3KQXA

Structure of a protease 1
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqxA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqxA02
4PXCA 5CPAA 3QNVA 2G9DA 3BXMA 4G1PA 1F2PA 1M4LA 3PB8X 4OMEA 1PCAA 3B7IA 4OC3A 4GM5A 2V8VA 1GYTA 4NGRA 6CPAA 4X3RA 4P4IA 4FWUA 2IMOA 1Y7EA 3GUXA 2PVWA 3PFEA 5F09A 5FSXA 2PJ4A 4ZY1A 1NSAA 4NGSA 5JM6A 2V8GA 4OC0A 4UIAA 2ZELA 4A94A 4H2KA 4UEZA 3FH4A 1LAMA 2ZOFA 4P4FA 4ABLA 5AILA 5THWA 4JYWA 4P6YA 4JCAA 4OC4A 2V8DA 3IIDA 2HB6A 2ZEPA 1LFWA 4WWVA 1CPXA 2PJBA 1VHOA 4NGMA 2AFXA 1VHUA 2AFUA 3ISZA 5K8PA 2WZNA 1IY7A 1ZR5A 2PJCA 3WC7A 3NH5A 4R76A 4ZI6A 1AMPA 3VARA 3V2BA 3SI0A 4A37A 4DYOA 3KR5A 2C6CA 2XEFA 4PPZA 3KHZA 1ARLA 2LGRA 3HUVA 4KYBA 5JH9A 4R6TA 4F8ZA 2ZEDA 3SJEA 2FXKA 2F7VA 3KGQA 5DS0A 1Z5RA 3HLPA 4MMOA 3B3SA 4OC5A 3SJXA 4UEEA 2Q43A 3PB7X 2ZEOA 2FVGA 2CTBA 3Q6ZA 4EWTA 3D4UA 4PXEA 3B3TA 2JBKA 3V45A 1BLLE 5FSUA 5LYLA 3N5FA 4Z65A 4BD9A 4P10A 1F57A 1CX8A 2EK9A 5HVFA 3D67A 2ZENA 3GLJA 5HVHA 5LYFA 3EWRA 3SIIA 3FF3A 4FBEA 4ABKA 4IHMA 2BFQA 4NGQA 2AFCA 3PEIA 5LRJA 4MHZA 3RZAA 3JRUA 1LOKA 3CPXA 5LRKA 2PVVA 3SI1A 5FSZA 5FSVA 4J5QA 2PIZA 2BFRA 2GREA 3SJFA 1ELLP 4B6ZA 3D66A 2L8RA 1R43A 1PYTB 4MCRA 3D7GA 3PB4X 3NH8A 5I4MA 1YLOA 4FAIA 5K8NA 2AFSA 3EJFA 4IK2A 4IQYA 4UF4A 2PE3A 5HOLA 3DLJA 3IWWA 2ZEMA 4TWEA 2PRQA 1TKFA 1LCPA 2EEEA 3I1UA 3WC5A 3S9NA 3B3WA 3SJGA 4FUUA 1OBRA 3KI9A 3VFQA 2OOTA 4P4JA 2OR4A 4ETKA 1DE4C 3NFZA 3BI0A 4RUHA 3IJ3A 3NA6A 2PJAA 3GPQA 3EWPA 1AYEA 4ZYQA 2PJ1A 2PJ0A 4JZ0A 3KHXA 3KZWA 4ZY2A 4ZX8A 1UWYA 3B3CA 3PB6X 4A38A 4GUAA 5J1QA 4TU0A 4ZX9A 3IIBA 1SPVA 4J4ZA 1CP7A 3PB9X 3H8FA 2PJ5A 1TXRA 1CG2A 3RBUA 2ZOGA 1YSJA 2GLJA 4MCSA 2EK8A 3FX6A 5HXDA 2AFOA 3FVLA 1BPMA 1H8LA 3NH4A 1YD9A 2CIJA 2FAVA 3PBEA 3RAMA 2IQ6A 2ZEHA 3JZTA 2PCUA 4P4BA 3GB0A 3GQOA 5JGFA 2Q4ZA 4ETJA 1XJOA 4OIWA 3SIGA 5DUSA 3WC6A 1YMEA 1EE3P 1VGYA 3KQZA 4ESSA 3T8WA 1DTDA 3D7FA 3ISXA 3IFEA 3K2KA 1CBXA 1HDUA 1CPSA 4PXBA 4LQGA 1XMBA 3FEDA 1TKJA 1QQ9A 3TC8A 4P45A 3WABA 3DGVA 3IO1A 4DUKA 5K8OA 2V8HA 4TNUA 4EFDA 1Z8LA 4UMLA 4NGNA 3H8EA 4NJQA 1ELMP 4OP4A 1LAPA 4OIDA 3EKEA 5D8NA 5E3BA 3CT9A 3KL9A 4OC2A 3Q71A 4MHNA 3MRUA 4X2TA 3MN8A 5HVGA 4MXUA 2XEGA 5HIHA 2ZEGA 3PBBA 3GQEA 4D86A 2CF4A 1ZG7A 3SI2A 4CPAA 1F2OA 3SIHA 2ZEFA 2DEAA 4WJBA 4ZY0A 3B3VA 5FSYA 2XD7A 2CTCA 3KQXA 3VATA 1TF8A 1XRYA 1KWMA 2XEJA 4IAVA 1YW4A 8CPAA 2BO9A 3LMSA 4GVVA 5CB5A 3S9MA 1ZLIA 4OKOA 2I3CA 4OC1A 1ARMA 2ABZA 1BAVA 4F9VA 2NSMA 3FECA 3S9LA 2Q51A 3B35A 2VRIA 4GVWA 2PIYA 5K8MA 3BI1A 4Q7AA 1XFOA 1QMUA 3EWOA 1TKHA 2F8HA 2XEIA 2O53A 1BPNA 5CMSA 2X47A 1Y0YA 3D7HA 4JLLA 4JVVA 2WYRA 4EMEA 1FNOA 1ZG8A 4YU9A 2HC9A 3FEEA 5CBMA 1YW6A 5CB3A 2IJZA 1NJRA 3EWQA 3PRTA 1TY8A 2QYVA 2PJ7A 4PXDA 3V7ZA 4UEFA 4MRIA 3D68A 4O23A 2VL1A 2FG1A 2JBJA 2QJ8A 2PJ3A 1FT7A 2EWBA 3V38A 1Y0RA 1IGBA 1ZLHA 2NYQA 4MHPA 1HEEA 3ETIA 3D7DA 4K3NA 2V77A 7CPAA 3TX8A 4NFRA 2C6GA 1CP6A 1TXZA 5IB9A 2AFZA 5LYDA 4F9UA 2RFHA 3CPAA 1JQGA 1HDQA 1XBUA 2GLFA 3IEHA 4W9YA 2QVPA 1HJZA 3H8GA 3L2NA 3CDXA 3GPOA 3IIFA 3K9TA 2ACFA 4R7MA 4K0CA 4P44A 3WT4A 1R3NA 2ZEEA 4NGPA 2BCOA 4PQAA 4X8IA 4A39A 1VHEA 4J5RA 2RB7A 5LRGA 5ELYA 4DJLA 1ZR3A 1ZG9A 4JGKA 3KASA 2AFMA 2DX6A 4MCPA 4AXVA 2ANPA 4J5SA 4ONWA 2PJ9A 3FMCA 1RTQA 3EW5A 2C6PA 3B2YA 1Z2LA 5D29A 5LYIA 3PFOA 4MCQA 3KR4A 3GPGA 4UIBA 1Q7LA 4R8FA 3EJGA 1TF9A 1LANA 2POKA 4MHYA 2O4HA 2JEWA 2BOAA 4KSIA 3LWUA 3IC1A 4YWYA 2GU2A 4P4DA 3SIJA 3FJUA 4NGTA 3VH9A 2J9AA 2PJ8A 4NJRA 2PJ2A 2C1CA 4P4EA 2PJ6A 1VIXA 3BHXA 2AFWA
chains in the Genus database with same CATH superfamily
2FSRA 2RNKA 4PXCA 1IICA 2JLMA 1VKCA 3QNVA 2Z3NA 2G9DA 3BXMA 5CPAA 4C7HA 3D3SA 1MJBA 4G1PA 1F2PA 1M4LA 3PB8X 4OMEA 1PCAA 3B7IA 4OC3A 5E96A 1VHSA 4GM5A 2V8VA 2J8RA 2BSWA 1GYTA 4NGRA 6CPAA 4X3RA 4R3KA 5F47A 4M3SA 4M6GA 3S6GA 4P4IA 4FWUA 2IMOA 1Y7EA 3GUXA 2PVWA 3PFEA 2Q7BA 5F09A 5FSXA 2PJ4A 2Z3MA 4ZY1A 1NSAA 4KLWA 4NGSA 2V8GA 5JM6A 4OC0A 4UIAA 2ZELA 4A94A 4H2KA 4CYPA 5C88A 1YGHA 4UEZA 4Q38A 3FH4A 3G8WA 1LAMA 4B5PA 3IU1A 2ZOFA 2GANA 4B11A 4P4FA 4ABLA 1QSMA 5AILA 2OU2A 5THWA 4JYWA 4HNWB 5G21A 3S6KA 4P6YA 4JCAA 4XNHC 4OC4A 3OWCA 2V8DA 3IIDA 2HB6A 3FNCA 2CNSA 2WPWA 4KUAA 2ZEPA 1LFWA 4WWVA 2JEVA 3UY5A 1CPXA 5F46A 3F5BA 2PJBA 4MFLA 1VHOA 4PSXA 1NE9A 2CXAA 5HH1A 4NGMA 1JWQA 2AFXA 4ONUA 1VHUA 1PUAA 2A4NA 4FD4A 2AFUA 3ISZA 1M44A 2Z11A 5K8PA 