3KQXA

Structure of a protease 1
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqxA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqxA02
1HEEA 4OKOA 2PJ1A 3D7HA 4X3RA 2WZNA 1PYTB 4JGKA 5JGFA 4MHNA 5FSXA 3NH8A 2ABZA 1Y0RA 1ZG7A 3EJFA 1QMUA 4MHZA 4PPZA 1VHOA 2CTCA 1VGYA 2PJ5A 4R8FA 5K8PA 4P6YA 4JVVA 1M4LA 2XEIA 2PIZA 2EK8A 3IIDA 1VHEA 1UWYA 4ETJA 4ZYQA 1LAMA 2DX6A 1JQGA 3K9TA 1CX8A 4UEZA 4UIBA 1YSJA 2ZEPA 2ZELA 1BLLE 1ZR3A 4P4FA 2POKA 3PFOA 4PXBA 4UMLA 3FMCA 4K3NA 1YW6A 3GUXA 5LYDA 2I3CA 4PXEA 2IQ6A 2PJAA 3IFEA 3LMSA 3FVLA 4J5SA 1LFWA 3KHZA 3TX8A 8CPAA 4F8ZA 3EWRA 1ARMA 2AFZA 1CPSA 3I1UA 3PRTA 3SJGA 1LOKA 1TF8A 4R6TA 4IQYA 2PJ3A 2PIYA 3MRUA 4TNUA 4OC0A 3HUVA 5CPAA 2Q4ZA 4ZY2A 5HXDA 1XMBA 3IIFA 2V8HA 4R7MA 3RAMA 1NJRA 4UEFA 4O23A 4A39A 3EJGA 3B3WA 2ZEFA 3D4UA 2C1CA 4W9YA 5LYLA 4OC5A 1YMEA 2GLJA 1NSAA 3H8FA 3EKEA 2PJ9A 3DLJA 1DTDA 2ACFA 5HVFA 3FJUA 3NFZA 1XBUA 4F9VA 3FX6A 3FECA 2GLFA 2ZEGA 4WWVA 4DJLA 5HOLA 3RBUA 2IJZA 3NH5A 4X8IA 2PE3A 3GQEA 4P45A 4NGNA 2OR4A 4B6ZA 2AFMA 2C6PA 3WC7A 4FUUA 3PBEA 4GM5A 4FAIA 2AFCA 3H8GA 4FWUA 4D86A 4PXDA 2C6GA 4IAVA 3JZTA 2V77A 3KQZA 3SIJA 1KWMA 2PVVA 1F2PA 1TKJA 4P4IA 4TU0A 2HB6A 3GPQA 3VARA 5ELYA 2PJ6A 3B7IA 3Q71A 4PXCA 2J9AA 3SJEA 2CTBA 2F7VA 1CP7A 3EW5A 2PRQA 3D7DA 1Z2LA 2PJBA 4BD9A 3N5FA 3V7ZA 4NGTA 4A37A 5LRKA 3S9NA 4ZY0A 4MCRA 1LCPA 2BFRA 1ARLA 4GVWA 3GPGA 3JRUA 4H2KA 2OOTA 3IC1A 3NH4A 3CT9A 1Y0YA 3CPXA 4MHPA 4JCAA 3KI9A 1F57A 1HDUA 1AYEA 4IK2A 3V45A 5JM6A 1IY7A 1VIXA 1OBRA 2ZEEA 4Z65A 5I4MA 2PJ4A 2EK9A 5FSZA 4OC1A 2RB7A 3EWQA 1BPMA 1Z8LA 3PB6X 4MHYA 2AFOA 2V8DA 4UF4A 2F8HA 3PB8X 4YU9A 3B3SA 4MMOA 4OC3A 1Y7EA 2G9DA 3KR5A 3IWWA 3K2KA 1XFOA 4JZ0A 1F2OA 5HIHA 2JBKA 1ELLP 1PCAA 4NGQA 3FEEA 4PQAA 3IEHA 4WJBA 4ONWA 3HLPA 2PCUA 3CPAA 2VRIA 1Z5RA 4F9UA 3SJFA 2FVGA 3B3TA 3Q6ZA 3D7GA 4NJRA 3D7FA 1BPNA 1BAVA 2NYQA 2V8GA 2QVPA 3PEIA 1HDQA 5CMSA 2PJ2A 4J4ZA 2NSMA 1EE3P 2L8RA 5JH9A 2Q51A 1HJZA 4A38A 3SIIA 1ZG9A 3TC8A 3V2BA 5E3BA 1TXZA 2VL1A 3SI2A 4G1PA 2ZEDA 4IHMA 4NGSA 4KYBA 4OC4A 3D67A 1FT7A 1YW4A 1QQ9A 3RZAA 3SI1A 4P4DA 4Q7AA 5FSUA 1ELMP 4P4JA 2ANPA 5D8NA 3SI0A 4J5QA 4OIWA 3NA6A 4P44A 4ZX8A 2BCOA 3GPOA 5DUSA 2XD7A 1GYTA 1CP6A 3SIGA 4YWYA 1ZR5A 3B3VA 1ZLIA 3GLJA 5D29A 4RUHA 3PBBA 4DUKA 3GQOA 4GUAA 7CPAA 2FAVA 3VFQA 2PVWA 1YLOA 3B35A 2BFQA 2Q43A 1YD9A 3B3CA 3FF3A 4KSIA 4NFRA 2PJCA 5CBMA 2AFWA 5LYIA 2AFSA 2BOAA 1Q7LA 1CPXA 2BO9A 4J5RA 4FBEA 2CF4A 3D68A 4NGMA 3PB4X 4NGRA 3BI1A 3KL9A 3LWUA 2WYRA 2FXKA 1DE4C 3KASA 5J1QA 3WC6A 2ZEMA 3BXMA 5K8OA 5IB9A 3V38A 5AILA 1AMPA 2EEEA 1TF9A 4P4EA 2QYVA 1CBXA 4JYWA 4ABKA 1H8LA 4TWEA 1LAPA 4OC2A 2LGRA 4NGPA 1ZLHA 4NJQA 4ESSA 2V8VA 4GVVA 1XJOA 2HC9A 2XEGA 3QNVA 3CDXA 4LQGA 3EWPA 4A94A 2AFXA 4ETKA 3BI0A 3KGQA 3MN8A 3WABA 2XEFA 2GREA 4OP4A 5HVHA 3PFEA 4MCPA 5LYFA 3ETIA 3VH9A 5LRGA 3KHXA 2EWBA 3KQXA 1R43A 1LANA 3DGVA 5CB3A 4EFDA 4K0CA 3IO1A 2GU2A 1VHUA 3PB7X 1TXRA 4ZI6A 4ZX9A 2IMOA 1RTQA 3KR4A 2CIJA 2ZOGA 3SIHA 2PJ7A 5THWA 4JLLA 3WT4A 5DS0A 2C6CA 1FNOA 4OIDA 2RFHA 3BHXA 4R76A 1XRYA 3ISZA 3VATA 3KZWA 3SJXA 1ZG8A 5F09A 4OMEA 5HVGA 4ZY1A 3D66A 4AXVA 3B2YA 4X2TA 4UIAA 3IIBA 4CPAA 3H8EA 2PJ8A 1TY8A 2QJ8A 4MRIA 3ISXA 4EMEA 1SPVA 3L2NA 3EWOA 6CPAA 2AFUA 3T8WA 5K8NA 4P4BA 4MXUA 4P10A 5FSYA 2JEWA 5LRJA 5CB5A 2ZEOA 4UEEA 3IJ3A 2FG1A 2DEAA 1TKHA 2O4HA 2ZENA 4DYOA 1CG2A 4MCSA 4EWTA 3PB9X 2ZOFA 2X47A 3FEDA 2PJ0A 3GB0A 4MCQA 3S9LA 2XEJA 3S9MA 1IGBA 3FH4A 1TKFA 2O53A 1R3NA 3WC5A 5K8MA 5FSVA 2ZEHA 2JBJA 4ABLA
