3KQXA

Structure of a protease 1
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqxA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqxA02
4ZI6A 2PJ7A 2JBJA 2JEWA 5HOLA 2BCOA 3I1UA 3PFEA 3VATA 5I4MA 3KGQA 5HVHA 1YD9A 4FUUA 2CF4A 3D4UA 3EW5A 3BXMA 4R6TA 4X3RA 1Z2LA 2FVGA 3B35A 2DX6A 1BPMA 2ZEOA 1ZR3A 3SJXA 3ISZA 4O23A 2AFXA 5HVGA 3FMCA 2BFQA 3CDXA 3BHXA 3IIBA 4ABKA 4PXEA 4IQYA 1JQGA 1IY7A 3RBUA 1CP7A 4MCPA 4MHNA 3RZAA 3IO1A 2ZEMA 2PJ4A 1AMPA 4UEFA 4A94A 4NGSA 2HB6A 1TXRA 4ZY1A 4P4BA 5LYDA 5K8MA 4NGMA 2PIYA 4GVVA 2GREA 3IWWA 2IMOA 1VGYA 4Z65A 3Q6ZA 3PB7X 2Q51A 2BOAA 3D7HA 1TY8A 3B3WA 3FH4A 3QNVA 2ACFA 4IK2A 3SI1A 3CPAA 1BLLE 1NJRA 1ARMA 4MXUA 2PJ5A 5THWA 3B3TA 3IEHA 2LGRA 1R3NA 4OC5A 1TKHA 5CB5A 4MRIA 4A38A 4MCSA 2F8HA 4P4EA 5HVFA 2FG1A 4P45A 4BD9A 3SI2A 3D67A 1ZG8A 1FT7A 1CG2A 3B3CA 1F2PA 5FSZA 1IGBA 1LFWA 4FAIA 2O53A 4NGPA 3SJGA 3CPXA 3D68A 5HIHA 3L2NA 3LWUA 3IIFA 4X2TA 4R7MA 1QMUA 5DS0A 4ABLA 1TF8A 3FECA 4IHMA 2IQ6A 2PJ0A 1Q7LA 1ELMP 3EWRA 4GUAA 4P4DA 5J1QA 2EK8A 4JYWA 3KZWA 2C6CA 3PB4X 2G9DA 3V45A 3HLPA 4NGRA 4P10A 2QJ8A 3NH4A 1YSJA 4WWVA 1TF9A 4MHZA 4X8IA 5E3BA 2EK9A 1UWYA 5JM6A 4WJBA 3DGVA 3IJ3A 1HJZA 5LRJA 1OBRA 3K9TA 3PB9X 2PJ1A 3DLJA 4CPAA 1ARLA 3WC6A 2POKA 2VRIA 4ONWA 4KSIA 4OKOA 3VFQA 4IAVA 4JVVA 3BI0A 3FVLA 3D7GA 3EJFA 4K0CA 3H8FA 2PJBA 4JZ0A 4FWUA 1XRYA 4PQAA 4JLLA 2V8DA 3NH5A 1ZLHA 2XEFA 3PEIA 2ANPA 3FF3A 4EMEA 3CT9A 2CTCA 2GLFA 2PJ9A 2ZEGA 3NFZA 1YW4A 1PYTB 2F7VA 4OC1A 1NSAA 1VHOA 2PJ8A 2RB7A 4ZX8A 4OMEA 5FSUA 2ZOFA 5CB3A 2V8GA 3B7IA 4OIDA 3VH9A 4J5SA 4NJRA 3GQOA 2CIJA 2GU2A 2EWBA 2PVWA 2OR4A 2PJCA 1H8LA 2WYRA 2BO9A 2IJZA 1LCPA 3LMSA 3EWQA 3KASA 2ZEPA 5JH9A 2J9AA 1HDQA 4UEEA 1HDUA 4B6ZA 7CPAA 3VARA 4MCRA 3PBBA 3RAMA 1Y7EA 4MCQA 4ZY0A 3V7ZA 2FXKA 2AFZA 2VL1A 1Y0YA 3ISXA 4F9VA 3WC7A 3FEDA 2C6PA 4J5QA 1TXZA 5CMSA 1R43A 5HXDA 4MMOA 3WT4A 8CPAA 3PRTA 4ZY2A 1DTDA 3BI1A 3GPOA 5LYFA 2PE3A 1M4LA 2XEIA 4P4IA 4OC2A 4MHPA 3SIHA 2XEJA 4UMLA 3SI0A 3EWPA 2I3CA 1Z5RA 1KWMA 4NGTA 4EWTA 2BFRA 4ZYQA 3D66A 4ETJA 2PJ3A 4GVWA 4DUKA 4PXCA 5JGFA 3ETIA 3WABA 1TKJA 3D7DA 4AXVA 1CPSA 3EWOA 5K8PA 4MHYA 3H8EA 1Y0RA 4GM5A 2NYQA 1RTQA 4ESSA 2V8HA 3FJUA 3KR5A 2ZEEA 4OC4A 2GLJA 4DYOA 2L8RA 2CTBA 4TU0A 4J5RA 5ELYA 2RFHA 5LYLA 5K8OA 5D8NA 1ZG9A 3SJFA 6CPAA 3K2KA 3B2YA 4G1PA 4OP4A 3KR4A 2PVVA 3NH8A 5LYIA 1XBUA 3B3SA 4YU9A 3TC8A 5IB9A 5CPAA 1Z8LA 4UEZA 2X47A 3EKEA 2ZELA 3NA6A 4R76A 1VHUA 2C1CA 4UF4A 3T8WA 1ZR5A 2FAVA 2C6GA 2PRQA 3V2BA 2PJ6A 4OC0A 2AFCA 3JRUA 4DJLA 2AFUA 3IIDA 3H8GA 3EJGA 1YMEA 1FNOA 3S9NA 1YLOA 3PBEA 3PFOA 3SIJA 5F09A 1GYTA 5D29A 2ZENA 3KHZA 3FEEA 1CBXA 3Q71A 2ZOGA 4EFDA 4W9YA 2ZEDA 4R8FA 3MRUA 4PXDA 2PJ2A 2ZEFA 4NGNA 5FSVA 1BPNA 4LQGA 3KQXA 4D86A 4NGQA 2NSMA 3N5FA 2V77A 4P44A 2WZNA 4PXBA 3GPQA 1CP6A 1ELLP 2JBKA 4UIAA 3GUXA 4PPZA 2EEEA 3GLJA 5FSYA 2HC9A 3KHXA 3GPGA 2PIZA 3WC5A 3KL9A 3V38A 3IC1A 4P4JA 2PJAA 1AYEA 4JCAA 1QQ9A 2AFOA 5CBMA 4NFRA 3GB0A 1CX8A 3S9LA 4F9UA 2AFWA 1LAMA 1DE4C 4ZX9A 5K8NA 2AFSA 3KI9A 4H2KA 1CPXA 2QVPA 1LOKA 2Q4ZA 4TNUA 1LANA 2Q43A 4NJQA 5FSXA 4ETKA 2QYVA 3JZTA 3D7FA 5LRKA 1XMBA 4FBEA 5DUSA 1ZG7A 4Q7AA 4TWEA 4F8ZA 1VHEA 1EE3P 2ZEHA 1F2OA 3S9MA 1HEEA 1F57A 1PCAA 4KYBA 5AILA 5LRGA 3KQZA 3SIGA 2V8VA 4P6YA 1XFOA 4JGKA 3GQEA 2O4HA 1SPVA 3B3VA 3SJEA 4A39A 1TKFA 3IFEA 4YWYA 1XJOA 3MN8A 1LAPA 1ZLIA 2OOTA 4A37A 3TX8A 3FX6A 2ABZA 4K3NA 1YW6A 1BAVA 3HUVA 2XD7A 3SIIA 3PB8X 3PB6X 4UIBA 4P4FA 2XEGA 4OC3A 2DEAA 4RUHA 4OIWA 1VIXA 2PCUA 4J4ZA 2AFMA
chains in the Genus database with same CATH superfamily
4ZI6A 2YGWA 3RNZA 2PJ7A 2Z3MA 3F0AA 2JBJA 4BMHA 2JEWA 2I00A 5HOLA 2BCOA 2B4BA 3I1UA 1S7LA 1Y9WA 2DF5A 3PFEA 3VATA 4B11A 5I4MA 3KGQA 4B5OA 4H6UA 3B8GA 5HVHA 1YD9A 4FUUA 4I49A 2CNSA 2CF4A 3D4UA 3EW5A 3BXMA 2JLMA 4R6TA 4XPLA 4YFJA 4X3RA 3FIXA 1Z2LA 5GCNA 2FVGA 5AG5A 1KUYA 3B35A 2ZW6A 5EC4A 4XNHC 2P6EA 1Z9UA 2DX6A 1BPMA 3VWEA 2ZEOA 1ZR3A 3SJXA 4KVXA 3ISZA 4O23A 2AFXA 5HVGA 3FMCA 2BFQA 3CDXA 2JZEA 1YQEA 4QC6A 3BHXA 2FL4A 3IIBA 4PSWA 4B5PA 4ABKA 4PXEA 2FT0A 2Z3NA 4IQYA 4CYNA 2HQYA 1R57A 1JQGA 1KUXA 1QSOA 4NF1A 4E8OA 4II9A 2FIWA 1IY7A 3RBUA 4UFXA 3TFYA 3EFAA 1CP7A 4A30A 4CGPA 3PZJA 1RXTA 4MHNA 4MCPA 1TIQA 3D2PA 1M4DA 4X5KA 3RZAA 4CRZB 4M6HA 3A9LA 3IO1A 5DWMA 2JEVA 3WR7A 1K4JA 2ZEMA 2PJ4A 1KUVA 1M4IA 1AMPA 4UEFA 2WUUA 4A32A 4A94A 1S7FA 