1AUGA 2WZNA 1IY7A 3QAHA 3LD2A 1ZR5A 2PJCA 3WC7A 3NH5A 3GY9A 3R1KA 4MFKA 2EO8A 4R76A 4ZI6A 1AMPA 2R98A 2EBJA 3VARA 4A33A 4II9A 3V2BA 3SI0A 4A37A 4DYOA 3KR5A 5I0CA 2C6CA 4CAFA 2XEFA 2J8NA 4PK3A 4X5KA 2ZXVA 4C68A 4PPZA 1M4GA 2J8MA 3KHZA 2GE3A 1ARLA 1Q2YA 2LGRA 1MJ9A 4KYBA 2PR8A 3HUVA 5C82A 4R6TA 2Z10A 4IUSA 4F8ZA 3P2FA 4MI4A 5JH9A 2ZEDA 4KOYA 2ZW4A 3SJEA 4C2ZA 4Y49B 2FXKA 2F7VA 2OZGA 3KGQA 5DS0A 1Z5RA 3W6XA 3KKWA 3HLPA 1U6MA 4MMOA 3B3SA 4UCPA 2VZZA 4OC5A 3SJXA 2Z3OA 4UEEA 2Q43A 3PB7X 2ZEOA 2FVGA 4CGMA 4QUSA 3EXNA 2G3TA 2OB0A 2CTBA 3Q6ZA 2VEZA 1Z8XA 2PRBA 5G22A 4KSFA 4MHDA 4EWTA 2WUUA 3D4UA 3BJ7A 4PXEA 3B3TA 4CGPA 2JBKA 2JZFA 2PQ8A 3V45A 2Z3KA 3D2PA 4MBUA 1BLLE 1XEBA 3V8IA 2ARHA 3QB8A 5FSUA 5H86A 5LYLA 1I21A 3N5FA 4Z65A 4BD9A 1CM0A 2VI7A 4P10A 3S6HA 1IOIA 1F57A 1J4JA 1CX8A 3RYOA 1YVKA 2B4DA 2EK9A 5HVFA 4KZTA 4LUAA 3D67A 5EMIA 2ZENA 5GCNA 4PV6A 4HNXB 3GLJA 5HVHA 5LYFA 3BJ8A 3EWRA 4KVME 2PC1A 4FD6A 4MY3A 4CAXA 1IYKA 3SIIA 1V0CA 4MFZA 3FBUA 3QAYA 3FF3A 4XPDC 4FBEA 1FY7A 4ABKA 2OH1A 4IHMA 2BFQA 4NGQA 5AG7A 4B5OA 2AFCA 3PEIA 4RN7A 2VXKA 2DXQA 4FD7A 3JRUA 4MHZA 5LRJA 3RZAA 1LOKA 2FIAA 5A28A 3DR8A 4LX9A 4AVAA 4QVTA 5DWMA 3CPXA 3PZJA 5LRKA 2PVVA 3SI1A 5FSZA 5FSVA 4J5QA 4CGNA 4AG9A 4A2ZA 4R3LA 2PIZA 2BFRA 1M4IA 2GREA 3SJFA 1QSRA 4ZGYB 1ELLP 2D4OA 4B6ZA 3D66A 2L8RA 3TO6A 3VWDA 2B3UA 4AVBA 1ZO0A 1R43A 1PYTB 3E0KA 4MCRA 3D7GA 4YRHA 3PB4X 2BUEA 3A9LA 4U5YA 3TOBA 4A38A 5JQ4A 1SQHA 2G3AA 3SHPA 3NH8A 5I4MA 4GS4A 1YLOA 3CXSA 4FAIA 5K8NA 2AFSA 3EJFA 1OZPA 4IK2A 4IQYA 3CXQA 4UF4A 3R9GA 2PE3A 5HOLA 3DLJA 3H5ZA 1YX0A 2ZEMA 3IWWA 3D2MA 4TWEA 2PRQA 1TKFA 1LCPA 4C2YA 4M6HA 2EEEA 3I1UA 3SXNA 4RI1A 3B3WA 3WC5A 1WWZA 3SJGA 4FUUA 4IF5A 2P6FA 1OBRA 3KI9A 3VFQA 2OOTA 4P4JA 2OR4A 4ETKA 1DE4C 2WPXA 3IU2A 3NFZA 3BI0A 4RUHA 3IJ3A 3LACA 3NA6A 1GHEA 1YQEA 1Z4EA 1ON0A 3P2HA 2PJAA 4UFVA 3PP9A 4JJXA 5CNPA 3GPQA 3EWPA 1AYEA 4JWPA 3GIUA 4ZYQA 1RO5A 4K30A 2PJ1A 2PJ0A 1YLEA 1XE4A 3KHXA 4JZ0A 3KZWA 5KTCA 4ZY2A 4A31A 4ZX8A 1LRZA 1UWYA 3B3CA 3PB6X 3IWEA 4MJ8A 5AG6A 4GUAA 1CJWA 3DDDA 4OLLA 2Q4VA 3TE4A 5J1QA 1KUVA 1S7NA 4UCMA 5KTAA 3NE7A 4TU0A 3TOAA 1Z8TA 4ZX9A 5KTDA 3IIBA 1YREA 1SPVA 4J4ZA 1CP7A 4E2AA 3EC4A 4AG7A 3EFAA 3N7ZA 3PB9X 3H8FA 2Q7SA 2PJ5A 1TXRA 3G3SA 4R57A 1CG2A 3T90A 3RBUA 1I12A 2ZOGA 2OZUA 5J8CA 1YSJA 2GLJA 2JDDA 4MCSA 2EK8A 2VQYA 3FIXA 3FX6A 5HXDA 2AFOA 3I9SA 3FVLA 2B5GA 4RS2A 1BPMA 1H8LA 4QB9A 1A2ZA 4MFJA 3NH4A 4CYNA 3S9NA 3DR6A 1YD9A 2CIJA 2FAVA 2P6GA 3PBEA 3RAMA 2IQ6A 5IV0A 4CYQA 2ZEHA 4B5PB 4CGOA 2CNTA 3JZTA 2PCUA 4P4BA 3SXOA 3WR7A 3GB0A 3GQOA 1BOBA 4KORA 5JGFA 2Q4ZA 4JLYA 4ETJA 4CYOA 1XJOA 4KOTA 4OIWA 3TO7A 3SIGA 1MJAA 5DUSA 1Z4RA 4HPSA 3WC6A 4L8AA 3FB3A 1YMEA 2AE6A 4UFXA 4MFQA 1EE3P 1Z9UA 4PK2A 1VGYA 3KQZA 4ESSA 3T8WA 1DTDA 3D7FA 1KZFA 2B3VA 3ISXA 3IFEA 3K2KA 1CBXA 2HUZA 1HDUA 1CPSA 4PXBA 5G1ZA 3S6FA 4KSAA 1XMTA 4LQGA 3GYAA 4KOVA 1XMBA 3FEDA 1TKJA 2GIVA 4F6AA 1QQ9A 3TC8A 4P45A 2DF5A 2PDOA 3WABA 4FD5A 2KQVA 3DGVA 2R7HA 3K9UA 5AGEA 4J3GA 3IO1A 4DUKA 5ISVA 1S3ZA 2V8HA 4TNUA 3TCVA 2JDCA 4EFDA 5K8OA 1Z8LA 4UMLA 4JXQA 3RNZA 4NGNA 3H8EA 2I79A 2AJ6A 4YGOA 2FIWA 3CZXA 4NJQA 1ELMP 1YK3A 2YGWA 1Y7RA 1TIQA 2OZHA 3R9EA 4MY0A 1LAPA 4NEXA 4OP4A 4YFJA 4OIDA 3R95A 3T9YA 5BWAB 3EKEA 5D8NA 5E3BA 4R87A 4UWJA 5AG4A 5HMNA 3CT9A 3KL9A 4OC2A 3Q71A 1Q2DA 3TT2A 4U9YA 4MHNA 4KOXA 3MRUA 2IL4A 4M6IA 4LQ6A 4X2TA 3MN8A 5HVGA 4MXUA 2GFQA 2XEGA 2ZPAA 5HIHA 2ZEGA 4M85A 3PBBA 3GQEA 4D86A 2CF4A 3IWGA 2Q44A 4DNCA 4UWIA 1ZG7A 4KOWA 3SI2A 4CPAA 4E0AA 1F2OA 2PR1A 3SIHA 3GKRA 2ZEFA 2DEAA 2Z3LA 4WJBA 4ZY0A 3B3VA 4UCNA 2RC4A 2ZW5A 4NSQA 4Q36A 4UBRA 5FSYA 4C2XA 3IGRA 4F0YA 2KCWA 2XD7A 2CTCA 3KQXA 4CAVA 3VATA 3F8KA 3FYNA 1TF8A 1S7LA 4KOUA 2B4BA 2YNDA 1XRYA 4H89A 1KWMA 1XOVA 2XEJA 3LODA 1YW4A 4IAVA 8CPAA 2BO9A 2QIRA 4GVVA 5CB5A 3DSBA 3LMSA 1ZLIA 3S9MA 3TO9A 1S60A 2I3CA 4HNYB 2FS5A 4OKOA 4OC1A 1ARMA 2ABZA 1BAVA 4F9VA 3MGDA 2NSMA 1MK4A 1S5KA 4XPKA 3R9FA 5A27A 4QBJA 3FECA 2B4DB 3S9LA 2Q51A 2WCTA 4NCZA 4H6UA 2FL4A 2VRIA 4GVWA 2PIYA 3B35A 2PSWA 1M1DA 3BI1A 5K8MA 4Q7AA 2Y0MA 2R8VA 4F0XA 1XFOA 1QMUA 4OADA 2R1IA 3EWOA 1IOFA 4I49A 3TTHA 2YNEA 4A32A 3I3GA 2ZW7A 4XPLA 1TKHA 2F8HA 2F5IA 2XEIA 2O53A 5EC4A 1BPNA 5CMSA 4UA3A 2X47A 1Y0YA 3D7HA 2JZEA 4JLLA 4CRZB 4JVVA 3NE8A 5FVJA 2QECA 2WYRA 4EMEA 1FNOA 3W6SA 1ZG8A 4YU9A 