chains in the Genus database with same CATH superfamily
3CXSA 1HEEA 4OKOA 2PJ1A 3D7HA 4M6HA 4X3RA 2JLMA 1XMTA 2WZNA 1PYTB 2HUZA 3QAHA 1XEBA 3H5ZA 4JGKA 5JGFA 4MHNA 2CY2A 5FSXA 1BOBA 3NH8A 3FBUA 3C26A 2ABZA 1Y0RA 1ZG7A 4KOYA 2BSWA 5DWMA 4CAFA 3EJFA 1QMUA 4MHZA 4PPZA 1VHOA 2ATRA 2Q4VA 2VZZA 2CTCA 2CNMA 2I00A 4HNYB 3F0AA 1VGYA 2PJ5A 4C68A 2F5IA 1XIXA 4JXRA 2Q0YA 2G3AA 3IGRA 4P6YA 4JVVA 1M4LA 2Z0ZA 5C88A 2XEIA 2PIZA 4CYQA 2EK8A 2YNDA 3IIDA 1VHEA 1UWYA 4ETJA 4ZYQA 1LAMA 4HNXB 3E0KA 4MBUA 2DX6A 4A30A 3D3SA 1JQGA 3K9TA 1CX8A 4UEZA 4UIBA 1YSJA 4OADA 1ON0A 1N71A 4XPDB 5G21A 2B5GB 2ZEPA 2ZELA 1BLLE 5G20A 4KUAA 1X12A 1ZR3A 1KZFA 2EO8A 4P4FA 5G22A 2X7BA 4LUAA 2ZW4A 1YR0A 2G3TA 2POKA 3PFOA 4YFJA 4PXBA 4UMLA 2G0BA 4UCMA 4R9MA 3FMCA 1AUGA 4K3NA 1YW6A 2VZYA 2B58A 3GUXA 5LYDA 2I3CA 4PXEA 2IQ6A 2PJAA 3IFEA 3QAYA 3LMSA 3FVLA 4J5SA 2GIVA 1LFWA 1RO5A 1S5KA 3KHZA 4M6IA 5FVJA 3TOBA 3TX8A 3EWRA 1YREA 2QECA 4F8ZA 1ARMA 2AFZA 8CPAA 5F48A 2HQYA 1CPSA 4U9YA 4KOUA 3ZJ0A 2REFA 3I1UA 2B3VA 3PRTA 3SJGA 1LOKA 1TF8A 4A32A 4R6TA 3V8IA 3TO6A 4IQYA 2PJ3A 2PIYA 3MRUA 3JUWA 2J8RA 4KOXA 4KZTA 4TNUA 4A31A 1Q2DA 2ARHA 4OC0A 3HUVA 4QBJA 5IX3A 5CPAA 2Q4ZA 1M44A 4KOTA 2R7HA 4Y49B 4ZY2A 5HXDA 1RXTA 1XMBA 3K9UA 3IIFA 2V8HA 4R7MA 1YGHA 3TO9A 4AVBA 3RAMA 4C2XA 3P2HA 2DF5A 1NJRA 1CM0A 4KVXA 4UEFA 4O23A 1XOVA 4B12A 4A39A 3EJGA 2Z3PA 2ZEFA 3B3WA 3D4UA 2C1CA 4W9YA 5LYLA 4OC5A 5J8FA 1YMEA 2GLJA 1NSAA 4A95A 3H8FA 4JXQA 4CGOA 2VQYA 3EKEA 2PJ9A 3DLJA 4F0YA 3P2FA 1DTDA 2ACFA 2D4PA 2OZUA 5HVFA 2WPWA 4NCZA 3FJUA 5JQ4A 3NFZA 1XBUA 5JPHA 3PP9A 4F9VA 3NE8A 3FX6A 3FECA 4B14A 1KUVA 2GLFA 2ZEGA 4WWVA 4DJLA 2VXKA 2RNKA 4E8OA 3SHPA 5HOLA 4MFJA 4M85A 2IJZA 3NH5A 3RBUA 1QSOA 4X8IA 2PE3A 3GQEA 2OZGA 4P45A 4NGNA 3FXTA 4PV6A 2OR4A 4B6ZA 4M3SA 3S6HA 4B5PA 1U6MA 5HMNA 3RYOA 2AFMA 4H6ZA 3TCVA 2C6PA 4JWPA 3WC7A 4FUUA 1B87A 4K30A 3PBEA 4GM5A 2ZXVA 4JJXA 1NMTA 3TOAA 2QMLA 3TT2A 3ZZIA 4U9ZA 3T9YA 4FAIA 3TO7A 3CXQA 2AFCA 3H8GA 3EXNA 3F8KA 4FWUA 1QSRA 4D86A 4PSXA 4PXDA 2C6GA 3BLNA 4IAVA 3JZTA 3R9GA 2V77A 1MJ9A 4CGMA 4CRZB 2CNSA 3WR7A 3KQZA 3SIJA 1KWMA 2IL4A 2PVVA 4CGLA 1F2PA 1TKJA 3IWEA 2P0WA 4P4IA 4C2ZA 4TU0A 1YLEA 2C27A 3R96A 2HB6A 3EY5A 3GPQA 2VI7A 4MFPA 5ELYA 3VARA 3A9LA 2PJ6A 3B7IA 3Q71A 4Q38A 1S7NA 4PXCA 1Z4EA 2J9AA 3GKRA 3SJEA 4YRHA 2CTBA 2F7VA 4FD5A 4C7IA 1CP7A 3EW5A 2PRQA 4UWIA 1YVKA 3D7DA 2JZEA 4L8AA 1Z2LA 2PJBA 3CXPA 4BD9A 2JDCA 4FD6A 3N5FA 4KUBA 4NGTA 3R95A 3V7ZA 4A37A 5LRKA 3S9NA 4ZY0A 1S7KA 4MCRA 1LCPA 2BFRA 1ARLA 4GVWA 4UBRA 3GPGA 4C2YA 4NSQA 3TFYA 3JRUA 4H2KA 2OOTA 3IC1A 1YQEA 3GIUA 4B11A 4F0XA 3NH4A 3CT9A 1Z4RA 1Y0YA 2Z3OA 3CPXA 4MHPA 4JCAA 3KI9A 1F57A 1IOIA 2FL4A 2VBQA 1HDUA 1AYEA 1XF8A 4IK2A 3V45A 4II9A 5JM6A 4FD4A 5KTAA 3R9FA 1IY7A 1VIXA 1OBRA 1ZO0A 2ZEEA 4Z65A 3DSBA 2PJ4A 5I4MA 2EK9A 2R98A 3DDDA 1NE9A 1M1DA 5FSZA 1B6BA 1I1DA 2EUIA 2OH1A 2QIRA 2RB7A 4OC1A 5A28A 3EWQA 1BPMA 1Z8LA 5AG7A 3PB6X 4MHYA 4KVME 2AFOA 4XPLA 2V8DA 4R57A 4R3LA 4UF4A 2F8HA 3BJ7A 3PB8X 1QSNA 4YU9A 5ISVA 2ZW7A 2KQVA 3B3SA 4MMOA 3PGPA 4OC3A 1Y7EA 3F5BA 2G9DA 3EFAA 5F49A 4BINA 2JEVA 2PQ8A 3KR5A 2J8MA 3KKWA 4BBHA 3IWWA 4CYPA 5K8PA 2P6EA 3K2KA 5AG6A 1XFOA 4JZ0A 2BEIA 1F2OA 2Z3KA 5HIHA 2JBKA 2Q04A 1ELLP 1PCAA 4KSAA 4NGQA 2ZPAA 1FY7A 1M4DA 3FEEA 4RI1A 4PQAA 4RN7A 3IEHA 4J3GA 4WJBA 4ONWA 4UFWA 5DWNA 2Q7BA 3HLPA 2YGWA 2PCUA 1QSTA 4H6UA 3CPAA 2VRIA 1Z5RA 3I3GA 5E96A 2WUUA 4CGPA 2PRBA 3SJFA 4F9UA 1I21A 2FVGA 4YGOA 3B3TA 3Q6ZA 