4NGSA 2HB6A 4FD5A 2REFA 1YVKA 2IL4A 1TXRA 4ZY1A 4U9YA 4K30A 1Z8XA 5C82A 3GIUA 4P4BA 2P0WA 2R7HA 5LYDA 2DXQA 4HNYB 2A4NA 4NGMA 2EBJA 2WCTA 2PIYA 5K8MA 3EC4A 4GVVA 4OAEA 2GREA 4KVOE 3IWWA 1V0CA 2IMOA 3V8IA 1VGYA 1IYLA 4Z65A 2B3UA 3Q6ZA 2EVNA 2OB0A 3PB7X 2Q51A 2BOAA 4DNCA 3D7HA 2GIVA 4J3GA 2JDDA 1TY8A 2PR8A 4UBRA 3B3WA 2QECA 2ZXVA 3FH4A 3C26A 2ACFA 3QNVA 3R96A 4IK2A 3SI1A 5AG7A 3CPAA 4HKFA 1BLLE 1NJRA 1ARMA 1CM0A 2B5GB 2GANA 2PJ5A 3E0KA 4MXUA 2REEA 2KQVA 5THWA 3BJ8A 1Z4EA 2P6FA 4AVAA 2G0BA 2HUZA 4M6GA 4MFLA 1UFHA 1PU9A 3B3TA 3IEHA 1U6MA 3P2HA 4UFWA 5H84A 2LGRA 1R3NA 4OC5A 1WWZA 2I79A 4CGMA 1YK3A 4FD6A 1M1DA 2C27A 4MFJA 1TKHA 5CB5A 4HPSA 2H5MA 4MRIA 4MCSA 4QB9A 3T90A 2F8HA 4UWIA 4A38A 1NMTA 4P4EA 1RO5A 5HVFA 3PP9A 1IICA 2FG1A 3R9GA 2VXKA 5BWAB 3S6KA 1Q2YA 1IOFA 1MJAA 1XF8A 4P45A 1Q2CA 4BD9A 3SI2A 1B87A 3IWGA 3D67A 1ZG8A 1FT7A 4U5YA 1CG2A 3B3CA 1F2PA 4CYPA 5FSZA 2PDOA 4CAXA 5IV0A 4MJ8A 2Q04A 1SQHA 3IWEA 4KOTA 1IGBA 5F48A 1LFWA 2Z0ZA 4FAIA 2O53A 4NGPA 3SJGA 4AG7A 3CPXA 4PSXA 2OZUA 3D68A 4JJXA 5HIHA 3L2NA 3LWUA 3IIFA 1IU8A 4X2TA 4R7MA 1IYKA 2VQYA 3LODA 1QMUA 1XIXA 5DS0A 1YLEA 3ZJ0A 4ABLA 1JWQA 1TF8A 2PC1A 4BINA 3FECA 1Z8WA 4ORFA 3RYOA 4IHMA 4C2XA 2IQ6A 2Z3LA 3W6SA 2G3AA 4IF5A 2PJ0A 1Q7LA 2B4DB 4JXRA 1ELMP 2B4DA 3FBUA 4QVTA 3EWRA 4GUAA 4P4DA 5J1QA 4KOWA 2EK8A 1Z8TA 4JYWA 3KZWA 2C6CA 4M6IA 4A31A 1QSRA 3PB4X 1S7KA 2G9DA 4CAWA 3V45A 2VBQA 3HLPA 3EXNA 4KLVA 4NGRA 2AE6A 2BL1A 4P10A 4PK3A 4AVBA 4B12A 4MY3A 2QJ8A 3NH4A 2CY2A 5G22A 1YSJA 4WWVA 1TF9A 4MHZA 1P4NA 4X8IA 5E3BA 3KKWA 4KS9A 4XPDB 2EK9A 4CAVA 2BUEA 1UWYA 2ZPAA 3EO4A 4IUSA 5AGEA 4KOVA 2BSWA 5JM6A 2ODFA 4WJBA 1Y9KA 2Z3OA 3DGVA 3IJ3A 4C2YA 1HJZA 2PRBA 3GKRA 4R3LA 2B58A 5F49A 3QAYA 5LRJA 1OBRA 5C88A 2P6GA 3K9TA 3PB9X 4HNXB 3TTHA 2PJ1A 3DLJA 2FSRA 2PQ8A 2OH1A 4ZGYB 2PSWA 4CPAA 1ARLA 4OLLA 3BJ7A 3WC6A 2POKA 2VRIA 1YREA 4KSIA 2ARHA 4OKOA 4ONWA 4R87A 3H4QA 4Y49B 3VFQA 3FNCA 4IAVA 4JVVA 3BI0A 3FVLA 3D7GA 2FIAA 3EJFA 3D2MA 4K0CA 2Z11A 4GXHA 3H8FA 3D8PA 2PJBA 4JZ0A 4FWUA 1XRYA 3MGDA 4PQAA 4CS0B 1A2ZA 4JLLA 2V8DA 3NH5A 5AG4A 1S5KA 4EVYA 1ZLHA 2XEFA 3PEIA 2ANPA 3FF3A 1N71A 4EMEA 3CT9A 2CTCA 4LQ6A 5F46A 2GLFA 2PJ9A 2ZEGA 3NFZA 1YW4A 2RC4A 2FE7A 4QBJA 4BBHA 1PYTB 1XE4A 1QSNA 2F7VA 4R57A 4OC1A 3VWDA 1NSAA 1VHOA 2PJ8A 5DWNA 2RB7A 4ZX8A 3IGRA 4OMEA 2Z3KA 5FSUA 2ZOFA 5CB3A 2WPWA 4QUSA 3FYNA 1NSLA 4L8AA 2V8GA 3B7IA 2R8VA 4OIDA 2K5TA 3VH9A 3DR6A 2Z10A 4H6ZA 4J5SA 4UFVA 3F8KA 4NJRA 4MY0A 4PV6A 2OU2A 3GQOA 2CIJA 3TCVA 2VZYA 2GU2A 2EWBA 2PVWA 4CAFA 2OR4A 4MFZA 2CXAA 2PJCA 3DDDA 1H8LA 2BO9A 2PR1A 2O28A 2WYRA 4CGLA 2IJZA 1LCPA 3LMSA 4KZTA 4XNHB 4F0YA 3EWQA 2B5GA 3KASA 2ZEPA 3TO9A 4KOSA 3H5ZA 5JH9A 2J9AA 3DNSA 1HDQA 4UEEA 1HDUA 4B6ZA 4E0AA 7CPAA 3VARA 4MCRA 4UA3A 3JVNA 4RS2A 5J8CA 3PBBA 2Q7BA 3RAMA 3G8WA 1Y7EA 4MCQA 4C68A 4ZY0A 1P0HA 4KVME 3V7ZA 2FXKA 4R3KA 1XMTA 2AFZA 4JWPA 5F47A 2VL1A 1Y0YA 1I12A 3QB8A 3ISXA 2R98A 4F9VA 3WC7A 1VHSA 2X7BA 3EY5A 3FEDA 2OZGA 4CYOA 3CXQA 2BEIA 3K9UA 2C6PA 4J5QA 1TXZA 5CMSA 1R43A 4XPDC 5HXDA 3BLNA 4MMOA 3WT4A 3DSBA 3PRTA 4Q38A 8CPAA 4ZY2A 3P2FA 1DTDA 5IX3A 3BI1A 3GPOA 1MJ9A 2D4PA 5LYFA 2PE3A 1M4LA 2XEIA 4KSFA 4P4IA 1AUGA 1IB1E 4OC2A 3I9SA 4MHPA 3SIHA 5KTCA 2XEJA 5HH1A 4UMLA 3SI0A 3EWPA 5I0CA 1XOVA 2YNEA 2I3CA 1Z5RA 1KWMA 2Q44A 4NGTA 4L89A 4EWTA 2YNCA 2BFRA 4ZYQA 2OZHA 4JXQA 4Y49C 3D66A 2CNTA 4ETJA 2PJ3A 4GVWA 4KUAA 2J8NA 1BO4A 4R9MA 1Z4RA 5FVJA 4DUKA 2EUIA 4PXCA 5JGFA 3ETIA 4YRHA 3WABA 1TKJA 3D7DA 5J8FA 1MK4A 4AXVA 1CPSA 3EWOA 3N7ZA 5IB0A 5K8PA 4MHYA 2Q4YA 3LACA 5AG6A 3H8EA 3W6XA 1Y0RA 2EO8A 2R1IA 4GM5A 4OADA 2JZFA 5KTAA 2NYQA 4FD7A 4H89A 5EMIA 4LX9A 1RTQA 4ZBGA 4ESSA 2V8HA 3FJUA 3KR5A 2ZEEA 4CYQA 2RNKA 4OC4A 2W2GA 2GLJA 4KOUA 3SHPA 4DYOA 3NE8A 2L8RA 2CTBA 4TU0A 4J5RA 5ELYA 2RFHA 2NMTA 3ZZIA 5HMNA 3CZXA 4B13A 5K8OA 5LYLA 1Y7RA 3R1KA 3W91A 4CRYB 1ZG9A 5D8NA 4JLYA 3SJFA 4FD4A 2VEZA 5CNPA 3SXNA 6CPAA 3IU2A 3K2KA 3B2YA 2Z3PA 2GFQA 4G1PA 4OP4A 4MFQA 3KR4A 3GY9A 3QAHA 3GYAA 5H86A 1KZFA 2PVVA 2VI7A 3NH8A 5LYIA 1XBUA 2QIRA 3B3SA 3LD2A 4YU9A 1B6BA 1ZO0A 1YVOA 3TC8A 5IB9A 4KOYA 5CPAA 3I3GA 2Q7SA 3R9FA 3CXPA 1Z8LA 4UEZA 2X47A 3OWCA 4AG9A 3EKEA 1M4GA 3NE7A 2ZELA 4KORA 1J4JA 1X10A 3NA6A 4R76A 1VHUA 1NE9A 2C1CA 4MFKA 4UF4A 4CGOA 3T8WA 2YNDA 1ZR5A 2FAVA 2C6GA 4A33A 2PRQA 3V2BA 3TOAA 2PJ6A 3TE4A 