5AG5A 3JUWA 1QSNA 1P4NA 1WK4A 4H6ZA 2HC9A 5IB0A 4ZBGA 4B13A 3FEEA 3JTKA 4AVCA 2D4PA 3H4QA 5CBMA 1YW6A 5F49A 5CB3A 2FCKA 4XNHB 2IJZA 1NJRA 3EWQA 1IB1E 1K4JA 3PRTA 4EVYA 3CXPA 4E8OA 1TY8A 2QYVA 2ZW6A 4UFWA 2PJ7A 5H84A 4PXDA 3V7ZA 4UEFA 4MRIA 3D68A 4O23A 2QMLA 2VL1A 2FG1A 1XIXA 2JBJA 2P6EA 3BLNA 4KOSA 1Q2CA 4KVOE 5J8FA 1QSTA 2CY2A 4A95A 2QJ8A 2X7BA 2PJ3A 1FT7A 2EWBA 4CAWA 3V38A 1Y0RA 2BL1A 1IGBA 4JD6A 5IX3A 3TFYA 1ZLHA 2NYQA 4MHPA 1HEEA 3EY5A 2VBQA 1YR0A 2Z3PA 1BO4A 1R57A 4B12A 3ETIA 3D7DA 1KUYA 3FRMA 4BMHA 2HV2A 4K3NA 1RXTA 2V77A 2REFA 7CPAA 2P0WA 3TX8A 4KUBA 4NFRA 1P0HA 2C6GA 1CP6A 3R96A 1TXZA 5IB9A 2AFZA 3VWEA 5LYDA 4F9UA 4R9MA 2RFHA 3CPAA 4Y49C 1M4DA 4L89A 1JQGA 2K5TA 1HDQA 1XBUA 2ODFA 1B6BA 2Q04A 1NSLA 2GLFA 4AB7A 1X12A 4CAEA 3IEHA 3F0AA 4W9YA 4GXHA 4CGLA 2QVPA 1HJZA 1QSOA 3H8GA 3L2NA 1IU8A 2FT0A 2G0BA 3CDXA 4C7IA 3GPOA 3IIFA 2O28A 3K9TA 5F48A 4HKFA 1YVOA 2ACFA 4R7MA 4K0CA 4P44A 3W91A 3WT4A 1R3NA 4PSWA 1Z8WA 2ZEEA 4NGPA 1B87A 2BCOA 3B8GA 4PQAA 4X8IA 4A39A 2B5GB 2Q4YA 2W2GA 1VHEA 2WSAA 3FXTA 4J5RA 2RB7A 1IIDA 5ELYA 5LRGA 4NXYA 4OAEA 4DJLA 1ZR3A 4NF1A 2DPTA 2CNMA 1ZG9A 4CRYB 2Q0YA 4JGKA 2HQYA 3KASA 2AFMA 2DX6A 2FXFA 3JVNA 2B58A 2ANPA 2NMTA 4MCPA 4AXVA 1PU9A 2REEA 4ORFA 1I1DA 3PGPA 4J5SA 3ZZIA 4B10A 4ONWA 2PJ9A 1Y9KA 2YNCA 4B14A 1X10A 3FMCA 1RTQA 3EW5A 2C6PA 1UFHA 2H5MA 3B2YA 5DWNA 4BINA 1Z2LA 5D29A 5G20A 5LYIA 2Z0ZA 1S7KA 4XPDB 2BEIA 1L0CA 3EO4A 3ZJ0A 3PFOA 4MCQA 3KR4A 4BBHA 3GPGA 2EUIA 4UIBA 1Q7LA 1S7FA 3EJGA 4R8FA 1TF9A 3BHXA 4KS9A 1LANA 3D8PA 1Y9WA 1XF8A 2POKA 4MHYA 2VZYA 2O4HA 4A30A 2JEWA 2JZDA 4KSIA 2BOAA 2DPSA 3LWUA 4U9ZA 3IC1A 3C26A 4KLVA 4YWYA 2C27A 4KVXA 4CS0B 3DNSA 2GU2A 4P4DA 3SIJA 2YNCC 1NMTA 3FJUA 4JXRA 4NGTA 2J9AA 2ATRA 3VH9A 2PJ8A 4NJRA 2EVNA 2I00A 2PJ2A 2FE7A 1N71A 2C1CA 3RO0A 5JPHA 4P4EA 2PJ6A 1VIXA 1KUXA 4QC6A 1IYLA 4MFPA 2AFWA 5EBVA
chains in the Genus database with same CATH topology
4PXCA 5CPAA 3QNVA 2G9DA 3BXMA 4G1PA 1F2PA 1M4LA 3PB8X 4OMEA 1PCAA 3B7IA 4OC3A 4GM5A 2V8VA 1GYTA 4NGRA 6CPAA 4X3RA 4P4IA 4FWUA 2IMOA 1Y7EA 3GUXA 2PVWA 3PFEA 5F09A 5FSXA 2PJ4A 4ZY1A 1NSAA 4NGSA 5JM6A 2V8GA 4OC0A 4UIAA 2ZELA 4A94A 4H2KA 4UEZA 3FH4A 1LAMA 2ZOFA 4P4FA 4ABLA 5AILA 5THWA 4JYWA 4P6YA 4JCAA 4OC4A 2V8DA 3IIDA 2HB6A 2ZEPA 1LFWA 4WWVA 1CPXA 2PJBA 1VHOA 4NGMA 2AFXA 1VHUA 2AFUA 3ISZA 5K8PA 2WZNA 1IY7A 1ZR5A 2PJCA 3WC7A 3NH5A 4R76A 4ZI6A 1AMPA 3VARA 3V2BA 3SI0A 4A37A 4DYOA 3KR5A 2C6CA 2XEFA 4PPZA 3KHZA 1ARLA 2LGRA 3HUVA 4KYBA 5JH9A 4R6TA 4F8ZA 2ZEDA 3SJEA 2FXKA 2F7VA 3KGQA 5DS0A 1Z5RA 3HLPA 4MMOA 3B3SA 4OC5A 3SJXA 4UEEA 2Q43A 3PB7X 2ZEOA 2FVGA 2CTBA 3Q6ZA 4EWTA 3D4UA 4PXEA 3B3TA 2JBKA 3V45A 1BLLE 5FSUA 5LYLA 3N5FA 4Z65A 4BD9A 4P10A 1F57A 1CX8A 2EK9A 5HVFA 3D67A 2ZENA 3GLJA 5HVHA 5LYFA 3EWRA 3SIIA 3FF3A 4FBEA 4ABKA 4IHMA 2BFQA 4NGQA 2AFCA 3PEIA 5LRJA 4MHZA 3RZAA 3JRUA 1LOKA 3CPXA 5LRKA 2PVVA 3SI1A 5FSZA 5FSVA 4J5QA 2PIZA 2BFRA 2GREA 3SJFA 1ELLP 4B6ZA 3D66A 2L8RA 1R43A 1PYTB 4MCRA 3D7GA 3PB4X 3NH8A 5I4MA 1YLOA 4FAIA 5K8NA 2AFSA 3EJFA 4IK2A 4IQYA 4UF4A 2PE3A 5HOLA 3DLJA 3IWWA 2ZEMA 4TWEA 2PRQA 1TKFA 1LCPA 2EEEA 3I1UA 3WC5A 3S9NA 3B3WA 3SJGA 4FUUA 1OBRA 3KI9A 3VFQA 2OOTA 4P4JA 2OR4A 4ETKA 1DE4C 3NFZA 3BI0A 4RUHA 3IJ3A 3NA6A 2PJAA 3GPQA 3EWPA 1AYEA 4ZYQA 2PJ1A 2PJ0A 4JZ0A 3KHXA 3KZWA 4ZY2A 4ZX8A 1UWYA 3B3CA 3PB6X 4A38A 4GUAA 5J1QA 4TU0A 4ZX9A 3IIBA 1SPVA 4J4ZA 1CP7A 3PB9X 3H8FA 2PJ5A 1TXRA 1CG2A 3RBUA 2ZOGA 1YSJA 2GLJA 4MCSA 2EK8A 3FX6A 5HXDA 2AFOA 3FVLA 1BPMA 1H8LA 3NH4A 1YD9A 2CIJA 2FAVA 3PBEA 3RAMA 2IQ6A 2ZEHA 3JZTA 2PCUA 4P4BA 3GB0A 3GQOA 5JGFA 2Q4ZA 4ETJA 1XJOA 4OIWA 3SIGA 5DUSA 3WC6A 1YMEA 1EE3P 1VGYA 3KQZA 4ESSA 3T8WA 1DTDA 3D7FA 3ISXA 3IFEA 3K2KA 1CBXA 1HDUA 1CPSA 4PXBA 4LQGA 1XMBA 3FEDA 1TKJA 1QQ9A 3TC8A 4P45A 3WABA 3DGVA 3IO1A 4DUKA 5K8OA 2V8HA 4TNUA 4EFDA 1Z8LA 4UMLA 4NGNA 3H8EA 4NJQA 1ELMP 4OP4A 1LAPA 4OIDA 3EKEA 5D8NA 5E3BA 3CT9A 3KL9A 4OC2A 3Q71A 4MHNA 3MRUA 4X2TA 3MN8A 5HVGA 4MXUA 2XEGA 5HIHA 2ZEGA 3PBBA 3GQEA 4D86A 2CF4A 1ZG7A 3SI2A 4CPAA 1F2OA 3SIHA 2ZEFA 2DEAA 4WJBA 4ZY0A 3B3VA 5FSYA 2XD7A 2CTCA 3KQXA 3VATA 1TF8A 1XRYA 1KWMA 2XEJA 4IAVA 1YW4A 8CPAA 2BO9A 3LMSA 4GVVA 5CB5A 3S9MA 1ZLIA 4OKOA 2I3CA 4OC1A 1ARMA 2ABZA 1BAVA 4F9VA 2NSMA 3FECA 3S9LA 2Q51A 3B35A 2VRIA 4GVWA 2PIYA 5K8MA 3BI1A 4Q7AA 1XFOA 1QMUA 3EWOA 1TKHA 2F8HA 