6Z A;  5JPH A;  1XFO A;  5IB0 A;  4ZX9 A;  4R57 A;  5BWA B;  1ARM A;  3SII A;  2Z0Z A;  3TC8 A;  4JGK A;  3ZZI A;  4A32 A;  4KUB A;  3IID A;  3D2M A;  4MFZ A;  3BHX A;  3TFY A;  4J5Q A;  2YNC A;  1CM0 A;  2POK A;  4Q7A A;  3I3G A;  1NMT A;  5J8C A;  3RYO A;  3KHX A;  4XPD C;  4MI4 A;  3SXO A;  3R9F A;  2H5M A;  4F6A A;  4PK2 A;  3GUX A;  4PSX A;  2I00 A;  2F7V A;  3SIH A;  3JVN A;  4E2A A;  5I0C A;  3CPX A;  4MCQ A;  3R96 A;  4W9Y A;  1CP7 A;  3SJF A;  5G22 A;  4PXD A;  4X2T A;  1S3Z A;  2B3V A;  4P4I A;  4ABL A;  1Y0Y A;  4MHY A;  3RAM A;  2NMT A;  3LOD A;  5IV0 A;  1QSO A;  3EWO A;  4GVV A;  4ONU A;  1LFW A;  2OZH A;  4UEE A;  2AFS A;  2B4B A;  4P44 A;  3SI0 A;  1YR0 A;  4RN7 A;  4TWE A;  3DLJ A;  1KUY A;  2VL1 A;  4R3K A;  2V8V A;  1VHS A;  3IC1 A;  1VHO A;  5LRJ A;  1YQE A;  3S6K A;  5AIL A;  4ABK A;  1QMU A;  3B2Y A;  2PQ8 A;  3V2B A;  1IB1 E;  2X47 A;  2BFR A;  3I9S A;  5CB5 A;  5FSY A;  3PB8 X;  5FVJ A;  2XEG A;  2HB6 A;  1S7F A;  2CNM A;  2ZEM A;  2ZEN A;  3SJG A;  1P4N A;  5DWM A;  2QML A;  3IFE A;  4KVM E;  4AB7 A;  3FED A;  1PUA A;  4JD6 A;  4B10 A;  4NXY A;  4E8O A;  1YRE A;  4EWT A;  3KR5 A;  2ZEP A;  2JEV A;  2Z10 A;  3DSB A;  1F2O A;  4KUA A;  4B12 A;  2PJ8 A;  3WT4 A;  2AFO A;  2GLJ A;  3P2F A;  2ABZ A;  3ISZ A;  4R8F A;  2IL4 A;  1XF8 A;  2EEE A;  1ELM P;  2PVW A;  1VHU A;  4KZT A;  5G1Z A;  4B11 A;  4B6Z A;  3CXQ A;  2DX6 A;  2X7B A;  2C6G A;  3K2K A;  2ZOF A;  4NEX A;  4YWY A;  5DUS A;  3G8W A;  2PJ2 A;  4H6U A;  4NGR A;  3RO0 A;  3NH5 A;  3H5Z A;  3V8I A;  2ACF A;  4IQY A;  4A31 A;  1CJW A;  4X5K A;  4NCZ A;  4B5P B;  4L89 A;  5CBM A;  1ARL A;  1K4J A;  1PCA A;  1DTD A;  2DF5 A;  3PZJ A;  1YW4 A;  1Q2C A;  4FWU A;  2ATR A;  2VQY A;  1FY7 A;  3RZA A;  5FSU A;  4IHM A;  1P0H A;  2Q0Y A;  4P4D A;  2FCK A;  4LUA A;  4MXU A;  4F0X A;  5GCN A;  4MHD A;  5F48 A;  4A30 A;  2KQV A;  1XBU A;  4UEZ A;  2AFM A;  2RC4 A;  7CPA A;  5I4M A;  4DJL A;  2OOT A;  3S9L A;  4KOR A;  3P2H A;  4QBJ A;  3D7G A;  2F5I A;  4A33 A;  2ZW6 A;  2P6G A;  3R9E A;  1TF8 A;  2D4O A;  4CRZ B;  2QIR A;  3DR6 A;  2JBJ A;  2PR1 A;  4KS9 A;  3IO1 A;  4CAE A;  1WK4 A;  2P0W A;  4QC6 A;  1CBX A;  5CMS A;  3CXS A;  1BPM A;  2Z3K A;  3G3S A;  3W91 