5E96A 4OC0A 2AFCA 4B5PB 3JRUA 4DJLA 2AFUA 3IIDA 3H8GA 3EJGA 1YMEA 1FNOA 4XPKA 4MHDA 3S9NA 1YLOA 4UWJA 3PBEA 3PFOA 1BOBA 2HV2A 3TO6A 1OZPA 3T9YA 4HNWB 4F0XA 3SIJA 5F09A 2VZZA 1GYTA 5D29A 2ZENA 3KHZA 3FEEA 1CBXA 4UCPA 4A2ZA 3Q71A 2ZOGA 4EFDA 1Q2DA 4W9YA 2ZEDA 4R8FA 4RI1A 5G1ZA 2J8RA 3JTKA 3MRUA 3RO0A 4PXDA 2PJ2A 1XEBA 2ZEFA 3DR8A 4NGNA 3R95A 5KTDA 5FSVA 2ZW7A 1BPNA 4LUAA 4LQGA 4F6AA 3KQXA 1ON0A 3FRMA 2QMLA 4D86A 4NGQA 2NSMA 3N5FA 2V77A 4MBUA 2WZNA 4P44A 4PXBA 3GPQA 1CP6A 1I21A 4MI4A 4NSQA 1FY7A 2F5IA 1VKCA 1ELLP 2JBKA 2FS5A 4PK2A 4E2AA 5A27A 5JPHA 4UIAA 3GUXA 4PPZA 2EEEA 3TO7A 3GLJA 5FSYA 2HC9A 3KHXA 3GPGA 2G3TA 2PIZA 3WC5A 1L0CA 3KL9A 3V38A 2YNCC 3IC1A 4P4JA 4B14A 2PJAA 1AYEA 4M3SA 3R9EA 4JCAA 1QQ9A 1YR0A 2AFOA 3F5BA 5CBMA 2KCWA 4KSAA 2D4OA 2DPSA 3FXTA 4NFRA 2JDCA 2ZW4A 3GB0A 4KOXA 1IIDA 3UY5A 4CGNA 1M44A 1QSMA 1S60A 1CX8A 5EBVA 4B10A 3S9LA 4F9UA 4MFPA 2AFWA 4Q36A 1LAMA 3FB3A 1DE4C 3JUWA 4ZX9A 4KLWA 3TT2A 1MJBA 4KUBA 4CAEA 2AFSA 3KI9A 4ONUA 5K8NA 3D3SA 4H2KA 1I1DA 3SXOA 2CNMA 1CPXA 2QVPA 3G3SA 1LOKA 2Q4ZA 4TNUA 3S6HA 1LANA 2Q43A 1S7NA 4NJQA 5FSXA 4ETKA 5G20A 2J8MA 2QYVA 3JZTA 2WPXA 3D7FA 3PGPA 5LRKA 2DPTA 1XMBA 4FBEA 5DUSA 1ZG7A 4NXYA 4Q7AA 4JD6A 4TWEA 4F8ZA 1LRZA 2FCKA 4RN7A 1VHEA 1EE3P 2ZEHA 1F2OA 3S9MA 1HEEA 1CJWA 1F57A 1X12A 1PCAA 1GHEA 1WK4A 2GE3A 4KYBA 3TOBA 5AILA 4U9ZA 3IU1A 5LRGA 4GS4A 3KQZA 3SIGA 2FXFA 5ISVA 2V8VA 4NEXA 1XFOA 4JGKA 3GQEA 4P6YA 4UCMA 2O4HA 1SPVA 2WSAA 2ATRA 3B3VA 2AJ6A 4M85A 3SJEA 4A39A 1QSTA 1TKFA 3IFEA 4YWYA 1IOIA 1XJOA 1YGHA 3MN8A 1LAPA 1ZLIA 4AB7A 4C7HA 4NCZA 5G21A 2OOTA 4A37A 3TX8A 3FX6A 1PUAA 2ABZA 5JQ4A 4K3NA 1YW6A 1BAVA 3HUVA 1YX0A 2XD7A 3SIIA 4UCNA 3S6FA 3S6GA 4AVCA 3PB8X 2Q0YA 3PB6X 4UIBA 4C2ZA 4P4FA 2XEGA 2ZW5A 4OC3A 2JZDA 2DEAA 5A28A 4RUHA 2B3VA 2Q4VA 4C7IA 3CXSA 4YGOA 4OIWA 1VIXA 2PCUA 4A95A 4J4ZA 2AFMA 2Y0MA 1S3ZA
chains in the Genus database with same CATH topology
4ZI6A 2PJ7A 2JBJA 2JEWA 5HOLA 2BCOA 3I1UA 3PFEA 3VATA 5I4MA 3KGQA 5HVHA 1YD9A 4FUUA 2CF4A 3D4UA 3EW5A 3BXMA 4R6TA 4X3RA 1Z2LA 2FVGA 3B35A 2DX6A 1BPMA 2ZEOA 1ZR3A 3SJXA 3ISZA 4O23A 2AFXA 5HVGA 3FMCA 2BFQA 3CDXA 3BHXA 3IIBA 4ABKA 4PXEA 4IQYA 1JQGA 1IY7A 3RBUA 1CP7A 4MCPA 4MHNA 3RZAA 3IO1A 2ZEMA 2PJ4A 1AMPA 4UEFA 4A94A 4NGSA 2HB6A 1TXRA 4ZY1A 4P4BA 5LYDA 5K8MA 4NGMA 2PIYA 4GVVA 2GREA 3IWWA 2IMOA 1VGYA 4Z65A 3Q6ZA 3PB7X 2Q51A 2BOAA 3D7HA 1TY8A 3B3WA 3FH4A 3QNVA 2ACFA 4IK2A 3SI1A 3CPAA 1BLLE 1NJRA 1ARMA 4MXUA 2PJ5A 5THWA 3B3TA 3IEHA 2LGRA 1R3NA 4OC5A 1TKHA 5CB5A 4MRIA 4A38A 4MCSA 2F8HA 4P4EA 5HVFA 2FG1A 4P45A 4BD9A 3SI2A 3D67A 1ZG8A 1FT7A 1CG2A 3B3CA 1F2PA 5FSZA 1IGBA 1LFWA 4FAIA 2O53A 4NGPA 3SJGA 3CPXA 3D68A 5HIHA 3L2NA 3LWUA 3IIFA 4X2TA 4R7MA 1QMUA 5DS0A 4ABLA 1TF8A 3FECA 4IHMA 2IQ6A 2PJ0A 1Q7LA 1ELMP 3EWRA 4GUAA 4P4DA 5J1QA 2EK8A 4JYWA 3KZWA 2C6CA 3PB4X 2G9DA 3V45A 3HLPA 4NGRA 4P10A 2QJ8A 3NH4A 1YSJA 4WWVA 1TF9A 4MHZA 4X8IA 5E3BA 2EK9A 1UWYA 5JM6A 4WJBA 3DGVA 3IJ3A 1HJZA 5LRJA 1OBRA 3K9TA 3PB9X 2PJ1A 3DLJA 4CPAA 1ARLA 3WC6A 2POKA 2VRIA 4ONWA 4KSIA 4OKOA 3VFQA 4IAVA 4JVVA 3BI0A 3FVLA 3D7GA 3EJFA 4K0CA 3H8FA 2PJBA 4JZ0A 4FWUA 1XRYA 4PQAA 4JLLA 2V8DA 3NH5A 1ZLHA 2XEFA 3PEIA 2ANPA 3FF3A 4EMEA 3CT9A 2CTCA 2GLFA 2PJ9A 2ZEGA 3NFZA 1YW4A 1PYTB 2F7VA 4OC1A 1NSAA 1VHOA 2PJ8A 2RB7A 4ZX8A 4OMEA 5FSUA 2ZOFA 5CB3A 2V8GA 3B7IA 4OIDA 3VH9A 4J5SA 4NJRA 3GQOA 2CIJA 2GU2A 2EWBA 2PVWA 2OR4A 2PJCA 1H8LA 2WYRA 2BO9A 2IJZA 1LCPA 3LMSA 3EWQA 3KASA 2ZEPA 5JH9A 2J9AA 1HDQA 4UEEA 1HDUA 4B6ZA 7CPAA 3VARA 4MCRA 3PBBA 3RAMA 1Y7EA 4MCQA 4ZY0A 3V7ZA 2FXKA 2AFZA 2VL1A 1Y0YA 3ISXA 4F9VA 3WC7A 3FEDA 2C6PA 4J5QA 1TXZA 5CMSA 1R43A 5HXDA 4MMOA 3WT4A 8CPAA 3PRTA 4ZY2A 1DTDA 3BI1A 3GPOA 5LYFA 2PE3A 1M4LA 2XEIA 4P4IA 4OC2A 4MHPA 3SIHA 2XEJA 4UMLA 3SI0A 3EWPA 2I3CA 1Z5RA 1KWMA 4NGTA 4EWTA 2BFRA 4ZYQA 3D66A 4ETJA 2PJ3A 4GVWA 4DUKA 4PXCA 5JGFA 3ETIA 3WABA 1TKJA 3D7DA 4AXVA 1CPSA 3EWOA 5K8PA 4MHYA 3H8EA 1Y0RA 4GM5A 2NYQA 1RTQA 4ESSA 2V8HA 3FJUA 3KR5A 2ZEEA 4OC4A 2GLJA 4DYOA 2L8RA 2CTBA 4TU0A 4J5RA 5ELYA 2RFHA 5LYLA 5K8OA 5D8NA 1ZG9A 3SJFA 6CPAA 3K2KA 3B2YA 4G1PA 4OP4A 3KR4A 2PVVA 3NH8A 5LYIA 1XBUA 3B3SA 4YU9A 3TC8A 5IB9A 5CPAA 1Z8LA 4UEZA 2X47A 3EKEA 2ZELA 3NA6A 4R76A 1VHUA 2C1CA 4UF4A 3T8WA 1ZR5A 2FAVA 2C6GA 2PRQA 3V2BA 2PJ6A 4OC0A 2AFCA 3JRUA 4DJLA 2AFUA 3IIDA 3H8GA 3EJGA 1YMEA 