2XEIA 2O53A 1BPNA 5CMSA 2X47A 1Y0YA 3D7HA 4JLLA 4JVVA 2WYRA 4EMEA 1FNOA 1ZG8A 4YU9A 2HC9A 3FEEA 5CBMA 1YW6A 5CB3A 2IJZA 1NJRA 3EWQA 3PRTA 1TY8A 2QYVA 2PJ7A 4PXDA 3V7ZA 4UEFA 4MRIA 3D68A 4O23A 2VL1A 2FG1A 2JBJA 2QJ8A 2PJ3A 1FT7A 2EWBA 3V38A 1Y0RA 1IGBA 1ZLHA 2NYQA 4MHPA 1HEEA 3ETIA 3D7DA 4K3NA 2V77A 7CPAA 3TX8A 4NFRA 2C6GA 1CP6A 1TXZA 5IB9A 2AFZA 5LYDA 4F9UA 2RFHA 3CPAA 1JQGA 1HDQA 1XBUA 2GLFA 3IEHA 4W9YA 2QVPA 1HJZA 3H8GA 3L2NA 3CDXA 3GPOA 3IIFA 3K9TA 2ACFA 4R7MA 4K0CA 4P44A 3WT4A 1R3NA 2ZEEA 4NGPA 2BCOA 4PQAA 4X8IA 4A39A 1VHEA 4J5RA 2RB7A 5LRGA 5ELYA 4DJLA 1ZR3A 1ZG9A 4JGKA 3KASA 2AFMA 2DX6A 4MCPA 4AXVA 2ANPA 4J5SA 4ONWA 2PJ9A 3FMCA 1RTQA 3EW5A 2C6PA 3B2YA 1Z2LA 5D29A 5LYIA 3PFOA 4MCQA 3KR4A 3GPGA 4UIBA 1Q7LA 4R8FA 3EJGA 1TF9A 1LANA 2POKA 4MHYA 2O4HA 2JEWA 2BOAA 4KSIA 3LWUA 3IC1A 4YWYA 2GU2A 4P4DA 3SIJA 3FJUA 4NGTA 3VH9A 2J9AA 2PJ8A 4NJRA 2PJ2A 2C1CA 4P4EA 2PJ6A 1VIXA 3BHXA 2AFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXC A;  5CPA A;  3QNV A;  2G9D A;  3BXM A;  4G1P A;  1F2P A;  1M4L A;  3PB8 X;  4OME A;  1PCA A;  3B7I A;  4OC3 A;  4GM5 A;  2V8V A;  1GYT A;  4NGR A;  6CPA A;  4X3R A;  4P4I A;  4FWU A;  2IMO A;  1Y7E A;  3GUX A;  2PVW A;  3PFE A;  5F09 A;  5FSX A;  2PJ4 A;  4ZY1 A;  1NSA A;  4NGS A;  5JM6 A;  2V8G A;  4OC0 A;  4UIA A;  2ZEL A;  4A94 A;  4H2K A;  4UEZ A;  3FH4 A;  1LAM A;  2ZOF A;  4P4F A;  4ABL A;  5AIL A;  5THW A;  4JYW A;  4P6Y A;  4JCA A;  4OC4 A;  2V8D A;  3IID A;  2HB6 A;  2ZEP A;  1LFW A;  4WWV A;  1CPX A;  2PJB A;  1VHO A;  4NGM A;  2AFX A;  1VHU A;  2AFU A;  3ISZ A;  5K8P A;  2WZN A;  1IY7 A;  1ZR5 A;  2PJC A;  3WC7 A;  3NH5 A;  4R76 A;  4ZI6 A;  1AMP A;  3VAR A;  3V2B A;  3SI0 A;  4A37 A;  4DYO A;  3KR5 A;  2C6C A;  2XEF A;  4PPZ A;  3KHZ A;  1ARL A;  2LGR A;  3HUV A;  4KYB A;  5JH9 A;  4R6T A;  4F8Z A;  2ZED A;  3SJE A;  2FXK A;  2F7V A;  3KGQ A;  5DS0 A;  1Z5R A;  3HLP A;  4MMO A;  3B3S A;  4OC5 A;  3SJX A;  4UEE A;  2Q43 A;  3PB7 X;  2ZEO A;  2FVG A;  2CTB A;  3Q6Z A;  4EWT A;  3D4U A;  4PXE A;  3B3T A;  2JBK A;  3V45 A;  1BLL E;  5FSU A;  5LYL A;  3N5F A;  4Z65 A;  4BD9 A;  4P10 A;  1F57 A;  1CX8 A;  2EK9 A;  5HVF A;  3D67 A;  2ZEN A;  3GLJ A;  5HVH A;  5LYF A;  3EWR A;  3SII A;  3FF3 A;  4FBE A;  4ABK A;  4IHM A;  2BFQ A;  4NGQ A;  2AFC A;  3PEI A;  5LRJ A;  4MHZ A;  3RZA A;  3JRU A;  1LOK A;  3CPX A;  5LRK A;  2PVV A;  3SI1 A;  5FSZ A;  5FSV A;  4J5Q A;  2PIZ A;  2BFR A;  2GRE A;  3SJF A;  1ELL P;  4B6Z A;  3D66 A;  2L8R A;  1R43 A;  1PYT B;  4MCR A;  3D7G A;  3PB4 X;  3NH8 A;  5I4M A;  1YLO A;  4FAI A;  5K8N A;  2AFS A;  3EJF A;  4IK2 A;  4IQY A;  4UF4 A;  2PE3 A;  5HOL A;  3DLJ A;  3IWW A;  2ZEM A;  4TWE A;  2PRQ A;  1TKF A;  1LCP A;  2EEE A;  3I1U A;  3WC5 A;  3S9N A;  3B3W A;  3SJG A;  4FUU A;  1OBR A;  3KI9 A;  3VFQ A;  2OOT A;  4P4J A;  2OR4 A;  4ETK A;  1DE4 C;  3NFZ A;  3BI0 A;  4RUH A;  3IJ3 A;  3NA6 A;  2PJA A;  3GPQ A;  3EWP A;  1AYE A;  4ZYQ A;  2PJ1 A;  2PJ0 A;  4JZ0 A;  3KHX A;  3KZW A;  4ZY2 A;  4ZX8 A;  1UWY A;  3B3C A;  3PB6 X;  4A38 A;  4GUA A;  5J1Q A;  4TU0 A;  4ZX9 A;  3IIB A;  1SPV A;  4J4Z A;  1CP7 A;  3PB9 X;  3H8F A;  2PJ5 A;  1TXR A;  1CG2 A;  3RBU A;  2ZOG A;  1YSJ A;  2GLJ A;  4MCS A;  2EK8 A;  3FX6 A;  5HXD A;  2AFO A;  3FVL A;  1BPM A;  1H8L A;  3NH4 A;  1YD9 A;  2CIJ A;  2FAV A;  3PBE A;  3RAM A;  2IQ6 A;  2ZEH A;  3JZT A;  2PCU A;  4P4B A;  3GB0 A;  3GQO A;  5JGF A;  2Q4Z A;  4ETJ A;  1XJO A;  4OIW A;  3SIG A;  5DUS A;  3WC6 A;  1YME A;  1EE3 P;  1VGY A;  3KQZ A;  4ESS A;  3T8W A;  1DTD A;  3D7F A;  3ISX A;  3IFE A;  3K2K A;  1CBX A;  1HDU A;  1CPS A;  4PXB A;  4LQG A;  1XMB A;  3FED A;  1TKJ A;  1QQ9 A;  3TC8 A;  4P45 A;  3WAB A;  3DGV A;  3IO1 A;  4DUK A;  5K8O A;  2V8H A;  4TNU A;  4EFD A;  1Z8L A;  4UML A;  4NGN A;  3H8E A;  4NJQ A;  1ELM P;  4OP4 A;  1LAP A;  4OID A;  3EKE A;  5D8N A;  5E3B A;  3CT9 A;  3KL9 A;  4OC2 A;  3Q71 A;  4MHN A;  3MRU A;  4X2T A;  3MN8 A;  5HVG A;  4MXU A;  2XEG A;  5HIH A;  2ZEG A;  3PBB A;  3GQE A;  4D86 A;  2CF4 A;  1ZG7 A;  3SI2 A;  4CPA A;  1F2O A;  3SIH A;  2ZEF A;  2DEA A;  4WJB A;  4ZY0 A;  3B3V A;  5FSY A;  2XD7 A;  2CTC A;  3KQX A;  3VAT A;  1TF8 A;  1XRY A;  1KWM A;  2XEJ A;  4IAV A;  1YW4 A;  8CPA A;  2BO9 A;  3LMS A;  