3D7GA 4FD7A 4XPDC 4MHDA 4B13A 4NJRA 4ONUA 1UFHA 3D7FA 1BPNA 1BAVA 2NYQA 1WK4A 2B3UA 2V8GA 2REEA 1Y9WA 2QVPA 3D8PA 3PEIA 4B5PB 4MY3A 1HDQA 3FB3A 5CMSA 1Z9UA 2FSRA 2Z3MA 2PJ2A 5J8CA 4J4ZA 3TTHA 2Z11A 2NSMA 2W2GA 1EE3P 2L8RA 2RC4A 4KOWA 4JD6A 5JH9A 4HPSA 2Q51A 1HJZA 4MI4A 4A38A 3SIIA 1ZG9A 1Q2CA 4R8FA 3DR8A 3TC8A 2I79A 3V2BA 5E3BA 1TXZA 1K4JA 2Z10A 2VL1A 4L89A 2GANA 4QVTA 4B10A 4X5KA 3SI2A 4A2ZA 4DNCA 1S7LA 4CAWA 2KCWA 2Q7SA 4G1PA 2ZEDA 4IHMA 4NGSA 4KYBA 4OC4A 4R87A 5IB0A 1KUYA 3FIXA 1PU9A 3D67A 1FT7A 1LRZA 1YW4A 4KOSA 4R3KA 1QQ9A 2ZW5A 4GS4A 2FT0A 4XNHB 3RO0A 3RZAA 2R8VA 3SI1A 4IF5A 2FXFA 3DNSA 4P4DA 4Q7AA 5FSUA 3MGDA 4Y49C 1ELMP 2PC1A 1NSLA 1GHEA 4P4JA 3JVNA 2ANPA 5D8NA 4NXYA 3SI0A 1Q2YA 4A33A 4J5QA 3FYNA 5G1ZA 3S6GA 4OIWA 2DXQA 3NA6A 4P44A 4CYNA 4ZX8A 4QC6A 2BCOA 1A2ZA 3GPOA 5DUSA 2EVNA 2YNCC 4JLYA 2XD7A 2FE7A 4CGNA 1GYTA 1CP6A 4HKFA 3SIGA 2JDDA 4YWYA 1Y9KA 1ZR5A 3B3VA 1ZLIA 3GLJA 5D29A 2FIWA 4RUHA 3N7ZA 3H4QA 2A4NA 2Z3NA 3GY9A 3PBBA 3R1KA 4AG9A 5CNPA 4RS2A 4KS9A 5BWAB 4DUKA 3IU2A 4E2AA 1S3ZA 4M6GA 3GQOA 1MJBA 2PR8A 4GUAA 7CPAA 2FAVA 3VFQA 2PVWA 1YLOA 3B35A 1S60A 2BFQA 2Q43A 4PK3A 4UWJA 4CS0B 1YD9A 3B3CA 2WCTA 3VWDA 3FF3A 4KSIA 3LODA 4NFRA 1YK3A 3T90A 2PJCA 5CBMA 2AFWA 5LYIA 1YX0A 2AFSA 2BOAA 2DPSA 1Q7LA 1YVOA 4ZBGA 1CPXA 2ZW6A 3EC4A 2BO9A 2HV2A 1XE4A 4J5RA 5H86A 4FBEA 5A27A 5EC4A 1V0CA 1P0HA 2CF4A 3D68A 4QB9A 4NGMA 3PB4X 4NGRA 4PSWA 3BI1A 3KL9A 3LWUA 3G8WA 4AVAA 2WYRA 4EVYA 3G3SA 2FXKA 2BUEA 1DE4C 2J8NA 3I9SA 2B4DA 1CJWA 3KASA 3WC6A 2ZEMA 4MFZA 5IV0A 3BXMA 5K8OA 5J1QA 1IICA 5IB9A 3V38A 5AILA 1AMPA 2EEEA 1TF9A 4P4EA 4ZGYB 5F46A 4H89A 4Q36A 3DR6A 2QYVA 2OU2A 1CBXA 3PZJA 4JYWA 4ABKA 4KSFA 1H8LA 1M4IA 4TWEA 1LAPA 3W6XA 1TIQA 4CYOA 4OC2A 2LGRA 4MFKA 4NGPA 4CAEA 5C82A 1ZLHA 1JWQA 3NE7A 4NJQA 4ESSA 4IUSA 2V8VA 3B8GA 4GVVA 4XPKA 1XJOA 2HC9A 2XEGA 1BO4A 3QNVA 3CDXA 4LQGA 5KTCA 1Z8TA 1WWZA 3EWPA 4KLWA 1MJAA 5EBVA 4A94A 2R1IA 2AFXA 5AGEA 2P6GA 4C7HA 4ETKA 3BI0A 1Y7RA 3KGQA 2Q44A 3LACA 2CNTA 2JZFA 3MN8A 4UFVA 2XEFA 3WABA 2GREA 3QB8A 4OP4A 1S7FA 3PFEA 4MCPA 5HVHA 4NF1A 1X10A 5LYFA 1MK4A 2PSWA 3ETIA 1R57A 3VH9A 5F47A 5LRGA 2Q4YA 3KHXA 2EWBA 2DPTA 3KQXA 1R43A 1LANA 3DGVA 1IB1E 5CB3A 3FRMA 4OAEA 3JTKA 3SXOA 1OZPA 4MJ8A 4K0CA 4EFDA 4I49A 3IO1A 1P4NA 2GU2A 3S6KA 1VHUA 3PB7X 1TXRA 2B5GA 1IIDA 5AG4A 1IYLA 4ZI6A 3GYAA 2WSAA 4ZX9A 2IMOA 3IU1A 2ODFA 1QSMA 1RTQA 3KR4A 2CIJA 2NMTA 4OLLA 2PDOA 3EO4A 3BJ8A 2EBJA 2D4OA 3SIHA 2ZOGA 2PJ7A 5THWA 3W91A 2AJ6A 4LQ6A 4JLLA 4U5YA 5DS0A 3WT4A 5AG5A 2Y0MA 2C6CA 1FNOA 4OIDA 4MFQA 2CXAA 2RFHA 1PUAA 3BHXA 4R76A 3CZXA 4LX9A 1J4JA 1XRYA 2FCKA 4KOVA 1Z8XA 1KUXA 3UY5A 4B5OA 5GCNA 3RNZA 2FIAA 5KTDA 3ISZA 4KVOE 3VATA 2GE3A 3D2MA 4ORFA 4E0AA 3KZWA 4UCPA 3SJXA 3D2PA 1ZG8A 5F09A 2H5MA 1VHSA 4OMEA 4QUSA 4ZY1A 3W6SA 5HVGA 3D66A 4AXVA 3B2YA 4AVCA 4CRYB 4X2TA 4UIAA 3IIBA 3S6FA 4AG7A 4CPAA 3H8EA 2PJ8A 2VEZA 1TY8A 2QJ8A 2OZHA 4MRIA 2GFQA 3ISXA 4EMEA 1SPVA 3L2NA 3EWOA 4CAXA 4MY0A 5HH1A 5I0CA 6CPAA 2AFUA 4KLVA 2P6FA 3T8WA 5K8NA 4P4BA 4MXUA 4P10A 5FSYA 2JEWA 3IWGA 1IU8A 2OB0A 2YNCA 5CB5A 3LD2A 5LRJA 3R9EA 2ZEOA 1I12A 4AB7A 4UEEA 4UCNA 3IJ3A 4UA3A 2FG1A 2DEAA 1TKHA 2O4HA 2ZENA 4PK2A 2PR1A 4DYOA 1CG2A 4KORA 5H84A 1Z8WA 4MCSA 3VWEA 4EWTA 2Z3LA 3PB9X 2ZOFA 4F6AA 2X47A 3FEDA 1VKCA 2PJ0A 4GXHA 3GB0A 3TE4A 3OWCA 1SQHA 4MCQA 4CAVA 2B4BA 2B4DB 2YNEA 3S9LA 4HNWB 2BL1A 2XEJA 3S9MA 2JZDA 1IGBA 2O28A 3FH4A 5EMIA 3FNCA 1TKFA 1IYKA 2O53A 2WPXA 1R3NA 4MFLA 4NEXA 3WC5A 5FSVA 2FS5A 2ZEHA 4UFXA 5K8MA 2K5TA 3SXNA 4BMHA 1M4GA 2JBJA 2AE6A 4ABLA 1IOFA 4XNHC 1L0CA