1FNOA 3S9NA 1YLOA 3PBEA 3PFOA 3SIJA 5F09A 1GYTA 5D29A 2ZENA 3KHZA 3FEEA 1CBXA 3Q71A 2ZOGA 4EFDA 4W9YA 2ZEDA 4R8FA 3MRUA 4PXDA 2PJ2A 2ZEFA 4NGNA 5FSVA 1BPNA 4LQGA 3KQXA 4D86A 4NGQA 2NSMA 3N5FA 2V77A 4P44A 2WZNA 4PXBA 3GPQA 1CP6A 1ELLP 2JBKA 4UIAA 3GUXA 4PPZA 2EEEA 3GLJA 5FSYA 2HC9A 3KHXA 3GPGA 2PIZA 3WC5A 3KL9A 3V38A 3IC1A 4P4JA 2PJAA 1AYEA 4JCAA 1QQ9A 2AFOA 5CBMA 4NFRA 3GB0A 1CX8A 3S9LA 4F9UA 2AFWA 1LAMA 1DE4C 4ZX9A 5K8NA 2AFSA 3KI9A 4H2KA 1CPXA 2QVPA 1LOKA 2Q4ZA 4TNUA 1LANA 2Q43A 4NJQA 5FSXA 4ETKA 2QYVA 3JZTA 3D7FA 5LRKA 1XMBA 4FBEA 5DUSA 1ZG7A 4Q7AA 4TWEA 4F8ZA 1VHEA 1EE3P 2ZEHA 1F2OA 3S9MA 1HEEA 1F57A 1PCAA 4KYBA 5AILA 5LRGA 3KQZA 3SIGA 2V8VA 4P6YA 1XFOA 4JGKA 3GQEA 2O4HA 1SPVA 3B3VA 3SJEA 4A39A 1TKFA 3IFEA 4YWYA 1XJOA 3MN8A 1LAPA 1ZLIA 2OOTA 4A37A 3TX8A 3FX6A 2ABZA 4K3NA 1YW6A 1BAVA 3HUVA 2XD7A 3SIIA 3PB8X 3PB6X 4UIBA 4P4FA 2XEGA 4OC3A 2DEAA 4RUHA 4OIWA 1VIXA 2PCUA 4J4ZA 2AFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI6 A;  2PJ7 A;  2JBJ A;  2JEW A;  5HOL A;  2BCO A;  3I1U A;  3PFE A;  3VAT A;  5I4M A;  3KGQ A;  5HVH A;  1YD9 A;  4FUU A;  2CF4 A;  3D4U A;  3EW5 A;  3BXM A;  4R6T A;  4X3R A;  1Z2L A;  2FVG A;  3B35 A;  2DX6 A;  1BPM A;  2ZEO A;  1ZR3 A;  3SJX A;  3ISZ A;  4O23 A;  2AFX A;  5HVG A;  3FMC A;  2BFQ A;  3CDX A;  3BHX A;  3IIB A;  4ABK A;  4PXE A;  4IQY A;  1JQG A;  1IY7 A;  3RBU A;  1CP7 A;  4MCP A;  4MHN A;  3RZA A;  3IO1 A;  2ZEM A;  2PJ4 A;  1AMP A;  4UEF A;  4A94 A;  4NGS A;  2HB6 A;  1TXR A;  4ZY1 A;  4P4B A;  5LYD A;  5K8M A;  4NGM A;  2PIY A;  4GVV A;  2GRE A;  3IWW A;  2IMO A;  1VGY A;  4Z65 A;  3Q6Z A;  3PB7 X;  2Q51 A;  2BOA A;  3D7H A;  1TY8 A;  3B3W A;  3FH4 A;  3QNV A;  2ACF A;  4IK2 A;  3SI1 A;  3CPA A;  1BLL E;  1NJR A;  1ARM A;  4MXU A;  2PJ5 A;  5THW A;  3B3T A;  3IEH A;  2LGR A;  1R3N A;  4OC5 A;  1TKH A;  5CB5 A;  4MRI A;  4A38 A;  4MCS A;  2F8H A;  4P4E A;  5HVF A;  2FG1 A;  4P45 A;  4BD9 A;  3SI2 A;  3D67 A;  1ZG8 A;  1FT7 A;  1CG2 A;  3B3C A;  1F2P A;  5FSZ A;  1IGB A;  1LFW A;  4FAI A;  2O53 A;  4NGP A;  3SJG A;  3CPX A;  3D68 A;  5HIH A;  3L2N A;  3LWU A;  3IIF A;  4X2T A;  4R7M A;  1QMU A;  5DS0 A;  4ABL A;  1TF8 A;  3FEC A;  4IHM A;  2IQ6 A;  2PJ0 A;  1Q7L A;  1ELM P;  3EWR A;  4GUA A;  4P4D A;  5J1Q A;  2EK8 A;  4JYW A;  3KZW A;  2C6C A;  3PB4 X;  2G9D A;  3V45 A;  3HLP A;  4NGR A;  4P10 A;  2QJ8 A;  3NH4 A;  1YSJ A;  4WWV A;  1TF9 A;  4MHZ A;  4X8I A;  5E3B A;  2EK9 A;  1UWY A;  5JM6 A;  4WJB A;  3DGV A;  3IJ3 A;  1HJZ A;  5LRJ A;  1OBR A;  3K9T A;  3PB9 X;  2PJ1 A;  3DLJ A;  4CPA A;  1ARL A;  3WC6 A;  2POK A;  2VRI A;  4ONW A;  4KSI A;  4OKO A;  3VFQ A;  4IAV A;  4JVV A;  3BI0 A;  3FVL A;  3D7G A;  3EJF A;  4K0C A;  3H8F A;  2PJB A;  4JZ0 A;  4FWU A;  1XRY A;  4PQA A;  4JLL A;  2V8D A;  3NH5 A;  1ZLH A;  2XEF A;  3PEI A;  2ANP A;  3FF3 A;  4EME A;  3CT9 A;  2CTC A;  2GLF A;  2PJ9 A;  2ZEG A;  3NFZ A;  1YW4 A;  1PYT B;  2F7V A;  4OC1 A;  1NSA A;  1VHO A;  2PJ8 A;  2RB7 A;  4ZX8 A;  4OME A;  5FSU A;  2ZOF A;  5CB3 A;  2V8G A;  3B7I A;  4OID A;  3VH9 A;  4J5S A;  4NJR A;  3GQO A;  2CIJ A;  2GU2 A;  2EWB A;  2PVW A;  2OR4 A;  2PJC A;  1H8L A;  2WYR A;  2BO9 A;  2IJZ A;  1LCP A;  3LMS A;  3EWQ A;  3KAS A;  2ZEP A;  5JH9 A;  2J9A A;  1HDQ A;  4UEE A;  1HDU A;  4B6Z A;  7CPA A;  3VAR A;  4MCR A;  3PBB A;  3RAM A;  1Y7E A;  4MCQ A;  4ZY0 A;  3V7Z A;  2FXK A;  2AFZ A;  2VL1 A;  1Y0Y A;  3ISX A;  4F9V A;  3WC7 A;  3FED A;  2C6P A;  4J5Q A;  1TXZ A;  5CMS A;  1R43 A;  5HXD A;  4MMO A;  3WT4 A;  8CPA A;  3PRT A;  4ZY2 A;  1DTD A;  3BI1 A;  3GPO A;  5LYF A;  2PE3 A;  1M4L A;  2XEI A;  4P4I A;  4OC2 A;  4MHP A;  3SIH A;  2XEJ A;  4UML A;  3SI0 A;  3EWP A;  2I3C A;  1Z5R A;  1KWM A;  4NGT A;  4EWT A;  2BFR A;  4ZYQ A;  3D66 A;  4ETJ A;  2PJ3 A;  4GVW A;  4DUK A;  4PXC A;  5JGF A;  3ETI A;  3WAB A;  1TKJ A;  3D7D A;  4AXV A;  1CPS A;  3EWO A;  5K8P A;  4MHY A;  3H8E A;  1Y0R A;  4GM5 A;  2NYQ A;  1RTQ A;  4ESS A;  2V8H A;  3FJU A;  3KR5 A;  2ZEE A;  4OC4 A;  2GLJ A;  4DYO A;  2L8R A;  2CTB A;  4TU0 A;  4J5R A;  5ELY A;  2RFH A;  5LYL A;  5K8O A;  5D8N A;  1ZG9 A;  3SJF A;  6CPA A;  3K2K A;  3B2Y A;  4G1P A;  4OP4 A;  3KR4 A;  2PVV A;  3NH8 A;  5LYI A;  1XBU A;  3B3S A;  4YU9 A;  3TC8 A;  5IB9 A;  