A;  4C68 A;  2DXQ A;  3FRM A;  3OWC A;  5K8M A;  4II9 A;  2XD7 A;  2WCT A;  1Z8W A;  2YGW A;  4JJX A;  5THW A;  4KSI A;  1BOB A;  4C2Y A;  4UFV A;  1L0C A;  4B13 A;  2JZE A;  4MHP A;  4QUS A;  3PB6 X;  5LYL A;  3R1K A;  4R6T A;  2ZEL A;  1ZG9 A;  3FEE A;  1H8L A;  4ORF A;  2ZEG A;  4ESS A;  3QB8 A;  3V38 A;  3B8G A;  4F0Y A;  1TKF A;  1Z8L A;  2ARH A;  5LRK A;  4MFJ A;  2PJ9 A;  3H8F A;  3EW5 A;  1KUX A;  2ZEE A;  1XOV A;  4UML A;  1J4J A;  4M6G A;  2BO9 A;  1Q7L A;  2EVN A;  4B5O A;  4AVB A;  5LRG A;  1YK3 A;  4BMH A;  1LAP A;  3TOB A;  2BL1 A;  5CB3 A;  3KGQ A;  1UWY A;  5LYD A;  4OID A;  2YNE A;  3WC5 A;  5AGE A;  1ZLH A;  4C2X A;  5LYF A;  4YGO A;  2PR8 A;  1M1D A;  3IU1 A;  1YSJ A;  4J3G A;  4CRY B;  3MRU A;  2B4D B;  3PEI A;  2WUU A;  3D4U A;  3DDD A;  4MJ8 A;  1NSA A;  2IJZ A;  2P6E A;  2PVV A;  1CP6 A;  4CGN A;  1LOK A;  2PJC A;  2YNC C;  2ZXV A;  3GB0 A;  4CYN A;  4C7I A;  2P6F A;  5HVG A;  2DPT A;  4HNX B;  3B3T A;  4HNW B;  4UIA A;  2REE A;  1HJZ A;  4FUU A;  4A38 A;  4F9U A;  3S6F A;  4IAV A;  1Y9K A;  1TXZ A;  4KLW A;  1VIX A;  2ANP A;  2G9D A;  4H89 A;  1Y7E A;  4U5Y A;  2CXA A;  1YGH A;  2PIZ A;  2ZOG A;  4ZGY B;  3BI1 A;  4PQA A;  1NJR A;  1TIQ A;  4C2Z A;  2Q7B A;  5F46 A;  4P45 A;  1NSL A;  4UWJ A;  3GPO A;  1SQH A;  1KZF A;  1Q2Y A;  3FNC A;  3QNV A;  2W2G A;  1IYL A;  5IB9 A;  4NGN A;  3T9Y A;  4UFX A;  2PJ1 A;  5EC4 A;  1UFH A;  1I1D A;  4PXE A;  4CGO A;  2R98 A;  1ON0 A;  5CPA A;  1IID A;  1F57 A;  2PE3 A;  1Y7R A;  4G1P A;  4MHZ A;  3EKE A;  2Q51 A;  2CNT A;  4KSA A;  5HH1 A;  3S9M A;  3VFQ A;  3KQX A;  2AJ6 A;  3KHZ A;  4UCN A;  3PBE A;  2XEJ A;  1CPX A;  1M4I A;  4NGT A; 
#chains in the Genus database with same CATH homology
 2GRE A;  4AXV A;  1TKJ A;  1IY7 A;  1DE4 C;  4DUK A;  2XEI A;  4NFR A;  2AFU A;  3KL9 A;  4OC3 A;  3IJ3 A;  3SJE A;  3KAS A;  2V8H A;  3L2N A;  3D7H A;  3GPG A;  2CTC A;  1HEE A;  2AFW A;  3BI0 A;  1BLL E;  4JYW A;  2EWB A;  4KYB A;  3FEC A;  4MCS A;  3DGV A;  1F2P A;  5K8O A;  2JBK A;  3H8E A;  1R43 A;  2NSM A;  1ZG8 A;  4NGQ A;  4UF4 A;  4NJQ A;  4P4B A;  2PRQ A;  1IGB A;  3FJU A;  4MCP A;  4ZY1 A;  3K9T A;  2PJ3 A;  4ZI6 A;  1GYT A;  4OC4 A;  4JVV A;  3D7F A;  5K8P A;  