chains in the Genus database with same CATH topology
1HEEA 4OKOA 2PJ1A 3D7HA 4X3RA 2WZNA 1PYTB 4JGKA 5JGFA 4MHNA 5FSXA 3NH8A 2ABZA 1Y0RA 1ZG7A 3EJFA 1QMUA 4MHZA 4PPZA 1VHOA 2CTCA 1VGYA 2PJ5A 4R8FA 5K8PA 4P6YA 4JVVA 1M4LA 2XEIA 2PIZA 2EK8A 3IIDA 1VHEA 1UWYA 4ETJA 4ZYQA 1LAMA 2DX6A 1JQGA 3K9TA 1CX8A 4UEZA 4UIBA 1YSJA 2ZEPA 2ZELA 1BLLE 1ZR3A 4P4FA 2POKA 3PFOA 4PXBA 4UMLA 3FMCA 4K3NA 1YW6A 3GUXA 5LYDA 2I3CA 4PXEA 2IQ6A 2PJAA 3IFEA 3LMSA 3FVLA 4J5SA 1LFWA 3KHZA 3TX8A 8CPAA 4F8ZA 3EWRA 1ARMA 2AFZA 1CPSA 3I1UA 3PRTA 3SJGA 1LOKA 1TF8A 4R6TA 4IQYA 2PJ3A 2PIYA 3MRUA 4TNUA 4OC0A 3HUVA 5CPAA 2Q4ZA 4ZY2A 5HXDA 1XMBA 3IIFA 2V8HA 4R7MA 3RAMA 1NJRA 4UEFA 4O23A 4A39A 3EJGA 3B3WA 2ZEFA 3D4UA 2C1CA 4W9YA 5LYLA 4OC5A 1YMEA 2GLJA 1NSAA 3H8FA 3EKEA 2PJ9A 3DLJA 1DTDA 2ACFA 5HVFA 3FJUA 3NFZA 1XBUA 4F9VA 3FX6A 3FECA 2GLFA 2ZEGA 4WWVA 4DJLA 5HOLA 3RBUA 2IJZA 3NH5A 4X8IA 2PE3A 3GQEA 4P45A 4NGNA 2OR4A 4B6ZA 2AFMA 2C6PA 3WC7A 4FUUA 3PBEA 4GM5A 4FAIA 2AFCA 3H8GA 4FWUA 4D86A 4PXDA 2C6GA 4IAVA 3JZTA 2V77A 3KQZA 3SIJA 1KWMA 2PVVA 1F2PA 1TKJA 4P4IA 4TU0A 2HB6A 3GPQA 3VARA 5ELYA 2PJ6A 3B7IA 3Q71A 4PXCA 2J9AA 3SJEA 2CTBA 2F7VA 1CP7A 3EW5A 2PRQA 3D7DA 1Z2LA 2PJBA 4BD9A 3N5FA 3V7ZA 4NGTA 4A37A 5LRKA 3S9NA 4ZY0A 4MCRA 1LCPA 2BFRA 1ARLA 4GVWA 3GPGA 3JRUA 4H2KA 2OOTA 3IC1A 3NH4A 3CT9A 1Y0YA 3CPXA 4MHPA 4JCAA 3KI9A 1F57A 1HDUA 1AYEA 4IK2A 3V45A 5JM6A 1IY7A 1VIXA 1OBRA 2ZEEA 4Z65A 5I4MA 2PJ4A 2EK9A 5FSZA 4OC1A 2RB7A 3EWQA 1BPMA 1Z8LA 3PB6X 4MHYA 2AFOA 2V8DA 4UF4A 2F8HA 3PB8X 4YU9A 3B3SA 4MMOA 4OC3A 1Y7EA 2G9DA 3KR5A 3IWWA 3K2KA 1XFOA 4JZ0A 1F2OA 5HIHA 2JBKA 1ELLP 1PCAA 4NGQA 3FEEA 4PQAA 3IEHA 4WJBA 4ONWA 3HLPA 2PCUA 3CPAA 2VRIA 1Z5RA 4F9UA 3SJFA 2FVGA 3B3TA 3Q6ZA 3D7GA 4NJRA 3D7FA 1BPNA 1BAVA 2NYQA 2V8GA 2QVPA 3PEIA 1HDQA 5CMSA 2PJ2A 4J4ZA 2NSMA 1EE3P 2L8RA 5JH9A 2Q51A 1HJZA 4A38A 3SIIA 1ZG9A 3TC8A 3V2BA 5E3BA 1TXZA 2VL1A 3SI2A 4G1PA 2ZEDA 4IHMA 4NGSA 4KYBA 4OC4A 3D67A 1FT7A 1YW4A 1QQ9A 3RZAA 3SI1A 4P4DA 4Q7AA 5FSUA 1ELMP 4P4JA 2ANPA 5D8NA 3SI0A 4J5QA 4OIWA 3NA6A 4P44A 4ZX8A 2BCOA 3GPOA 5DUSA 2XD7A 1GYTA 1CP6A 3SIGA 4YWYA 1ZR5A 3B3VA 1ZLIA 3GLJA 5D29A 4RUHA 3PBBA 4DUKA 3GQOA 4GUAA 7CPAA 2FAVA 3VFQA 2PVWA 1YLOA 3B35A 2BFQA 2Q43A 1YD9A 3B3CA 3FF3A 4KSIA 4NFRA 2PJCA 5CBMA 2AFWA 5LYIA 2AFSA 2BOAA 1Q7LA 1CPXA 2BO9A 4J5RA 4FBEA 2CF4A 3D68A 4NGMA 3PB4X 4NGRA 3BI1A 3KL9A 3LWUA 2WYRA 2FXKA 1DE4C 3KASA 5J1QA 3WC6A 2ZEMA 3BXMA 5K8OA 5IB9A 3V38A 5AILA 1AMPA 2EEEA 1TF9A 4P4EA 2QYVA 1CBXA 4JYWA 4ABKA 1H8LA 4TWEA 1LAPA 4OC2A 2LGRA 4NGPA 1ZLHA 4NJQA 4ESSA 2V8VA 4GVVA 1XJOA 2HC9A 2XEGA 3QNVA 3CDXA 4LQGA 3EWPA 4A94A 2AFXA 4ETKA 3BI0A 3KGQA 3MN8A 3WABA 2XEFA 2GREA 4OP4A 5HVHA 3PFEA 4MCPA 5LYFA 3ETIA 3VH9A 5LRGA 3KHXA 2EWBA 3KQXA 1R43A 1LANA 3DGVA 5CB3A 4EFDA 4K0CA 3IO1A 2GU2A 1VHUA 3PB7X 1TXRA 4ZI6A 4ZX9A 2IMOA 1RTQA 3KR4A 2CIJA 2ZOGA 3SIHA 2PJ7A 5THWA 4JLLA 3WT4A 5DS0A 2C6CA 1FNOA 4OIDA 2RFHA 3BHXA 4R76A 1XRYA 3ISZA 3VATA 3KZWA 3SJXA 1ZG8A 5F09A 4OMEA 5HVGA 4ZY1A 3D66A 4AXVA 3B2YA 4X2TA 4UIAA 3IIBA 4CPAA 3H8EA 2PJ8A 1TY8A 2QJ8A 4MRIA 3ISXA 4EMEA 1SPVA 3L2NA 3EWOA 6CPAA 2AFUA 3T8WA 5K8NA 4P4BA 4MXUA 4P10A 5FSYA 2JEWA 5LRJA 5CB5A 2ZEOA 4UEEA 3IJ3A 2FG1A 2DEAA 1TKHA 2O4HA 2ZENA 4DYOA 1CG2A 4MCSA 4EWTA 3PB9X 2ZOFA 2X47A 3FEDA 2PJ0A 3GB0A 4MCQA 3S9LA 2XEJA 3S9MA 1IGBA 3FH4A 1TKFA 2O53A 1R3NA 3WC5A 5K8MA 5FSVA 