5CPA A;  1Z8L A;  4UEZ A;  2X47 A;  3EKE A;  2ZEL A;  3NA6 A;  4R76 A;  1VHU A;  2C1C A;  4UF4 A;  3T8W A;  1ZR5 A;  2FAV A;  2C6G A;  2PRQ A;  3V2B A;  2PJ6 A;  4OC0 A;  2AFC A;  3JRU A;  4DJL A;  2AFU A;  3IID A;  3H8G A;  3EJG A;  1YME A;  1FNO A;  3S9N A;  1YLO A;  3PBE A;  3PFO A;  3SIJ A;  5F09 A;  1GYT A;  5D29 A;  2ZEN A;  3KHZ A;  3FEE A;  1CBX A;  3Q71 A;  2ZOG A;  4EFD A;  4W9Y A;  2ZED A;  4R8F A;  3MRU A;  4PXD A;  2PJ2 A;  2ZEF A;  4NGN A;  5FSV A;  1BPN A;  4LQG A;  3KQX A;  4D86 A;  4NGQ A;  2NSM A;  3N5F A;  2V77 A;  4P44 A;  2WZN A;  4PXB A;  3GPQ A;  1CP6 A;  1ELL P;  2JBK A;  4UIA A;  3GUX A;  4PPZ A;  2EEE A;  3GLJ A;  5FSY A;  2HC9 A;  3KHX A;  3GPG A;  2PIZ A;  3WC5 A;  3KL9 A;  3V38 A;  3IC1 A;  4P4J A;  2PJA A;  1AYE A;  4JCA A;  1QQ9 A;  2AFO A;  5CBM A;  4NFR A;  3GB0 A;  1CX8 A;  3S9L A;  4F9U A;  2AFW A;  1LAM A;  1DE4 C;  4ZX9 A;  5K8N A;  2AFS A;  3KI9 A;  4H2K A;  1CPX A;  2QVP A;  1LOK A;  2Q4Z A;  4TNU A;  1LAN A;  2Q43 A;  4NJQ A;  5FSX A;  4ETK A;  2QYV A;  3JZT A;  3D7F A;  5LRK A;  1XMB A;  4FBE A;  5DUS A;  1ZG7 A;  4Q7A A;  4TWE A;  4F8Z A;  1VHE A;  1EE3 P;  2ZEH A;  1F2O A;  3S9M A;  1HEE A;  1F57 A;  1PCA A;  4KYB A;  5AIL A;  5LRG A;  3KQZ A;  3SIG A;  2V8V A;  4P6Y A;  1XFO A;  4JGK A;  3GQE A;  2O4H A;  1SPV A;  3B3V A;  3SJE A;  4A39 A;  1TKF A;  3IFE A;  4YWY A;  1XJO A;  3MN8 A;  1LAP A;  1ZLI A;  2OOT A;  4A37 A;  3TX8 A;  3FX6 A;  2ABZ A;  4K3N A;  1YW6 A;  1BAV A;  3HUV A;  2XD7 A;  3SII A;  3PB8 X;  3PB6 X;  4UIB A;  4P4F A;  2XEG A;  4OC3 A;  2DEA A;  4RUH A;  4OIW A;  1VIX A;  2PCU A;  4J4Z A;  2AFM A; 
#chains in the Genus database with same CATH topology
 4ZI6 A;  2YGW A;  3RNZ A;  2PJ7 A;  2Z3M A;  3F0A A;  2JBJ A;  4BMH A;  2JEW A;  2I00 A;  5HOL A;  2BCO A;  2B4B A;  3I1U A;  1S7L A;  1Y9W A;  2DF5 A;  3PFE A;  3VAT A;  4B11 A;  5I4M A;  3KGQ A;  4B5O A;  4H6U A;  3B8G A;  5HVH A;  1YD9 A;  4FUU A;  4I49 A;  2CNS A;  2CF4 A;  3D4U A;  3EW5 A;  3BXM A;  2JLM A;  4R6T A;  4XPL A;  4YFJ A;  4X3R A;  3FIX A;  1Z2L A;  5GCN A;  2FVG A;  5AG5 A;  1KUY A;  3B35 A;  2ZW6 A;  5EC4 A;  4XNH C;  2P6E A;  1Z9U A;  2DX6 A;  1BPM A;  3VWE A;  2ZEO A;  1ZR3 A;  3SJX A;  4KVX A;  3ISZ A;  4O23 A;  2AFX A;  5HVG A;  3FMC A;  2BFQ A;  3CDX A;  2JZE A;  1YQE A;  4QC6 A;  3BHX A;  2FL4 A;  3IIB A;  4PSW A;  4B5P A;  4ABK A;  4PXE A;  2FT0 A;  2Z3N A;  4IQY A;  4CYN A;  2HQY A;  1R57 A;  1JQG A;  1KUX A;  1QSO A;  4NF1 A;  4E8O A;  4II9 A;  2FIW A;  1IY7 A;  3RBU A;  4UFX A;  3TFY A;  3EFA A;  1CP7 A;  4A30 A;  4CGP A;  3PZJ A;  1RXT A;  4MHN A;  4MCP A;  1TIQ A;  3D2P A;  1M4D A;  4X5K A;  3RZA A;  4CRZ B;  4M6H A;  3A9L A;  3IO1 A;  5DWM A;  2JEV A;  3WR7 A;  1K4J A;  2ZEM A;  2PJ4 A;  1KUV A;  1M4I A;  1AMP A;  4UEF A;  2WUU A;  4A32 A;  4A94 A;  1S7F A;  4NGS A;  2HB6 A;  4FD5 A;  2REF A;  1YVK A;  2IL4 A;  1TXR A;  4ZY1 A;  4U9Y A;  4K30 A;  1Z8X A;  5C82 A;  3GIU A;  4P4B A;  2P0W A;  2R7H A;  5LYD A;  2DXQ A;  4HNY B;  2A4N A;  4NGM A;  2EBJ A;  2WCT A;  2PIY A;  5K8M A;  3EC4 A;  4GVV A;  4OAE A;  2GRE A;  4KVO E;  3IWW A;  1V0C A;  2IMO A;  3V8I A;  1VGY A;  1IYL A;  4Z65 A;  2B3U A;  3Q6Z A;  2EVN A;  2OB0 A;  3PB7 X;  2Q51 A;  2BOA A;  4DNC A;  3D7H A;  2GIV A;  4J3G A;  2JDD A;  1TY8 A;  2PR8 A;  4UBR A;  3B3W A;  2QEC A;  2ZXV A;  3FH4 A;  3C26 A;  2ACF A;  3QNV A;  3R96 A;  4IK2 A;  3SI1 A;  5AG7 A;  3CPA A;  4HKF A;  1BLL E;  1NJR A;  1ARM A;  1CM0 A;  2B5G B;  2GAN A;  2PJ5 A;  3E0K A;  4MXU A;  2REE A;  2KQV A;  5THW A;  3BJ8 A;  1Z4E A;  2P6F A;  4AVA A;  2G0B A;  2HUZ A;  4M6G A;  4MFL A;  1UFH A;  1PU9 A;  3B3T A;  3IEH A;  1U6M A;  3P2H A;  4UFW A;  5H84 A;  2LGR A;  1R3N A;  4OC5 A;  1WWZ A;  2I79 A;  4CGM A;  1YK3 A;  4FD6 A;  1M1D A;  2C27 A;  4MFJ A;  1TKH A;  5CB5 A;  4HPS A;  2H5M A;  4MRI A;  4MCS A;  4QB9 A;  3T90 A;  2F8H A;  4UWI A;  4A38 A;  1NMT A;  4P4E A;  1RO5 A;  5HVF A;  3PP9 A;  1IIC A;  2FG1 A;  3R9G A;  2VXK A;  5BWA B;  3S6K A;  1Q2Y A;  1IOF A;  1MJA A;  1XF8 A;  4P45 A;  1Q2C A;  4BD9 A;  3SI2 A;  1B87 A;  3IWG A;  3D67 A;  1ZG8 A;  1FT7 A;  4U5Y A;  1CG2 A;  3B3C A;  1F2P A;  4CYP A;  5FSZ A;  2PDO A;  4CAX A;  5IV0 A;  4MJ8 A;  2Q04 A;  1SQH A;  3IWE