3IWW A;  1YW6 A;  4K3N A;  2O53 A;  3D7D A;  4J4Z A;  1TXR A;  3PB7 X;  1YD9 A;  1Z5R A;  2XEF A;  5D29 A;  3V7Z A;  3EJF A;  1BPN A;  4OC0 A;  1TY8 A;  4JZ0 A;  3GPQ A;  1ZLI A;  2I3C A;  3FVL A;  4P10 A;  1XMB A;  4PPZ A;  3NA6 A;  2FXK A;  3ISX A;  2V8D A;  3B3V A;  3RBU A;  1SPV A;  3H8G A;  3IEH A;  2AFC A;  2EK8 A;  1AMP A;  3B3S A;  5LYI A;  4P6Y A;  3KI9 A;  3HLP A;  2WZN A;  1TF9 A;  4PXC A;  2LGR A;  4F9V A;  4NJR A;  4EFD A;  3PFO A;  1YME A;  3PB9 X;  3T8W A;  2CTB A;  2RFH A;  2GLF A;  1HDU A;  3MN8 A;  3V45 A;  1R3N A;  2AFX A;  5JGF A;  1HDQ A;  4UEF A;  5HOL A;  4MCR A;  4TU0 A;  2CF4 A;  3LWU A;  4NGP A;  3FMC A;  3GQE A;  4FAI A;  4OIW A;  2QJ8 A;  4YU9 A;  2NYQ A;  4P4J A;  8CPA A;  4FBE A;  1XJO A;  4OKO A;  1ZR5 A;  5FSZ A;  3SI1 A;  1Z2L A;  3SJX A;  5HXD A;  2EK9 A;  1YLO A;  4P4E A;  2V8G A;  3GLJ A;  1ZG7 A;  1QQ9 A;  2DEA A;  4F8Z A;  3IIF A;  3PRT A;  2F8H A;  4K0C A;  5HIH A;  4BD9 A;  6CPA A;  2C6C A;  2BOA A;  4JLL A;  3I1U A;  3LMS A;  4MHN A;  1VHE A;  4RUH A;  4TNU A;  3B35 A;  1VGY A;  4J5S A;  2IMO A;  4IK2 A;  3CPA A;  4MRI A;  4Z65 A;  5K8N A;  1FNO A;  4WWV A;  4A37 A;  3EJG A;  2RB7 A;  1BAV A;  2Q4Z A;  5DS0 A;  3SIJ A;  2J9A A;  4OME A;  2PJ0 A;  1LCP A;  5E3B A;  2PJ5 A;  2GU2 A;  3NH4 A;  2OR4 A;  2PJ6 A;  2AFZ A;  2ZEH A;  4A39 A;  2WYR A;  2FAV A;  1JQG A;  4ETK A;  3N5F A;  4OC2 A;  5J1Q A;  4ZY0 A;  3NFZ A;  5JM6 A;  4R76 A;  2PJB A;  1LAM A;  4NGS A;  2C1C A;  3NH8 A;  3CT9 A;  3SIG A;  1ELL P;  3SI2 A;  5FSV A;  3JZT A;  3PBB A;  3EWQ A;  2V77 A;  2BFQ A;  3PFE A;  5HVF A;  5HVH A;  2ZEF A;  2QYV A;  2ZED A;  4R7M A;  1OBR A;  4ZX8 A;  5FSX A;  3D68 A;  4GUA A;  4LQG A;  3JRU A;  5F09 A;  2HC9 A;  1FT7 A;  3TX8 A;  1ZR3 A;  1Y0R A;  4OP4 A;  1TKH A;  1CX8 A;  1CPS A;  4X8I A;  4PXB A;  2FVG A;  1M4L A;  3CDX A;  3BXM A;  2PJ7 A;  3D66 A;  5D8N A;  2QVP A;  4JCA A;  3EWR A;  4WJB A;  4CPA A;  1LAN A;  3B3W A;  4H2K A;  2Q43 A;  1CG2 A;  3WC6 A;  3VAR A;  4ZY2 A;  4ETJ A;  3HUV A;  4ONW A;  4EME A;  3PB4 X;  3ETI A;  4NGM A;  3B3C A;  2O4H A;  4O23 A;  4ZYQ A;  1RTQ A;  4GVW A;  3VAT A;  2JEW A;  4A94 A;  3VH9 A;  2PJA A;  3KQZ A;  3D67 A;  4D86 A;  2ZEO A;  4J5R A;  3WC7 A;  3GQO