2ZEHA 2JBJA 4ABLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEE A;  4OKO A;  2PJ1 A;  3D7H A;  4X3R A;  2WZN A;  1PYT B;  4JGK A;  5JGF A;  4MHN A;  5FSX A;  3NH8 A;  2ABZ A;  1Y0R A;  1ZG7 A;  3EJF A;  1QMU A;  4MHZ A;  4PPZ A;  1VHO A;  2CTC A;  1VGY A;  2PJ5 A;  4R8F A;  5K8P A;  4P6Y A;  4JVV A;  1M4L A;  2XEI A;  2PIZ A;  2EK8 A;  3IID A;  1VHE A;  1UWY A;  4ETJ A;  4ZYQ A;  1LAM A;  2DX6 A;  1JQG A;  3K9T A;  1CX8 A;  4UEZ A;  4UIB A;  1YSJ A;  2ZEP A;  2ZEL A;  1BLL E;  1ZR3 A;  4P4F A;  2POK A;  3PFO A;  4PXB A;  4UML A;  3FMC A;  4K3N A;  1YW6 A;  3GUX A;  5LYD A;  2I3C A;  4PXE A;  2IQ6 A;  2PJA A;  3IFE A;  3LMS A;  3FVL A;  4J5S A;  1LFW A;  3KHZ A;  3TX8 A;  8CPA A;  4F8Z A;  3EWR A;  1ARM A;  2AFZ A;  1CPS A;  3I1U A;  3PRT A;  3SJG A;  1LOK A;  1TF8 A;  4R6T A;  4IQY A;  2PJ3 A;  2PIY A;  3MRU A;  4TNU A;  4OC0 A;  3HUV A;  5CPA A;  2Q4Z A;  4ZY2 A;  5HXD A;  1XMB A;  3IIF A;  2V8H A;  4R7M A;  3RAM A;  1NJR A;  4UEF A;  4O23 A;  4A39 A;  3EJG A;  3B3W A;  2ZEF A;  3D4U A;  2C1C A;  4W9Y A;  5LYL A;  4OC5 A;  1YME A;  2GLJ A;  1NSA A;  3H8F A;  3EKE A;  2PJ9 A;  3DLJ A;  1DTD A;  2ACF A;  5HVF A;  3FJU A;  3NFZ A;  1XBU A;  4F9V A;  3FX6 A;  3FEC A;  2GLF A;  2ZEG A;  4WWV A;  4DJL A;  5HOL A;  3RBU A;  2IJZ A;  3NH5 A;  4X8I A;  2PE3 A;  3GQE A;  4P45 A;  4NGN A;  2OR4 A;  4B6Z A;  2AFM A;  2C6P A;  3WC7 A;  4FUU A;  3PBE A;  4GM5 A;  4FAI A;  2AFC A;  3H8G A;  4FWU A;  4D86 A;  4PXD A;  2C6G A;  4IAV A;  3JZT A;  2V77 A;  3KQZ A;  3SIJ A;  1KWM A;  2PVV A;  1F2P A;  1TKJ A;  4P4I A;  4TU0 A;  2HB6 A;  3GPQ A;  3VAR A;  5ELY A;  2PJ6 A;  3B7I A;  3Q71 A;  4PXC A;  2J9A A;  3SJE A;  2CTB A;  2F7V A;  1CP7 A;  3EW5 A;  2PRQ A;  3D7D A;  1Z2L A;  2PJB A;  4BD9 A;  3N5F A;  3V7Z A;  4NGT A;  4A37 A;  5LRK A;  3S9N A;  4ZY0 A;  4MCR A;  1LCP A;  2BFR A;  1ARL A;  4GVW A;  3GPG A;  3JRU A;  4H2K A;  2OOT A;  3IC1 A;  3NH4 A;  3CT9 A;  1Y0Y A;  3CPX A;  4MHP A;  4JCA A;  3KI9 A;  1F57 A;  1HDU A;  1AYE A;  4IK2 A;  3V45 A;  5JM6 A;  1IY7 A;  1VIX A;  1OBR A;  2ZEE A;  4Z65 A;  5I4M A;  2PJ4 A;  2EK9 A;  5FSZ A;  4OC1 A;  2RB7 A;  3EWQ A;  1BPM A;  1Z8L A;  3PB6 X;  4MHY A;  2AFO A;  2V8D A;  4UF4 A;  2F8H A;  3PB8 X;  4YU9 A;  3B3S A;  4MMO A;  4OC3 A;  1Y7E A;  2G9D A;  3KR5 A;  3IWW A;  3K2K A;  1XFO A;  4JZ0 A;  1F2O A;  5HIH A;  2JBK A;  1ELL P;  1PCA A;  4NGQ A;  3FEE A;  4PQA A;  3IEH A;  4WJB A;  4ONW A;  3HLP A;  2PCU A;  3CPA A;  2VRI A;  1Z5R A;  4F9U A;  3SJF A;  2FVG A;  3B3T A;  3Q6Z A;  3D7G A;  4NJR A;  3D7F A;  1BPN A;  1BAV A;  2NYQ A;  2V8G A;  2QVP A;  3PEI A;  1HDQ A;  5CMS A;  2PJ2 A;  4J4Z A;  2NSM A;  1EE3 P;  2L8R A;  5JH9 A;  2Q51 A;  1HJZ A;  4A38 A;  3SII A;  1ZG9 A;  3TC8 A;  3V2B A;  5E3B A;  1TXZ A;  2VL1 A;  3SI2 A;  4G1P A;  2ZED A;  4IHM A;  4NGS A;  4KYB A;  4OC4 A;  3D67 A;  1FT7 A;  1YW4 A;  1QQ9 A;  3RZA A;  3SI1 A;  4P4D A;  4Q7A A;  5FSU A;  1ELM P;  4P4J A;  2ANP A;  5D8N A;  3SI0 A;  4J5Q A;  4OIW A;  3NA6 A;  4P44 A;  4ZX8 A;  2BCO A;  3GPO A;  5DUS A;  2XD7 A;  1GYT A;  1CP6 A;  3SIG A;  4YWY A;  1ZR5 A;  3B3V A;  1ZLI A;  3GLJ A;  5D29 A;  4RUH A;  3PBB A;  4DUK A;  3GQO A;  4GUA A;  7CPA A;  2FAV A;  3VFQ A;  2PVW A;  1YLO A;  3B35 A;  2BFQ A;  2Q43 A;  1YD9 A;  3B3C A;  3FF3 A;  4KSI A;  4NFR A;  2PJC A;  5CBM A;  2AFW A;  5LYI A;  2AFS A;  2BOA A;  1Q7L A;  1CPX A;  2BO9 A;  