A;  4KOT A;  1IGB A;  5F48 A;  1LFW A;  2Z0Z A;  4FAI A;  2O53 A;  4NGP A;  3SJG A;  4AG7 A;  3CPX A;  4PSX A;  2OZU A;  3D68 A;  4JJX A;  5HIH A;  3L2N A;  3LWU A;  3IIF A;  1IU8 A;  4X2T A;  4R7M A;  1IYK A;  2VQY A;  3LOD A;  1QMU A;  1XIX A;  5DS0 A;  1YLE A;  3ZJ0 A;  4ABL A;  1JWQ A;  1TF8 A;  2PC1 A;  4BIN A;  3FEC A;  1Z8W A;  4ORF A;  3RYO A;  4IHM A;  4C2X A;  2IQ6 A;  2Z3L A;  3W6S A;  2G3A A;  4IF5 A;  2PJ0 A;  1Q7L A;  2B4D B;  4JXR A;  1ELM P;  2B4D A;  3FBU A;  4QVT A;  3EWR A;  4GUA A;  4P4D A;  5J1Q A;  4KOW A;  2EK8 A;  1Z8T A;  4JYW A;  3KZW A;  2C6C A;  4M6I A;  4A31 A;  1QSR A;  3PB4 X;  1S7K A;  2G9D A;  4CAW A;  3V45 A;  2VBQ A;  3HLP A;  3EXN A;  4KLV A;  4NGR A;  2AE6 A;  2BL1 A;  4P10 A;  4PK3 A;  4AVB A;  4B12 A;  4MY3 A;  2QJ8 A;  3NH4 A;  2CY2 A;  5G22 A;  1YSJ A;  4WWV A;  1TF9 A;  4MHZ A;  1P4N A;  4X8I A;  5E3B A;  3KKW A;  4KS9 A;  4XPD B;  2EK9 A;  4CAV A;  2BUE A;  1UWY A;  2ZPA A;  3EO4 A;  4IUS A;  5AGE A;  4KOV A;  2BSW A;  5JM6 A;  2ODF A;  4WJB A;  1Y9K A;  2Z3O A;  3DGV A;  3IJ3 A;  4C2Y A;  1HJZ A;  2PRB A;  3GKR A;  4R3L A;  2B58 A;  5F49 A;  3QAY A;  5LRJ A;  1OBR A;  5C88 A;  2P6G A;  3K9T A;  3PB9 X;  4HNX B;  3TTH A;  2PJ1 A;  3DLJ A;  2FSR A;  2PQ8 A;  2OH1 A;  4ZGY B;  2PSW A;  4CPA A;  1ARL A;  4OLL A;  3BJ7 A;  3WC6 A;  2POK A;  2VRI A;  1YRE A;  4KSI A;  2ARH A;  4OKO A;  4ONW A;  4R87 A;  3H4Q A;  4Y49 B;  3VFQ A;  3FNC A;  4IAV A;  4JVV A;  3BI0 A;  3FVL A;  3D7G A;  2FIA A;  3EJF A;  3D2M A;  4K0C A;  2Z11 A;  4GXH A;  3H8F A;  3D8P A;  2PJB A;  4JZ0 A;  4FWU A;  1XRY A;  3MGD A;  4PQA A;  4CS0 B;  1A2Z A;  4JLL A;  2V8D A;  3NH5 A;  5AG4 A;  1S5K A;  4EVY A;  1ZLH A;  2XEF A;  3PEI A;  2ANP A;  3FF3 A;  1N71 A;  4EME A;  3CT9 A;  2CTC A;  4LQ6 A;  5F46 A;  2GLF A;  2PJ9 A;  2ZEG A;  3NFZ A;  1YW4 A;  2RC4 A;  2FE7 A;  4QBJ A;  4BBH A;  1PYT B;  1XE4 A;  1QSN A;  2F7V A;  4R57 A;  4OC1 A;  3VWD A;  1NSA A;  1VHO A;  2PJ8 A;  5DWN A;  2RB7 A;  4ZX8 A;  3IGR A;  4OME A;  2Z3K A;  5FSU A;  2ZOF A;  5CB3 A;  2WPW A;  4QUS A;  3FYN A;  1NSL A;  4L8A A;  2V8G A;  3B7I A;  2R8V A;  4OID A;  2K5T A;  3VH9 A;  3DR6 A;  2Z10 A;  4H6Z A;  4J5S A;  4UFV A;  3F8K A;  4NJR A;  4MY0 A;  4PV6 A;  2OU2 A;  3GQO A;  2CIJ A;  3TCV A;  2VZY A;  2GU2 A;  2EWB A;  2PVW A;  4CAF A;  2OR4 A;  4MFZ A;  2CXA A;  2PJC A;  3DDD A;  1H8L A;  2BO9 A;  2PR1 A;  2O28 A;  2WYR A;  4CGL A;  2IJZ A;  1LCP A;  3LMS A;  4KZT A;  4XNH B;  4F0Y A;  3EWQ A;  2B5G A;  3KAS A;  2ZEP A;  3TO9 A;  4KOS A;  3H5Z A;  5JH9 A;  2J9A A;  3DNS A;  1HDQ A;  4UEE A;  1HDU A;  4B6Z A;  4E0A A;  7CPA A;  3VAR A;  4MCR A;  4UA3 A;  3JVN A;  4RS2 A;  5J8C A;  3PBB A;  2Q7B A;  3RAM A;  3G8W A;  1Y7E A;  4MCQ A;  4C68 A;  4ZY0 A;  1P0H A;  4KVM E;  3V7Z A;  2FXK A;  4R3K A;  1XMT A;  2AFZ A;  4JWP A;  5F47 A;  2VL1 A;  1Y0Y A;  1I12 A;  3QB8 A;  3ISX A;  2R98 A;  4F9V A;  3WC7 A;  1VHS A;  2X7B A;  3EY5 A;  3FED A;  2OZG A;  4CYO A;  3CXQ A;  2BEI A;  3K9U A;  2C6P A;  4J5Q A;  1TXZ A;  5CMS A;  1R43 A;  4XPD C;  5HXD A;  3BLN A;  4MMO A;  3WT4 A;  3DSB A;  3PRT A;  4Q38 A;  8CPA A;  4ZY2 A;  3P2F A;  1DTD A;  5IX3 A;  3BI1 A;  3GPO A;  1MJ9 A;  2D4P A;  5LYF A;  2PE3 A;  1M4L A;  2XEI A;  4KSF A;  4P4I A;  1AUG A;  1IB1 E;  4OC2 A;  3I9S A;  4MHP A;  3SIH A;  5KTC A;  2XEJ A;  5HH1 A;  4UML A;  3SI0 A;  3EWP A;  5I0C A;  1XOV A;  2YNE A;  2I3C A;  1Z5R A;  1KWM A;  2Q44 A;  4NGT A;  4L89 A;  4EWT A;  2YNC A;  2BFR A;  4ZYQ A;  2OZH A;  4JXQ A;  4Y49 C;  3D66 A;  2CNT A;  4ETJ A;  2PJ3 A;  4GVW A;  4KUA A;  2J8N A;  1BO4 A;  4R9M A;  1Z4R A;  5FVJ A;  4DUK A;  2EUI A;  4PXC A;  5JGF A;  3ETI A;  4YRH A;  3WAB A;  1TKJ A;  3D7D A;  5J8F A;  1MK4 A;  4AXV A;  1CPS A;  3EWO A;  3N7Z A;  5IB0 A;  5K8P A;  4MHY A;  2Q4Y A;  3LAC A;  5AG6 A;  3H8E A;  3W6X A;  1Y0R A;  2EO8 A;  2R1I A;  4GM5 A;  4OAD A;  2JZF A;  5KTA A;  2NYQ A;  4FD7 A;  4H89 A;  5EMI A;  4LX9 A;  1RTQ A;  4ZBG A;  4ESS A;  2V8H A;  3FJU A;  3KR5 A;  2ZEE A;  4CYQ A;  2RNK A;  4OC4 A;  2W2G A;  2GLJ A;  4KOU A;  3SHP A;  4DYO A;  3NE8 A;  2L8R A;  2CTB A;  4TU0 A;  4J5R A;  5ELY A;  2RFH A;  2NMT A;  3ZZI A;  5HMN A;  3CZX A;  4B13 A;  5K8O A;  5LYL A;  1Y7R A;  3R1K