4GVV A;  5CB5 A;  3S9M A;  1ZLI A;  4OKO A;  2I3C A;  4OC1 A;  1ARM A;  2ABZ A;  1BAV A;  4F9V A;  2NSM A;  3FEC A;  3S9L A;  2Q51 A;  3B35 A;  2VRI A;  4GVW A;  2PIY A;  5K8M A;  3BI1 A;  4Q7A A;  1XFO A;  1QMU A;  3EWO A;  1TKH A;  2F8H A;  2XEI A;  2O53 A;  1BPN A;  5CMS A;  2X47 A;  1Y0Y A;  3D7H A;  4JLL A;  4JVV A;  2WYR A;  4EME A;  1FNO A;  1ZG8 A;  4YU9 A;  2HC9 A;  3FEE A;  5CBM A;  1YW6 A;  5CB3 A;  2IJZ A;  1NJR A;  3EWQ A;  3PRT A;  1TY8 A;  2QYV A;  2PJ7 A;  4PXD A;  3V7Z A;  4UEF A;  4MRI A;  3D68 A;  4O23 A;  2VL1 A;  2FG1 A;  2JBJ A;  2QJ8 A;  2PJ3 A;  1FT7 A;  2EWB A;  3V38 A;  1Y0R A;  1IGB A;  1ZLH A;  2NYQ A;  4MHP A;  1HEE A;  3ETI A;  3D7D A;  4K3N A;  2V77 A;  7CPA A;  3TX8 A;  4NFR A;  2C6G A;  1CP6 A;  1TXZ A;  5IB9 A;  2AFZ A;  5LYD A;  4F9U A;  2RFH A;  3CPA A;  1JQG A;  1HDQ A;  1XBU A;  2GLF A;  3IEH A;  4W9Y A;  2QVP A;  1HJZ A;  3H8G A;  3L2N A;  3CDX A;  3GPO A;  3IIF A;  3K9T A;  2ACF A;  4R7M A;  4K0C A;  4P44 A;  3WT4 A;  1R3N A;  2ZEE A;  4NGP A;  2BCO A;  4PQA A;  4X8I A;  4A39 A;  1VHE A;  4J5R A;  2RB7 A;  5LRG A;  5ELY A;  4DJL A;  1ZR3 A;  1ZG9 A;  4JGK A;  3KAS A;  2AFM A;  2DX6 A;  4MCP A;  4AXV A;  2ANP A;  4J5S A;  4ONW A;  2PJ9 A;  3FMC A;  1RTQ A;  3EW5 A;  2C6P A;  3B2Y A;  1Z2L A;  5D29 A;  5LYI A;  3PFO A;  4MCQ A;  3KR4 A;  3GPG A;  4UIB A;  1Q7L A;  4R8F A;  3EJG A;  1TF9 A;  1LAN A;  2POK A;  4MHY A;  2O4H A;  2JEW A;  2BOA A;  4KSI A;  3LWU A;  3IC1 A;  4YWY A;  2GU2 A;  4P4D A;  3SIJ A;  3FJU A;  4NGT A;  3VH9 A;  2J9A A;  2PJ8 A;  4NJR A;  2PJ2 A;  2C1C A;  4P4E A;  2PJ6 A;  1VIX A;  3BHX A;  2AFW A; 
#chains in the Genus database with same CATH topology
 2FSR A;  2RNK A;  4PXC A;  1IIC A;  2JLM A;  1VKC A;  3QNV A;  2Z3N A;  2G9D A;  3BXM A;  5CPA A;  4C7H A;  3D3S A;  1MJB A;  4G1P A;  1F2P A;  1M4L A;  3PB8 X;  4OME A;  1PCA A;  3B7I A;  4OC3 A;  5E96 A;  1VHS A;  4GM5 A;  2V8V A;  2J8R A;  2BSW A;  1GYT A;  4NGR A;  6CPA A;  4X3R A;  4R3K A;  5F47 A;  4M3S A;  4M6G A;  3S6G A;  4P4I A;  4FWU A;  2IMO A;  1Y7E A;  3GUX A;  2PVW A;  3PFE A;  2Q7B A;  5F09 A;  5FSX A;  2PJ4 A;  2Z3M A;  4ZY1 A;  1NSA A;  4KLW A;  4NGS A;  2V8G A;  5JM6 A;  4OC0 A;  4UIA A;  2ZEL A;  4A94 A;  4H2K A;  4CYP A;  5C88 A;  1YGH A;  4UEZ A;  4Q38 A;  3FH4 A;  3G8W A;  1LAM A;  4B5P A;  3IU1 A;  2ZOF A;  2GAN A;  4B11 A;  4P4F A;  4ABL A;  1QSM A;  5AIL A;  2OU2 A;  5THW A;  4JYW A;  4HNW B;  5G21 A;  3S6K A;  4P6Y A;  4JCA A;  4XNH C;  4OC4 A;  3OWC A;  2V8D A;  3IID A;  2HB6 A;  3FNC A;  2CNS A;  2WPW A;  4KUA A;  2ZEP A;  1LFW A;  4WWV A;  2JEV A;  3UY5 A;  1CPX A;  5F46 A;  3F5B A;  2PJB A;  4MFL A;  1VHO A;  4PSX A;  1NE9 A;  2CXA A;  5HH1 A;  4NGM A;  1JWQ A;  2AFX A;  4ONU A;  1VHU A;  1PUA A;  2A4N A;  4FD4 A;  2AFU A;  3ISZ A;  1M44 A;  2Z11 A;  5K8P A;  1AUG A;  2WZN A;  1IY7 A;  3QAH A;  3LD2 A;  1ZR5 A;  2PJC A;  3WC7 A;  3NH5 A;  3GY9 A;  3R1K A;  4MFK A;  2EO8 A;  4R76 A;  4ZI6 A;  1AMP A;  2R98 A;  2EBJ A;  3VAR A;  4A33 A;  4II9 A;  3V2B A;  3SI0 A;  4A37 A;  4DYO A;  3KR5 A;  5I0C A;  2C6C A;  4CAF A;  2XEF A;  2J8N A;  4PK3 A;  4X5K A;  2ZXV A;  4C68 A;  4PPZ A;  1M4G A;  2J8M A;  3KHZ A;  2GE3 A;  1ARL A;  1Q2Y A;  2LGR A;  1MJ9 A;  4KYB A;  2PR8 A;  3HUV A;  5C82 A;  4R6T A;  2Z10 A;  4IUS A;  4F8Z A;  3P2F A;  4MI4 A;  5JH9 A;  2ZED A;  4KOY A;  2ZW4 A;  3SJE A;  4C2Z A;  4Y49 B;  2FXK A;  2F7V A;  2OZG A;  3KGQ A;  5DS0 A;  1Z5R A;  3W6X A;  3KKW A;  3HLP A;  1U6M A;  4MMO A;  3B3S A;  4UCP A;  2VZZ A;  4OC5 A;  3SJX A;  2Z3O A;  4UEE A;  2Q43 A;  3PB7 X;  2ZEO A;  2FVG A;  4CGM A;  4QUS A;  3EXN A;  2G3T A;  2OB0 A;  2CTB A;  3Q6Z A;  2VEZ A;  1Z8X A;  2PRB A;  5G22 A;  4KSF A;  4MHD A;  4EWT A;  2WUU A;  3D4U A;  3BJ7 A;  4PXE A;  3B3T A;  4CGP A;  2JBK A;  2JZF A;  2PQ8 A;  3V45 A;  2Z3K A;  3D2P A;  4MBU A;  1BLL E;  1XEB A;  3V8I A;  2ARH A;  3QB8 A;  5FSU A;  5H86 A;  5LYL A;  1I21 A;  3N5F A;  4Z65 A;  4BD9 A;  1CM0 A;  2VI7 A;  4P10 A;  3S6H A;  1IOI A;  1F57 A;  1J4J A;  1CX8 A;  3RYO A;  1YVK A;  2B4D A;  2EK9 A;  5HVF A;  4KZT A;  4LUA A;  3D67 A;  5EMI A;  2ZEN A;  5GCN A;  4PV6 A;  4HNX B;  3GLJ A;  5HVH A;  5LYF A;  3BJ8 A;  3EWR A;  4KVM E;  2PC1 A;  4FD6 A;  4MY3 