4J5R A;  4FBE A;  2CF4 A;  3D68 A;  4NGM A;  3PB4 X;  4NGR A;  3BI1 A;  3KL9 A;  3LWU A;  2WYR A;  2FXK A;  1DE4 C;  3KAS A;  5J1Q A;  3WC6 A;  2ZEM A;  3BXM A;  5K8O A;  5IB9 A;  3V38 A;  5AIL A;  1AMP A;  2EEE A;  1TF9 A;  4P4E A;  2QYV A;  1CBX A;  4JYW A;  4ABK A;  1H8L A;  4TWE A;  1LAP A;  4OC2 A;  2LGR A;  4NGP A;  1ZLH A;  4NJQ A;  4ESS A;  2V8V A;  4GVV A;  1XJO A;  2HC9 A;  2XEG A;  3QNV A;  3CDX A;  4LQG A;  3EWP A;  4A94 A;  2AFX A;  4ETK A;  3BI0 A;  3KGQ A;  3MN8 A;  3WAB A;  2XEF A;  2GRE A;  4OP4 A;  5HVH A;  3PFE A;  4MCP A;  5LYF A;  3ETI A;  3VH9 A;  5LRG A;  3KHX A;  2EWB A;  3KQX A;  1R43 A;  1LAN A;  3DGV A;  5CB3 A;  4EFD A;  4K0C A;  3IO1 A;  2GU2 A;  1VHU A;  3PB7 X;  1TXR A;  4ZI6 A;  4ZX9 A;  2IMO A;  1RTQ A;  3KR4 A;  2CIJ A;  2ZOG A;  3SIH A;  2PJ7 A;  5THW A;  4JLL A;  3WT4 A;  5DS0 A;  2C6C A;  1FNO A;  4OID A;  2RFH A;  3BHX A;  4R76 A;  1XRY A;  3ISZ A;  3VAT A;  3KZW A;  3SJX A;  1ZG8 A;  5F09 A;  4OME A;  5HVG A;  4ZY1 A;  3D66 A;  4AXV A;  3B2Y A;  4X2T A;  4UIA A;  3IIB A;  4CPA A;  3H8E A;  2PJ8 A;  1TY8 A;  2QJ8 A;  4MRI A;  3ISX A;  4EME A;  1SPV A;  3L2N A;  3EWO A;  6CPA A;  2AFU A;  3T8W A;  5K8N A;  4P4B A;  4MXU A;  4P10 A;  5FSY A;  2JEW A;  5LRJ A;  5CB5 A;  2ZEO A;  4UEE A;  3IJ3 A;  2FG1 A;  2DEA A;  1TKH A;  2O4H A;  2ZEN A;  4DYO A;  1CG2 A;  4MCS A;  4EWT A;  3PB9 X;  2ZOF A;  2X47 A;  3FED A;  2PJ0 A;  3GB0 A;  4MCQ A;  3S9L A;  2XEJ A;  3S9M A;  1IGB A;  3FH4 A;  1TKF A;  2O53 A;  1R3N A;  3WC5 A;  5K8M A;  5FSV A;  2ZEH A;  2JBJ A;  4ABL A; 
#chains in the Genus database with same CATH topology
 3CXS A;  1HEE A;  4OKO A;  2PJ1 A;  3D7H A;  4M6H A;  4X3R A;  2JLM A;  1XMT A;  2WZN A;  1PYT B;  2HUZ A;  3QAH A;  1XEB A;  3H5Z A;  4JGK A;  5JGF A;  4MHN A;  2CY2 A;  5FSX A;  1BOB A;  3NH8 A;  3FBU A;  3C26 A;  2ABZ A;  1Y0R A;  1ZG7 A;  4KOY A;  2BSW A;  5DWM A;  4CAF A;  3EJF A;  1QMU A;  4MHZ A;  4PPZ A;  1VHO A;  2ATR A;  2Q4V A;  2VZZ A;  2CTC A;  2CNM A;  2I00 A;  4HNY B;  3F0A A;  1VGY A;  2PJ5 A;  4C68 A;  2F5I A;  1XIX A;  4JXR A;  2Q0Y A;  2G3A A;  3IGR A;  4P6Y A;  4JVV A;  1M4L A;  2Z0Z A;  5C88 A;  2XEI A;  2PIZ A;  4CYQ A;  2EK8 A;  2YND A;  3IID A;  1VHE A;  1UWY A;  4ETJ A;  4ZYQ A;  1LAM A;  4HNX B;  3E0K A;  4MBU A;  2DX6 A;  4A30 A;  3D3S A;  1JQG A;  3K9T A;  1CX8 A;  4UEZ A;  4UIB A;  1YSJ A;  4OAD A;  1ON0 A;  1N71 A;  4XPD B;  5G21 A;  2B5G B;  2ZEP A;  2ZEL A;  1BLL E;  5G20 A;  4KUA A;  1X12 A;  1ZR3 A;  1KZF A;  2EO8 A;  4P4F A;  5G22 A;  2X7B A;  4LUA A;  2ZW4 A;  1YR0 A;  2G3T A;  2POK A;  3PFO A;  4YFJ A;  4PXB A;  4UML A;  2G0B A;  4UCM A;  4R9M A;  3FMC A;  1AUG A;  4K3N A;  1YW6 A;  2VZY A;  2B58 A;  3GUX A;  5LYD A;  2I3C A;  4PXE A;  2IQ6 A;  2PJA A;  3IFE A;  3QAY A;  3LMS A;  3FVL A;  4J5S A;  2GIV A;  1LFW A;  1RO5 A;  1S5K A;  3KHZ A;  4M6I A;  5FVJ A;  3TOB A;  3TX8 A;  3EWR A;  1YRE A;  2QEC A;  4F8Z A;  1ARM A;  2AFZ A;  8CPA A;  5F48 A;  2HQY A;  1CPS A;  4U9Y A;  4KOU A;  3ZJ0 A;  2REF A;  3I1U A;  2B3V A;  3PRT A;  3SJG A;  1LOK A;  1TF8 A;  4A32 A;  4R6T A;  3V8I A;  3TO6 A;  4IQY A;  2PJ3 A;  2PIY A;  3MRU A;  3JUW A;  2J8R A;  4KOX A;  4KZT A;  4TNU A;  4A31 A;  1Q2D A;  2ARH A;  4OC0 A;  3HUV A;  4QBJ A;  5IX3 A;  5CPA A;  2Q4Z A;  1M44 A;  4KOT A;  2R7H A;  4Y49 B;  4ZY2 A;  5HXD A;  1RXT A;  1XMB A;  3K9U A;  3IIF A;  2V8H A;  4R7M A;  1YGH