A;  3W91 A;  4CRY B;  1ZG9 A;  5D8N A;  4JLY A;  3SJF A;  4FD4 A;  2VEZ A;  5CNP A;  3SXN A;  6CPA A;  3IU2 A;  3K2K A;  3B2Y A;  2Z3P A;  2GFQ A;  4G1P A;  4OP4 A;  4MFQ A;  3KR4 A;  3GY9 A;  3QAH A;  3GYA A;  5H86 A;  1KZF A;  2PVV A;  2VI7 A;  3NH8 A;  5LYI A;  1XBU A;  2QIR A;  3B3S A;  3LD2 A;  4YU9 A;  1B6B A;  1ZO0 A;  1YVO A;  3TC8 A;  5IB9 A;  4KOY A;  5CPA A;  3I3G A;  2Q7S A;  3R9F A;  3CXP A;  1Z8L A;  4UEZ A;  2X47 A;  3OWC A;  4AG9 A;  3EKE A;  1M4G A;  3NE7 A;  2ZEL A;  4KOR A;  1J4J A;  1X10 A;  3NA6 A;  4R76 A;  1VHU A;  1NE9 A;  2C1C A;  4MFK A;  4UF4 A;  4CGO A;  3T8W A;  2YND A;  1ZR5 A;  2FAV A;  2C6G A;  4A33 A;  2PRQ A;  3V2B A;  3TOA A;  2PJ6 A;  3TE4 A;  5E96 A;  4OC0 A;  2AFC A;  4B5P B;  3JRU A;  4DJL A;  2AFU A;  3IID A;  3H8G A;  3EJG A;  1YME A;  1FNO A;  4XPK A;  4MHD A;  3S9N A;  1YLO A;  4UWJ A;  3PBE A;  3PFO A;  1BOB A;  2HV2 A;  3TO6 A;  1OZP A;  3T9Y A;  4HNW B;  4F0X A;  3SIJ A;  5F09 A;  2VZZ A;  1GYT A;  5D29 A;  2ZEN A;  3KHZ A;  3FEE A;  1CBX A;  4UCP A;  4A2Z A;  3Q71 A;  2ZOG A;  4EFD A;  1Q2D A;  4W9Y A;  2ZED A;  4R8F A;  4RI1 A;  5G1Z A;  2J8R A;  3JTK A;  3MRU A;  3RO0 A;  4PXD A;  2PJ2 A;  1XEB A;  2ZEF A;  3DR8 A;  4NGN A;  3R95 A;  5KTD A;  5FSV A;  2ZW7 A;  1BPN A;  4LUA A;  4LQG A;  4F6A A;  3KQX A;  1ON0 A;  3FRM A;  2QML A;  4D86 A;  4NGQ A;  2NSM A;  3N5F A;  2V77 A;  4MBU A;  2WZN A;  4P44 A;  4PXB A;  3GPQ A;  1CP6 A;  1I21 A;  4MI4 A;  4NSQ A;  1FY7 A;  2F5I A;  1VKC A;  1ELL P;  2JBK A;  2FS5 A;  4PK2 A;  4E2A A;  5A27 A;  5JPH A;  4UIA A;  3GUX A;  4PPZ A;  2EEE A;  3TO7 A;  3GLJ A;  5FSY A;  2HC9 A;  3KHX A;  3GPG A;  2G3T A;  2PIZ A;  3WC5 A;  1L0C A;  3KL9 A;  3V38 A;  2YNC C;  3IC1 A;  4P4J A;  4B14 A;  2PJA A;  1AYE A;  4M3S A;  3R9E A;  4JCA A;  1QQ9 A;  1YR0 A;  2AFO A;  3F5B A;  5CBM A;  2KCW A;  4KSA A;  2D4O A;  2DPS A;  3FXT A;  4NFR A;  2JDC A;  2ZW4 A;  3GB0 A;  4KOX A;  1IID A;  3UY5 A;  4CGN A;  1M44 A;  1QSM A;  1S60 A;  1CX8 A;  5EBV A;  4B10 A;  3S9L A;  4F9U A;  4MFP A;  2AFW A;  4Q36 A;  1LAM A;  3FB3 A;  1DE4 C;  3JUW A;  4ZX9 A;  4KLW A;  3TT2 A;  1MJB A;  4KUB A;  4CAE A;  2AFS A;  3KI9 A;  4ONU A;  5K8N A;  3D3S A;  4H2K A;  1I1D A;  3SXO A;  2CNM A;  1CPX A;  2QVP A;  3G3S A;  1LOK A;  2Q4Z A;  4TNU A;  3S6H A;  1LAN A;  2Q43 A;  1S7N A;  4NJQ A;  5FSX A;  4ETK A;  5G20 A;  2J8M A;  2QYV A;  3JZT A;  2WPX A;  3D7F A;  3PGP A;  5LRK A;  2DPT A;  1XMB A;  4FBE A;  5DUS A;  1ZG7 A;  4NXY A;  4Q7A A;  4JD6 A;  4TWE A;  4F8Z A;  1LRZ A;  2FCK A;  4RN7 A;  1VHE A;  1EE3 P;  2ZEH A;  1F2O A;  3S9M A;  1HEE A;  1CJW A;  1F57 A;  1X12 A;  1PCA A;  1GHE A;  1WK4 A;  2GE3 A;  4KYB A;  3TOB A;  5AIL A;  4U9Z A;  3IU1 A;  5LRG A;  4GS4 A;  3KQZ A;  3SIG A;  2FXF A;  5ISV A;  2V8V A;  4NEX A;  1XFO A;  4JGK A;  3GQE A;  4P6Y A;  4UCM A;  2O4H A;  1SPV A;  2WSA A;  2ATR A;  3B3V A;  2AJ6 A;  4M85 A;  3SJE A;  4A39 A;  1QST A;  1TKF A;  3IFE A;  4YWY A;  1IOI A;  1XJO A;  1YGH A;  3MN8 A;  1LAP A;  1ZLI A;  4AB7 A;  4C7H A;  4NCZ A;  5G21 A;  2OOT A;  4A37 A;  3TX8 A;  3FX6 A;  1PUA A;  2ABZ A;  5JQ4 A;  4K3N A;  1YW6 A;  1BAV A;  3HUV A;  1YX0 A;  2XD7 A;  3SII A;  4UCN A;  3S6F A;  3S6G A;  4AVC A;  3PB8 X;  2Q0Y A;  3PB6 X;  4UIB A;  4C2Z A;  4P4F A;  2XEG A;  2ZW5 A;  4OC3 A;  2JZD A;  2DEA A;  5A28 A;  4RUH A;  2B3V A;  2Q4V A;  4C7I A;  3CXS A;  4YGO A;  4OIW A;  1VIX A;  2PCU A;  4A95 A;  4J4Z A;  2AFM A;  2Y0M A;  1S3Z A; 
#chains in the Genus database with same CATH homology
 4ZI6 A;  2PJ7 A;  2JBJ A;  2JEW A;  5HOL A;  2BCO A;  3I1U A;  3PFE A;  3VAT A;  5I4M A;  3KGQ A;  5HVH A;  1YD9 A;  4FUU A;  2CF4 A;  3D4U A;  3EW5 A;  3BXM A;  4R6T A;  4X3R A;  1Z2L A;  2FVG A;  3B35 A;  2DX6 A;  1BPM A;  2ZEO A;  1ZR3 A;  3SJX A;  3ISZ A;  4O23 A;  2AFX A;  5HVG A;  3FMC A;  2BFQ A;  3CDX A;  3BHX A;  3IIB A;  4ABK A;  4PXE A;  4IQY A;  1JQG A;  1IY7 A;  3RBU A;  1CP7 A;  4MCP A;  4MHN A;  3RZA A;  3IO1 A;  2ZEM A;  2PJ4 A;  1AMP A;  4UEF A;  4A94 A;  4NGS A;  2HB6 A;  1TXR A;  4ZY1 A;  4P4B A;  5LYD A;  5K8M A;  4NGM A;  2PIY A;  4GVV A;  2GRE A;  3IWW A;  2IMO A;  1VGY A;  4Z65 A;  3Q6Z A;  3PB7 X;  2Q51 A;  2BOA A;  3D7H A;  1TY8 A;  3B3W A;  3FH4 A;  3QNV A;  