A;  4CAX A;  1IYK A;  3SII A;  1V0C A;  4MFZ A;  3FBU A;  3QAY A;  3FF3 A;  4XPD C;  4FBE A;  1FY7 A;  4ABK A;  2OH1 A;  4IHM A;  2BFQ A;  4NGQ A;  5AG7 A;  4B5O A;  2AFC A;  3PEI A;  4RN7 A;  2VXK A;  2DXQ A;  4FD7 A;  3JRU A;  4MHZ A;  5LRJ A;  3RZA A;  1LOK A;  2FIA A;  5A28 A;  3DR8 A;  4LX9 A;  4AVA A;  4QVT A;  5DWM A;  3CPX A;  3PZJ A;  5LRK A;  2PVV A;  3SI1 A;  5FSZ A;  5FSV A;  4J5Q A;  4CGN A;  4AG9 A;  4A2Z A;  4R3L A;  2PIZ A;  2BFR A;  1M4I A;  2GRE A;  3SJF A;  1QSR A;  4ZGY B;  1ELL P;  2D4O A;  4B6Z A;  3D66 A;  2L8R A;  3TO6 A;  3VWD A;  2B3U A;  4AVB A;  1ZO0 A;  1R43 A;  1PYT B;  3E0K A;  4MCR A;  3D7G A;  4YRH A;  3PB4 X;  2BUE A;  3A9L A;  4U5Y A;  3TOB A;  4A38 A;  5JQ4 A;  1SQH A;  2G3A A;  3SHP A;  3NH8 A;  5I4M A;  4GS4 A;  1YLO A;  3CXS A;  4FAI A;  5K8N A;  2AFS A;  3EJF A;  1OZP A;  4IK2 A;  4IQY A;  3CXQ A;  4UF4 A;  3R9G A;  2PE3 A;  5HOL A;  3DLJ A;  3H5Z A;  1YX0 A;  2ZEM A;  3IWW A;  3D2M A;  4TWE A;  2PRQ A;  1TKF A;  1LCP A;  4C2Y A;  4M6H A;  2EEE A;  3I1U A;  3SXN A;  4RI1 A;  3B3W A;  3WC5 A;  1WWZ A;  3SJG A;  4FUU A;  4IF5 A;  2P6F A;  1OBR A;  3KI9 A;  3VFQ A;  2OOT A;  4P4J A;  2OR4 A;  4ETK A;  1DE4 C;  2WPX A;  3IU2 A;  3NFZ A;  3BI0 A;  4RUH A;  3IJ3 A;  3LAC A;  3NA6 A;  1GHE A;  1YQE A;  1Z4E A;  1ON0 A;  3P2H A;  2PJA A;  4UFV A;  3PP9 A;  4JJX A;  5CNP A;  3GPQ A;  3EWP A;  1AYE A;  4JWP A;  3GIU A;  4ZYQ A;  1RO5 A;  4K30 A;  2PJ1 A;  2PJ0 A;  1YLE A;  1XE4 A;  3KHX A;  4JZ0 A;  3KZW A;  5KTC A;  4ZY2 A;  4A31 A;  4ZX8 A;  1LRZ A;  1UWY A;  3B3C A;  3PB6 X;  3IWE A;  4MJ8 A;  5AG6 A;  4GUA A;  1CJW A;  3DDD A;  4OLL A;  2Q4V A;  3TE4 A;  5J1Q A;  1KUV A;  1S7N A;  4UCM A;  5KTA A;  3NE7 A;  4TU0 A;  3TOA A;  1Z8T A;  4ZX9 A;  5KTD A;  3IIB A;  1YRE A;  1SPV A;  4J4Z A;  1CP7 A;  4E2A A;  3EC4 A;  4AG7 A;  3EFA A;  3N7Z A;  3PB9 X;  3H8F A;  2Q7S A;  2PJ5 A;  1TXR A;  3G3S A;  4R57 A;  1CG2 A;  3T90 A;  3RBU A;  1I12 A;  2ZOG A;  2OZU A;  5J8C A;  1YSJ A;  2GLJ A;  2JDD A;  4MCS A;  2EK8 A;  2VQY A;  3FIX A;  3FX6 A;  5HXD A;  2AFO A;  3I9S A;  3FVL A;  2B5G A;  4RS2 A;  1BPM A;  1H8L A;  4QB9 A;  1A2Z A;  4MFJ A;  3NH4 A;  4CYN A;  3S9N A;  3DR6 A;  1YD9 A;  2CIJ A;  2FAV A;  2P6G A;  3PBE A;  3RAM A;  2IQ6 A;  5IV0 A;  4CYQ A;  2ZEH A;  4B5P B;  4CGO A;  2CNT A;  3JZT A;  2PCU A;  4P4B A;  3SXO A;  3WR7 A;  3GB0 A;  3GQO A;  1BOB A;  4KOR A;  5JGF A;  2Q4Z A;  4JLY A;  4ETJ A;  4CYO A;  1XJO A;  4KOT A;  4OIW A;  3TO7 A;  3SIG A;  1MJA A;  5DUS A;  1Z4R A;  4HPS A;  3WC6 A;  4L8A A;  3FB3 A;  1YME A;  2AE6 A;  4UFX A;  4MFQ A;  1EE3 P;  1Z9U A;  4PK2 A;  1VGY A;  3KQZ A;  4ESS A;  3T8W A;  1DTD A;  3D7F A;  1KZF A;  2B3V A;  3ISX A;  3IFE A;  3K2K A;  1CBX A;  2HUZ A;  1HDU A;  1CPS A;  4PXB A;  5G1Z A;  3S6F A;  4KSA A;  1XMT A;  4LQG A;  3GYA A;  4KOV A;  1XMB A;  3FED A;  1TKJ A;  2GIV A;  4F6A A;  1QQ9 A;  3TC8 A;  4P45 A;  2DF5 A;  2PDO A;  3WAB A;  4FD5 A;  2KQV A;  3DGV A;  2R7H A;  3K9U A;  5AGE A;  4J3G A;  3IO1 A;  4DUK A;  5ISV A;  1S3Z A;  2V8H A;  4TNU A;  3TCV A;  2JDC A;  4EFD A;  5K8O A;  1Z8L A;  4UML A;  4JXQ A;  3RNZ A;  4NGN A;  3H8E A;  2I79 A;  2AJ6 A;  4YGO A;  2FIW A;  3CZX A;  4NJQ A;  1ELM P;  1YK3 A;  2YGW A;  1Y7R A;  1TIQ A;  2OZH A;  3R9E A;  4MY0 A;  1LAP A;  4NEX A;  4OP4 A;  4YFJ A;  4OID A;  3R95 A;  3T9Y A;  5BWA B;  3EKE A;  5D8N A;  5E3B A;  4R87 A;  4UWJ A;  5AG4 A;  5HMN A;  3CT9 A;  3KL9 A;  4OC2 A;  3Q71 A;  1Q2D A;  3TT2 A;  4U9Y A;  4MHN A;  4KOX A;  3MRU A;  2IL4 A;  4M6I A;  4LQ6 A;  4X2T A;  3MN8 A;  5HVG A;  4MXU A;  2GFQ A;  2XEG A;  2ZPA A;  5HIH A;  2ZEG A;  4M85 A;  3PBB A;  3GQE A;  4D86 A;  2CF4 A;  3IWG A;  2Q44 A;  4DNC A;  4UWI A;  1ZG7 A;  4KOW A;  3SI2 A;  4CPA A;  4E0A A;  1F2O A;  2PR1 A;  3SIH A;  3GKR A;  2ZEF A;  2DEA A;  2Z3L A;  4WJB A;  4ZY0 A;  3B3V A;  4UCN A;  2RC4 A;  2ZW5 A;  4NSQ A;  4Q36 A;  4UBR A;  5FSY A;  4C2X A;  3IGR A;  4F0Y A;  2KCW A;  2XD7 A;  2CTC A;  3KQX A;  4CAV A;  3VAT A;  3F8K A;  3FYN A;  1TF8 A;  1S7L A;  4KOU A;  2B4B A;  2YND A;  1XRY A;  4H89 A;  1KWM A;  1XOV A;  2XEJ A;  3LOD A;  1YW4 A;  4IAV A;  8CPA A;  2BO9 A;  2QIR A;  4GVV A;  5CB5 A;  3DSB A;  3LMS A;  1ZLI A;  3S9M A;  3TO9 