A;  3Q71 A;  1EE3 P;  2L8R A;  4DYO A;  3FX6 A;  3KR4 A;  2PIY A;  3EWP A;  5ELY A;  3IIB A;  4GM5 A;  2CIJ A;  4X3R A;  3B7I A;  3FH4 A;  2PCU A;  2PJ4 A;  5JH9 A;  4OC5 A;  4MMO A;  2FG1 A;  2C6P A;  1AYE A;  1XRY A;  3KZW A;  2VRI A;  1PYT B;  4P4F A;  3WAB A;  2IQ6 A;  4OC1 A;  1KWM A;  3FF3 A;  2BCO A;  3Q6Z A;  1XFO A;  4ZX9 A;  1ARM A;  3SII A;  3TC8 A;  4JGK A;  3IID A;  3BHX A;  4J5Q A;  2POK A;  4Q7A A;  3KHX A;  3GUX A;  2F7V A;  3SIH A;  3CPX A;  4MCQ A;  4W9Y A;  1CP7 A;  3SJF A;  4PXD A;  4X2T A;  3RAM A;  4P4I A;  4ABL A;  1Y0Y A;  4MHY A;  3EWO A;  4GVV A;  1LFW A;  4UEE A;  2AFS A;  4P44 A;  3SI0 A;  4TWE A;  3DLJ A;  2VL1 A;  2V8V A;  5LRJ A;  3IC1 A;  1VHO A;  5AIL A;  4ABK A;  1QMU A;  3B2Y A;  3V2B A;  2X47 A;  2BFR A;  5CB5 A;  5FSY A;  3PB8 X;  2XEG A;  2HB6 A;  2ZEM A;  2ZEN A;  3SJG A;  3IFE A;  3FED A;  4EWT A;  3KR5 A;  2ZEP A;  1F2O A;  2PJ8 A;  3WT4 A;  2AFO A;  2GLJ A;  2ABZ A;  3ISZ A;  4R8F A;  2EEE A;  1ELM P;  2PVW A;  1VHU A;  4B6Z A;  2DX6 A;  4YWY A;  2C6G A;  3K2K A;  2ZOF A;  5DUS A;  2PJ2 A;  4NGR A;  3NH5 A;  2ACF A;  4IQY A;  5CBM A;  1ARL A;  1PCA A;  1DTD A;  1YW4 A;  4FWU A;  3RZA A;  5FSU A;  4IHM A;  4P4D A;  4MXU A;  1XBU A;  4UEZ A;  2AFM A;  7CPA A;  5I4M A;  4DJL A;  2OOT A;  3S9L A;  3D7G A;  1TF8 A;  2JBJ A;  3IO1 A;  1CBX A;  5CMS A;  1BPM A;  5K8M A;  2XD7 A;  5THW A;  4KSI A;  4MHP A;  3PB6 X;  5LYL A;  4R6T A;  2ZEL A;  1ZG9 A;  3FEE A;  1H8L A;  2ZEG A;  4ESS A;  3V38 A;  1TKF A;  1Z8L A;  5LRK A;  2PJ9 A;  3H8F A;  3EW5 A;  2ZEE A;  4UML A;  2BO9 A;  1Q7L A;  5LRG A;  1LAP A;  5CB3 A;  3KGQ A;  1UWY A;  5LYD A;  4OID A;  3WC5 A;  1ZLH A;  5LYF A;  1YSJ A;  3MRU A;  3PEI A;  3D4U A;  1NSA A;  2IJZ A;  2PVV A;  1CP6 A;  1LOK A;  2PJC A;  3GB0 A;  5HVG A;  3B3T A;  4UIA A;  4FUU A;  1HJZ A;  4A38 A;  4F9U A;  4IAV A;  1TXZ A;  1VIX A;  2ANP A;  2G9D A;  1Y7E A;  2PIZ A;  2ZOG A;  3BI1 A;  4PQA A;  1NJR A;  4P45 A;  3S9N A;  3GPO A;  3QNV A;  5IB9 A;  4NGN A;  2PJ1 A;  5CPA A;  2PE3 A;  1F57 A;  4G1P A;  4MHZ A;  3EKE A;  2Q51 A;  3S9M A;  3VFQ A;  3KQX A;  3KHZ A;  4PXE A;  3PBE A;  2XEJ A;  1CPX A;  4UIB A;  4NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...