A;  3TO9 A;  4AVB A;  3RAM A;  4C2X A;  3P2H A;  2DF5 A;  1NJR A;  1CM0 A;  4KVX A;  4UEF A;  4O23 A;  1XOV A;  4B12 A;  4A39 A;  3EJG A;  2Z3P A;  2ZEF A;  3B3W A;  3D4U A;  2C1C A;  4W9Y A;  5LYL A;  4OC5 A;  5J8F A;  1YME A;  2GLJ A;  1NSA A;  4A95 A;  3H8F A;  4JXQ A;  4CGO A;  2VQY A;  3EKE A;  2PJ9 A;  3DLJ A;  4F0Y A;  3P2F A;  1DTD A;  2ACF A;  2D4P A;  2OZU A;  5HVF A;  2WPW A;  4NCZ A;  3FJU A;  5JQ4 A;  3NFZ A;  1XBU A;  5JPH A;  3PP9 A;  4F9V A;  3NE8 A;  3FX6 A;  3FEC A;  4B14 A;  1KUV A;  2GLF A;  2ZEG A;  4WWV A;  4DJL A;  2VXK A;  2RNK A;  4E8O A;  3SHP A;  5HOL A;  4MFJ A;  4M85 A;  2IJZ A;  3NH5 A;  3RBU A;  1QSO A;  4X8I A;  2PE3 A;  3GQE A;  2OZG A;  4P45 A;  4NGN A;  3FXT A;  4PV6 A;  2OR4 A;  4B6Z A;  4M3S A;  3S6H A;  4B5P A;  1U6M A;  5HMN A;  3RYO A;  2AFM A;  4H6Z A;  3TCV A;  2C6P A;  4JWP A;  3WC7 A;  4FUU A;  1B87 A;  4K30 A;  3PBE A;  4GM5 A;  2ZXV A;  4JJX A;  1NMT A;  3TOA A;  2QML A;  3TT2 A;  3ZZI A;  4U9Z A;  3T9Y A;  4FAI A;  3TO7 A;  3CXQ A;  2AFC A;  3H8G A;  3EXN A;  3F8K A;  4FWU A;  1QSR A;  4D86 A;  4PSX A;  4PXD A;  2C6G A;  3BLN A;  4IAV A;  3JZT A;  3R9G A;  2V77 A;  1MJ9 A;  4CGM A;  4CRZ B;  2CNS A;  3WR7 A;  3KQZ A;  3SIJ A;  1KWM A;  2IL4 A;  2PVV A;  4CGL A;  1F2P A;  1TKJ A;  3IWE A;  2P0W A;  4P4I A;  4C2Z A;  4TU0 A;  1YLE A;  2C27 A;  3R96 A;  2HB6 A;  3EY5 A;  3GPQ A;  2VI7 A;  4MFP A;  5ELY A;  3VAR A;  3A9L A;  2PJ6 A;  3B7I A;  3Q71 A;  4Q38 A;  1S7N A;  4PXC A;  1Z4E A;  2J9A A;  3GKR A;  3SJE A;  4YRH A;  2CTB A;  2F7V A;  4FD5 A;  4C7I A;  1CP7 A;  3EW5 A;  2PRQ A;  4UWI A;  1YVK A;  3D7D A;  2JZE A;  4L8A A;  1Z2L A;  2PJB A;  3CXP A;  4BD9 A;  2JDC A;  4FD6 A;  3N5F A;  4KUB A;  4NGT A;  3R95 A;  3V7Z A;  4A37 A;  5LRK A;  3S9N A;  4ZY0 A;  1S7K A;  4MCR A;  1LCP A;  2BFR A;  1ARL A;  4GVW A;  4UBR A;  3GPG A;  4C2Y A;  4NSQ A;  3TFY A;  3JRU A;  4H2K A;  2OOT A;  3IC1 A;  1YQE A;  3GIU A;  4B11 A;  4F0X A;  3NH4 A;  3CT9 A;  1Z4R A;  1Y0Y A;  2Z3O A;  3CPX A;  4MHP A;  4JCA A;  3KI9 A;  1F57 A;  1IOI A;  2FL4 A;  2VBQ A;  1HDU A;  1AYE A;  1XF8 A;  4IK2 A;  3V45 A;  4II9 A;  5JM6 A;  4FD4 A;  5KTA A;  3R9F A;  1IY7 A;  1VIX A;  1OBR A;  1ZO0 A;  2ZEE A;  4Z65 A;  3DSB A;  2PJ4 A;  5I4M A;  2EK9 A;  2R98 A;  3DDD A;  1NE9 A;  1M1D A;  5FSZ A;  1B6B A;  1I1D A;  2EUI A;  2OH1 A;  2QIR A;  2RB7 A;  4OC1 A;  5A28 A;  3EWQ A;  1BPM A;  1Z8L A;  5AG7 A;  3PB6 X;  4MHY A;  4KVM E;  2AFO A;  4XPL A;  2V8D A;  4R57 A;  4R3L A;  4UF4 A;  2F8H A;  3BJ7 A;  3PB8 X;  1QSN A;  4YU9 A;  5ISV A;  2ZW7 A;  2KQV A;  3B3S A;  4MMO A;  3PGP A;  4OC3 A;  1Y7E A;  3F5B A;  2G9D A;  3EFA A;  5F49 A;  4BIN A;  2JEV A;  2PQ8 A;  3KR5 A;  2J8M A;  3KKW A;  4BBH A;  3IWW A;  4CYP A;  5K8P A;  2P6E A;  3K2K A;  5AG6 A;  1XFO A;  4JZ0 A;  2BEI A;  1F2O A;  2Z3K A;  5HIH A;  2JBK A;  2Q04 A;  1ELL P;  1PCA A;  4KSA A;  4NGQ A;  2ZPA A;  1FY7 A;  1M4D A;  3FEE A;  4RI1 A;  4PQA A;  4RN7 A;  3IEH A;  4J3G A;  4WJB A;  4ONW A;  4UFW A;  5DWN A;  2Q7B A;  3HLP A;  2YGW A;  2PCU A;  1QST A;  4H6U A;  3CPA A;  2VRI A;  1Z5R A;  3I3G A;  5E96 A;  2WUU A;  4CGP A;  2PRB A;  3SJF A;  4F9U A;  1I21 A;  2FVG A;  4YGO A;  3B3T A;  3Q6Z A;  3D7G A;  4FD7 A;  4XPD C;  4MHD A;  4B13 A;  4NJR A;  4ONU A;  1UFH A;  3D7F A;  1BPN A;  1BAV A;  2NYQ A;  1WK4 A;  2B3U A;  2V8G A;  2REE A;  1Y9W A;  2QVP A;  3D8P A;  3PEI A;  