A;  1S60 A;  2I3C A;  4HNY B;  2FS5 A;  4OKO A;  4OC1 A;  1ARM A;  2ABZ A;  1BAV A;  4F9V A;  3MGD A;  2NSM A;  1MK4 A;  1S5K A;  4XPK A;  3R9F A;  5A27 A;  4QBJ A;  3FEC A;  2B4D B;  3S9L A;  2Q51 A;  2WCT A;  4NCZ A;  4H6U A;  2FL4 A;  2VRI A;  4GVW A;  2PIY A;  3B35 A;  2PSW A;  1M1D A;  3BI1 A;  5K8M A;  4Q7A A;  2Y0M A;  2R8V A;  4F0X A;  1XFO A;  1QMU A;  4OAD A;  2R1I A;  3EWO A;  1IOF A;  4I49 A;  3TTH A;  2YNE A;  4A32 A;  3I3G A;  2ZW7 A;  4XPL A;  1TKH A;  2F8H A;  2F5I A;  2XEI A;  2O53 A;  5EC4 A;  1BPN A;  5CMS A;  4UA3 A;  2X47 A;  1Y0Y A;  3D7H A;  2JZE A;  4JLL A;  4CRZ B;  4JVV A;  3NE8 A;  5FVJ A;  2QEC A;  2WYR A;  4EME A;  1FNO A;  3W6S A;  1ZG8 A;  4YU9 A;  5AG5 A;  3JUW A;  1QSN A;  1P4N A;  1WK4 A;  4H6Z A;  2HC9 A;  5IB0 A;  4ZBG A;  4B13 A;  3FEE A;  3JTK A;  4AVC A;  2D4P A;  3H4Q A;  5CBM A;  1YW6 A;  5F49 A;  5CB3 A;  2FCK A;  4XNH B;  2IJZ A;  1NJR A;  3EWQ A;  1IB1 E;  1K4J A;  3PRT A;  4EVY A;  3CXP A;  4E8O A;  1TY8 A;  2QYV A;  2ZW6 A;  4UFW A;  2PJ7 A;  5H84 A;  4PXD A;  3V7Z A;  4UEF A;  4MRI A;  3D68 A;  4O23 A;  2QML A;  2VL1 A;  2FG1 A;  1XIX A;  2JBJ A;  2P6E A;  3BLN A;  4KOS A;  1Q2C A;  4KVO E;  5J8F A;  1QST A;  2CY2 A;  4A95 A;  2QJ8 A;  2X7B A;  2PJ3 A;  1FT7 A;  2EWB A;  4CAW A;  3V38 A;  1Y0R A;  2BL1 A;  1IGB A;  4JD6 A;  5IX3 A;  3TFY A;  1ZLH A;  2NYQ A;  4MHP A;  1HEE A;  3EY5 A;  2VBQ A;  1YR0 A;  2Z3P A;  1BO4 A;  1R57 A;  4B12 A;  3ETI A;  3D7D A;  1KUY A;  3FRM A;  4BMH A;  2HV2 A;  4K3N A;  1RXT A;  2V77 A;  2REF A;  7CPA A;  2P0W A;  3TX8 A;  4KUB A;  4NFR A;  1P0H A;  2C6G A;  1CP6 A;  3R96 A;  1TXZ A;  5IB9 A;  2AFZ A;  3VWE A;  5LYD A;  4F9U A;  4R9M A;  2RFH A;  3CPA A;  4Y49 C;  1M4D A;  4L89 A;  1JQG A;  2K5T A;  1HDQ A;  1XBU A;  2ODF A;  1B6B A;  2Q04 A;  1NSL A;  2GLF A;  4AB7 A;  1X12 A;  4CAE A;  3IEH A;  3F0A A;  4W9Y A;  4GXH A;  4CGL A;  2QVP A;  1HJZ A;  1QSO A;  3H8G A;  3L2N A;  1IU8 A;  2FT0 A;  2G0B A;  3CDX A;  4C7I A;  3GPO A;  3IIF A;  2O28 A;  3K9T A;  5F48 A;  4HKF A;  1YVO A;  2ACF A;  4R7M A;  4K0C A;  4P44 A;  3W91 A;  3WT4 A;  1R3N A;  4PSW A;  1Z8W A;  2ZEE A;  4NGP A;  1B87 A;  2BCO A;  3B8G A;  4PQA A;  4X8I A;  4A39 A;  2B5G B;  2Q4Y A;  2W2G A;  1VHE A;  2WSA A;  3FXT A;  4J5R A;  2RB7 A;  1IID A;  5ELY A;  5LRG A;  4NXY A;  4OAE A;  4DJL A;  1ZR3 A;  4NF1 A;  2DPT A;  2CNM A;  1ZG9 A;  4CRY B;  2Q0Y A;  4JGK A;  2HQY A;  3KAS A;  2AFM A;  2DX6 A;  2FXF A;  3JVN A;  2B58 A;  2ANP A;  2NMT A;  4MCP A;  4AXV A;  1PU9 A;  2REE A;  4ORF A;  1I1D A;  3PGP A;  4J5S A;  3ZZI A;  4B10 A;  4ONW A;  2PJ9 A;  1Y9K A;  2YNC A;  4B14 A;  1X10 A;  3FMC A;  1RTQ A;  3EW5 A;  2C6P A;  1UFH A;  2H5M A;  3B2Y A;  5DWN A;  4BIN A;  1Z2L A;  5D29 A;  5G20 A;  5LYI A;  2Z0Z A;  1S7K A;  4XPD B;  2BEI A;  1L0C A;  3EO4 A;  3ZJ0 A;  3PFO A;  4MCQ A;  3KR4 A;  4BBH A;  3GPG A;  2EUI A;  4UIB A;  1Q7L A;  1S7F A;  3EJG A;  4R8F A;  1TF9 A;  3BHX A;  4KS9 A;  1LAN A;  3D8P A;  1Y9W A;  1XF8 A;  2POK A;  4MHY A;  2VZY A;  2O4H A;  4A30 A;  2JEW A;  2JZD A;  4KSI A;  2BOA A;  2DPS A;  3LWU A;  4U9Z A;  3IC1 A;  3C26 A;  4KLV A;  4YWY A;  2C27 A;  4KVX A;  4CS0 B;  3DNS A;  2GU2 A;  4P4D A;  3SIJ A;  2YNC C;  1NMT A;  3FJU A;  4JXR A;  4NGT A;  2J9A A;  2ATR A;  3VH9 A;  2PJ8 A;  4NJR A;  2EVN A;  2I00 A;  2PJ2 A;  2FE7 A;  1N71 A;  2C1C A;  3RO0 A;  5JPH A;  4P4E A;  2PJ6 A;  1VIX A;  1KUX A;  4QC6 A;  1IYL A;  4MFP A;  2AFW A;  5EBV A; 
#chains in the Genus database with same CATH homology
 4PXC A;  5CPA A;  3QNV A;  2G9D A;  3BXM A;  4G1P A;  1F2P A;  1M4L A;  3PB8 X;  4OME A;  1PCA A;  3B7I A;  4OC3 A;  4GM5 A;  2V8V A;  1GYT A;  4NGR A;  6CPA A;  4X3R A;  4P4I A;  4FWU A;  2IMO A;  1Y7E A;  3GUX A;  2PVW A;  3PFE A;  5F09 A;  5FSX A;  2PJ4 A;  4ZY1 A;  1NSA A;  4NGS A;  5JM6 A;  2V8G A;  4OC0 A;  4UIA A;  2ZEL A;  4A94 A;  4H2K A;  4UEZ A;  3FH4 A;  1LAM A;  2ZOF A;  4P4F A;  4ABL A;  5AIL A;  5THW A;  4JYW A;  4P6Y A;  4JCA A;  4OC4 A;  2V8D A;  3IID A;  2HB6 A;  2ZEP A;  1LFW A;  4WWV A;  1CPX A;  2PJB A;  1VHO A;  4NGM A;  2AFX A;  1VHU A;  2AFU A;  3ISZ A;  5K8P A;  2WZN A;  1IY7 A;  1ZR5 A;  2PJC A;  3WC7 A;  3NH5 A;  4R76 A;  4ZI6 A;  1AMP A;  3VAR A;  3V2B A;  