2ACF A;  4IK2 A;  3SI1 A;  3CPA A;  1BLL E;  1NJR A;  1ARM A;  4MXU A;  2PJ5 A;  5THW A;  3B3T A;  3IEH A;  2LGR A;  1R3N A;  4OC5 A;  1TKH A;  5CB5 A;  4MRI A;  4A38 A;  4MCS A;  2F8H A;  4P4E A;  5HVF A;  2FG1 A;  4P45 A;  4BD9 A;  3SI2 A;  3D67 A;  1ZG8 A;  1FT7 A;  1CG2 A;  3B3C A;  1F2P A;  5FSZ A;  1IGB A;  1LFW A;  4FAI A;  2O53 A;  4NGP A;  3SJG A;  3CPX A;  3D68 A;  5HIH A;  3L2N A;  3LWU A;  3IIF A;  4X2T A;  4R7M A;  1QMU A;  5DS0 A;  4ABL A;  1TF8 A;  3FEC A;  4IHM A;  2IQ6 A;  2PJ0 A;  1Q7L A;  1ELM P;  3EWR A;  4GUA A;  4P4D A;  5J1Q A;  2EK8 A;  4JYW A;  3KZW A;  2C6C A;  3PB4 X;  2G9D A;  3V45 A;  3HLP A;  4NGR A;  4P10 A;  2QJ8 A;  3NH4 A;  1YSJ A;  4WWV A;  1TF9 A;  4MHZ A;  4X8I A;  5E3B A;  2EK9 A;  1UWY A;  5JM6 A;  4WJB A;  3DGV A;  3IJ3 A;  1HJZ A;  5LRJ A;  1OBR A;  3K9T A;  3PB9 X;  2PJ1 A;  3DLJ A;  4CPA A;  1ARL A;  3WC6 A;  2POK A;  2VRI A;  4ONW A;  4KSI A;  4OKO A;  3VFQ A;  4IAV A;  4JVV A;  3BI0 A;  3FVL A;  3D7G A;  3EJF A;  4K0C A;  3H8F A;  2PJB A;  4JZ0 A;  4FWU A;  1XRY A;  4PQA A;  4JLL A;  2V8D A;  3NH5 A;  1ZLH A;  2XEF A;  3PEI A;  2ANP A;  3FF3 A;  4EME A;  3CT9 A;  2CTC A;  2GLF A;  2PJ9 A;  2ZEG A;  3NFZ A;  1YW4 A;  1PYT B;  2F7V A;  4OC1 A;  1NSA A;  1VHO A;  2PJ8 A;  2RB7 A;  4ZX8 A;  4OME A;  5FSU A;  2ZOF A;  5CB3 A;  2V8G A;  3B7I A;  4OID A;  3VH9 A;  4J5S A;  4NJR A;  3GQO A;  2CIJ A;  2GU2 A;  2EWB A;  2PVW A;  2OR4 A;  2PJC A;  1H8L A;  2WYR A;  2BO9 A;  2IJZ A;  1LCP A;  3LMS A;  3EWQ A;  3KAS A;  2ZEP A;  5JH9 A;  2J9A A;  1HDQ A;  4UEE A;  1HDU A;  4B6Z A;  7CPA A;  3VAR A;  4MCR A;  3PBB A;  3RAM A;  1Y7E A;  4MCQ A;  4ZY0 A;  3V7Z A;  2FXK A;  2AFZ A;  2VL1 A;  1Y0Y A;  3ISX A;  4F9V A;  3WC7 A;  3FED A;  2C6P A;  4J5Q A;  1TXZ A;  5CMS A;  1R43 A;  5HXD A;  4MMO A;  3WT4 A;  8CPA A;  3PRT A;  4ZY2 A;  1DTD A;  3BI1 A;  3GPO A;  5LYF A;  2PE3 A;  1M4L A;  2XEI A;  4P4I A;  4OC2 A;  4MHP A;  3SIH A;  2XEJ A;  4UML A;  3SI0 A;  3EWP A;  2I3C A;  1Z5R A;  1KWM A;  4NGT A;  4EWT A;  2BFR A;  4ZYQ A;  3D66 A;  4ETJ A;  2PJ3 A;  4GVW A;  4DUK A;  4PXC A;  5JGF A;  3ETI A;  3WAB A;  1TKJ A;  3D7D A;  4AXV A;  1CPS A;  3EWO A;  5K8P A;  4MHY A;  3H8E A;  1Y0R A;  4GM5 A;  2NYQ A;  1RTQ A;  4ESS A;  2V8H A;  3FJU A;  3KR5 A;  2ZEE A;  4OC4 A;  2GLJ A;  4DYO A;  2L8R A;  2CTB A;  4TU0 A;  4J5R A;  5ELY A;  2RFH A;  5LYL A;  5K8O A;  5D8N A;  1ZG9 A;  3SJF A;  6CPA A;  3K2K A;  3B2Y A;  4G1P A;  4OP4 A;  3KR4 A;  2PVV A;  3NH8 A;  5LYI A;  1XBU A;  3B3S A;  4YU9 A;  3TC8 A;  5IB9 A;  5CPA A;  1Z8L A;  4UEZ A;  2X47 A;  3EKE A;  2ZEL A;  3NA6 A;  4R76 A;  1VHU A;  2C1C A;  4UF4 A;  3T8W A;  1ZR5 A;  2FAV A;  2C6G A;  2PRQ A;  3V2B A;  2PJ6 A;  4OC0 A;  2AFC A;  3JRU A;  4DJL A;  2AFU A;  3IID A;  3H8G A;  3EJG A;  1YME A;  1FNO A;  3S9N A;  1YLO A;  3PBE A;  3PFO A;  3SIJ A;  5F09 A;  1GYT A;  5D29 A;  2ZEN A;  3KHZ A;  3FEE A;  1CBX A;  3Q71 A;  2ZOG A;  4EFD A;  4W9Y A;  2ZED A;  4R8F A;  3MRU A;  4PXD A;  2PJ2 A;  2ZEF A;  4NGN A;  5FSV A;  1BPN A;  4LQG A;  3KQX A;  4D86 A;  4NGQ A;  2NSM A;  3N5F A;  2V77 A;  4P44 A;  2WZN A;  4PXB A;  3GPQ A;  1CP6 A;  1ELL P;  2JBK A;  4UIA A;  3GUX A;  4PPZ A;  2EEE A;  3GLJ A;  5FSY A;  2HC9 A;  3KHX A;  3GPG A;  2PIZ A;  3WC5 A;  3KL9 A;  3V38 A;  3IC1 A;  4P4J A;  2PJA A;  1AYE A;  4JCA A;  1QQ9 A;  2AFO A;  5CBM A;  4NFR A;  3GB0 A;  1CX8 A;  3S9L A;  4F9U A;  2AFW A;  1LAM A;  1DE4 C;  4ZX9 A;  5K8N A;  2AFS A;  3KI9 A;  4H2K A;  1CPX A;  2QVP A;  1LOK A;  2Q4Z A;  4TNU A;  1LAN A;  2Q43 A;  4NJQ A;  5FSX A;  4ETK A;  2QYV A;  3JZT A;  3D7F A;  5LRK A;  1XMB A;  4FBE A;  5DUS A;  1ZG7 A;  4Q7A A;  4TWE A;  4F8Z A;  1VHE A;  1EE3 P;  2ZEH A;  1F2O A;  3S9M A;  1HEE A;  1F57 A;  1PCA A;  4KYB A;  5AIL A;  5LRG A;  3KQZ A;  3SIG A;  2V8V A;  4P6Y A;  1XFO A;  4JGK A;  3GQE A;  2O4H A;  1SPV A;  3B3V A;  3SJE A;  4A39 A;  1TKF A;  3IFE A;  4YWY A;  1XJO A;  3MN8 A;  1LAP A;  1ZLI A;  2OOT A;  4A37 A;  3TX8 A;  3FX6 A;  2ABZ A;  4K3N A;  1YW6 A;  1BAV A;  3HUV A;  2XD7 A;  3SII A;  3PB8 X;  3PB6 X;  4UIB A;  4P4F A;  2XEG A;  4OC3 A;  2DEA A;  4RUH A;  4OIW A;  1VIX A;  2PCU A;  4J4Z A;  2AFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...