3SI0 A;  4A37 A;  4DYO A;  3KR5 A;  2C6C A;  2XEF A;  4PPZ A;  3KHZ A;  1ARL A;  2LGR A;  3HUV A;  4KYB A;  5JH9 A;  4R6T A;  4F8Z A;  2ZED A;  3SJE A;  2FXK A;  2F7V A;  3KGQ A;  5DS0 A;  1Z5R A;  3HLP A;  4MMO A;  3B3S A;  4OC5 A;  3SJX A;  4UEE A;  2Q43 A;  3PB7 X;  2ZEO A;  2FVG A;  2CTB A;  3Q6Z A;  4EWT A;  3D4U A;  4PXE A;  3B3T A;  2JBK A;  3V45 A;  1BLL E;  5FSU A;  5LYL A;  3N5F A;  4Z65 A;  4BD9 A;  4P10 A;  1F57 A;  1CX8 A;  2EK9 A;  5HVF A;  3D67 A;  2ZEN A;  3GLJ A;  5HVH A;  5LYF A;  3EWR A;  3SII A;  3FF3 A;  4FBE A;  4ABK A;  4IHM A;  2BFQ A;  4NGQ A;  2AFC A;  3PEI A;  5LRJ A;  4MHZ A;  3RZA A;  3JRU A;  1LOK A;  3CPX A;  5LRK A;  2PVV A;  3SI1 A;  5FSZ A;  5FSV A;  4J5Q A;  2PIZ A;  2BFR A;  2GRE A;  3SJF A;  1ELL P;  4B6Z A;  3D66 A;  2L8R A;  1R43 A;  1PYT B;  4MCR A;  3D7G A;  3PB4 X;  3NH8 A;  5I4M A;  1YLO A;  4FAI A;  5K8N A;  2AFS A;  3EJF A;  4IK2 A;  4IQY A;  4UF4 A;  2PE3 A;  5HOL A;  3DLJ A;  3IWW A;  2ZEM A;  4TWE A;  2PRQ A;  1TKF A;  1LCP A;  2EEE A;  3I1U A;  3WC5 A;  3S9N A;  3B3W A;  3SJG A;  4FUU A;  1OBR A;  3KI9 A;  3VFQ A;  2OOT A;  4P4J A;  2OR4 A;  4ETK A;  1DE4 C;  3NFZ A;  3BI0 A;  4RUH A;  3IJ3 A;  3NA6 A;  2PJA A;  3GPQ A;  3EWP A;  1AYE A;  4ZYQ A;  2PJ1 A;  2PJ0 A;  4JZ0 A;  3KHX A;  3KZW A;  4ZY2 A;  4ZX8 A;  1UWY A;  3B3C A;  3PB6 X;  4A38 A;  4GUA A;  5J1Q A;  4TU0 A;  4ZX9 A;  3IIB A;  1SPV A;  4J4Z A;  1CP7 A;  3PB9 X;  3H8F A;  2PJ5 A;  1TXR A;  1CG2 A;  3RBU A;  2ZOG A;  1YSJ A;  2GLJ A;  4MCS A;  2EK8 A;  3FX6 A;  5HXD A;  2AFO A;  3FVL A;  1BPM A;  1H8L A;  3NH4 A;  1YD9 A;  2CIJ A;  2FAV A;  3PBE A;  3RAM A;  2IQ6 A;  2ZEH A;  3JZT A;  2PCU A;  4P4B A;  3GB0 A;  3GQO A;  5JGF A;  2Q4Z A;  4ETJ A;  1XJO A;  4OIW A;  3SIG A;  5DUS A;  3WC6 A;  1YME A;  1EE3 P;  1VGY A;  3KQZ A;  4ESS A;  3T8W A;  1DTD A;  3D7F A;  3ISX A;  3IFE A;  3K2K A;  1CBX A;  1HDU A;  1CPS A;  4PXB A;  4LQG A;  1XMB A;  3FED A;  1TKJ A;  1QQ9 A;  3TC8 A;  4P45 A;  3WAB A;  3DGV A;  3IO1 A;  4DUK A;  5K8O A;  2V8H A;  4TNU A;  4EFD A;  1Z8L A;  4UML A;  4NGN A;  3H8E A;  4NJQ A;  1ELM P;  4OP4 A;  1LAP A;  4OID A;  3EKE A;  5D8N A;  5E3B A;  3CT9 A;  3KL9 A;  4OC2 A;  3Q71 A;  4MHN A;  3MRU A;  4X2T A;  3MN8 A;  5HVG A;  4MXU A;  2XEG A;  5HIH A;  2ZEG A;  3PBB A;  3GQE A;  4D86 A;  2CF4 A;  1ZG7 A;  3SI2 A;  4CPA A;  1F2O A;  3SIH A;  2ZEF A;  2DEA A;  4WJB A;  4ZY0 A;  3B3V A;  5FSY A;  2XD7 A;  2CTC A;  3KQX A;  3VAT A;  1TF8 A;  1XRY A;  1KWM A;  2XEJ A;  4IAV A;  1YW4 A;  8CPA A;  2BO9 A;  3LMS A;  4GVV A;  5CB5 A;  3S9M A;  1ZLI A;  4OKO A;  2I3C A;  4OC1 A;  1ARM A;  2ABZ A;  1BAV A;  4F9V A;  2NSM A;  3FEC A;  3S9L A;  2Q51 A;  3B35 A;  2VRI A;  4GVW A;  2PIY A;  5K8M A;  3BI1 A;  4Q7A A;  1XFO A;  1QMU A;  3EWO A;  1TKH A;  2F8H A;  2XEI A;  2O53 A;  1BPN A;  5CMS A;  2X47 A;  1Y0Y A;  3D7H A;  4JLL A;  4JVV A;  2WYR A;  4EME A;  1FNO A;  1ZG8 A;  4YU9 A;  2HC9 A;  3FEE A;  5CBM A;  1YW6 A;  5CB3 A;  2IJZ A;  1NJR A;  3EWQ A;  3PRT A;  1TY8 A;  2QYV A;  2PJ7 A;  4PXD A;  3V7Z A;  4UEF A;  4MRI A;  3D68 A;  4O23 A;  2VL1 A;  2FG1 A;  2JBJ A;  2QJ8 A;  2PJ3 A;  1FT7 A;  2EWB A;  3V38 A;  1Y0R A;  1IGB A;  1ZLH A;  2NYQ A;  4MHP A;  1HEE A;  3ETI A;  3D7D A;  4K3N A;  2V77 A;  7CPA A;  3TX8 A;  4NFR A;  2C6G A;  1CP6 A;  1TXZ A;  5IB9 A;  2AFZ A;  5LYD A;  4F9U A;  2RFH A;  3CPA A;  1JQG A;  1HDQ A;  1XBU A;  2GLF A;  3IEH A;  4W9Y A;  2QVP A;  1HJZ A;  3H8G A;  3L2N A;  3CDX A;  3GPO A;  3IIF A;  3K9T A;  2ACF A;  4R7M A;  4K0C A;  4P44 A;  3WT4 A;  1R3N A;  2ZEE A;  4NGP A;  2BCO A;  4PQA A;  4X8I A;  4A39 A;  1VHE A;  4J5R A;  2RB7 A;  5LRG A;  5ELY A;  4DJL A;  1ZR3 A;  1ZG9 A;  4JGK A;  3KAS A;  2AFM A;  2DX6 A;  4MCP A;  4AXV A;  2ANP A;  4J5S A;  4ONW A;  2PJ9 A;  3FMC A;  1RTQ A;  3EW5 A;  2C6P A;  3B2Y A;  1Z2L A;  5D29 A;  5LYI A;  3PFO A;  4MCQ A;  3KR4 A;  3GPG A;  4UIB A;  1Q7L A;  4R8F A;  3EJG A;  1TF9 A;  1LAN A;  2POK A;  4MHY A;  2O4H A;  2JEW A;  2BOA A;  4KSI A;  3LWU A;  3IC1 A;  4YWY A;  2GU2 A;  4P4D A;  3SIJ A;  3FJU A;  4NGT A;  3VH9 A;  2J9A A;  2PJ8 A;  4NJR A;  2PJ2 A;  2C1C A;  4P4E A;  2PJ6 A;  1VIX A;  3BHX A;  2AFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...