4B5P B;  4MY3 A;  1HDQ A;  3FB3 A;  5CMS A;  1Z9U A;  2FSR A;  2Z3M A;  2PJ2 A;  5J8C A;  4J4Z A;  3TTH A;  2Z11 A;  2NSM A;  2W2G A;  1EE3 P;  2L8R A;  2RC4 A;  4KOW A;  4JD6 A;  5JH9 A;  4HPS A;  2Q51 A;  1HJZ A;  4MI4 A;  4A38 A;  3SII A;  1ZG9 A;  1Q2C A;  4R8F A;  3DR8 A;  3TC8 A;  2I79 A;  3V2B A;  5E3B A;  1TXZ A;  1K4J A;  2Z10 A;  2VL1 A;  4L89 A;  2GAN A;  4QVT A;  4B10 A;  4X5K A;  3SI2 A;  4A2Z A;  4DNC A;  1S7L A;  4CAW A;  2KCW A;  2Q7S A;  4G1P A;  2ZED A;  4IHM A;  4NGS A;  4KYB A;  4OC4 A;  4R87 A;  5IB0 A;  1KUY A;  3FIX A;  1PU9 A;  3D67 A;  1FT7 A;  1LRZ A;  1YW4 A;  4KOS A;  4R3K A;  1QQ9 A;  2ZW5 A;  4GS4 A;  2FT0 A;  4XNH B;  3RO0 A;  3RZA A;  2R8V A;  3SI1 A;  4IF5 A;  2FXF A;  3DNS A;  4P4D A;  4Q7A A;  5FSU A;  3MGD A;  4Y49 C;  1ELM P;  2PC1 A;  1NSL A;  1GHE A;  4P4J A;  3JVN A;  2ANP A;  5D8N A;  4NXY A;  3SI0 A;  1Q2Y A;  4A33 A;  4J5Q A;  3FYN A;  5G1Z A;  3S6G A;  4OIW A;  2DXQ A;  3NA6 A;  4P44 A;  4CYN A;  4ZX8 A;  4QC6 A;  2BCO A;  1A2Z A;  3GPO A;  5DUS A;  2EVN A;  2YNC C;  4JLY A;  2XD7 A;  2FE7 A;  4CGN A;  1GYT A;  1CP6 A;  4HKF A;  3SIG A;  2JDD A;  4YWY A;  1Y9K A;  1ZR5 A;  3B3V A;  1ZLI A;  3GLJ A;  5D29 A;  2FIW A;  4RUH A;  3N7Z A;  3H4Q A;  2A4N A;  2Z3N A;  3GY9 A;  3PBB A;  3R1K A;  4AG9 A;  5CNP A;  4RS2 A;  4KS9 A;  5BWA B;  4DUK A;  3IU2 A;  4E2A A;  1S3Z A;  4M6G A;  3GQO A;  1MJB A;  2PR8 A;  4GUA A;  7CPA A;  2FAV A;  3VFQ A;  2PVW A;  1YLO A;  3B35 A;  1S60 A;  2BFQ A;  2Q43 A;  4PK3 A;  4UWJ A;  4CS0 B;  1YD9 A;  3B3C A;  2WCT A;  3VWD A;  3FF3 A;  4KSI A;  3LOD A;  4NFR A;  1YK3 A;  3T90 A;  2PJC A;  5CBM A;  2AFW A;  5LYI A;  1YX0 A;  2AFS A;  2BOA A;  2DPS A;  1Q7L A;  1YVO A;  4ZBG A;  1CPX A;  2ZW6 A;  3EC4 A;  2BO9 A;  2HV2 A;  1XE4 A;  4J5R A;  5H86 A;  4FBE A;  5A27 A;  5EC4 A;  1V0C A;  1P0H A;  2CF4 A;  3D68 A;  4QB9 A;  4NGM A;  3PB4 X;  4NGR A;  4PSW A;  3BI1 A;  3KL9 A;  3LWU A;  3G8W A;  4AVA A;  2WYR A;  4EVY A;  3G3S A;  2FXK A;  2BUE A;  1DE4 C;  2J8N A;  3I9S A;  2B4D A;  1CJW A;  3KAS A;  3WC6 A;  2ZEM A;  4MFZ A;  5IV0 A;  3BXM A;  5K8O A;  5J1Q A;  1IIC A;  5IB9 A;  3V38 A;  5AIL A;  1AMP A;  2EEE A;  1TF9 A;  4P4E A;  4ZGY B;  5F46 A;  4H89 A;  4Q36 A;  3DR6 A;  2QYV A;  2OU2 A;  1CBX A;  3PZJ A;  4JYW A;  4ABK A;  4KSF A;  1H8L A;  1M4I A;  4TWE A;  1LAP A;  3W6X A;  1TIQ A;  4CYO A;  4OC2 A;  2LGR A;  4MFK A;  4NGP A;  4CAE A;  5C82 A;  1ZLH A;  1JWQ A;  3NE7 A;  4NJQ A;  4ESS A;  4IUS A;  2V8V A;  3B8G A;  4GVV A;  4XPK A;  1XJO A;  2HC9 A;  2XEG A;  1BO4 A;  3QNV A;  3CDX A;  4LQG A;  5KTC A;  1Z8T A;  1WWZ A;  3EWP A;  4KLW A;  1MJA A;  5EBV A;  4A94 A;  2R1I A;  2AFX A;  5AGE A;  2P6G A;  4C7H A;  4ETK A;  3BI0 A;  1Y7R A;  3KGQ A;  2Q44 A;  3LAC A;  2CNT A;  2JZF A;  3MN8 A;  4UFV A;  2XEF A;  3WAB A;  2GRE A;  3QB8 A;  4OP4 A;  1S7F A;  3PFE A;  4MCP A;  5HVH A;  4NF1 A;  1X10 A;  5LYF A;  1MK4 A;  2PSW A;  3ETI A;  1R57 A;  3VH9 A;  5F47 A;  5LRG A;  2Q4Y A;  3KHX A;  2EWB A;  2DPT A;  3KQX A;  1R43 A;  1LAN A;  3DGV A;  1IB1 E;  5CB3 A;  3FRM A;  4OAE A;  3JTK A;  3SXO A;  1OZP A;  4MJ8 A;  4K0C A;  4EFD A;  4I49 A;  3IO1 A;  1P4N A;  2GU2 A;  3S6K A;  1VHU A;  3PB7 X;  1TXR A;  2B5G A;  1IID A;  5AG4 A;  1IYL A;  4ZI6 A;  3GYA A;  2WSA A;  4ZX9 A;  2IMO A;  3IU1 A;  2ODF A;  1QSM A;  1RTQ A;  3KR4 A;  2CIJ A;  2NMT A;  4OLL A;  2PDO A;  3EO4 A;  3BJ8 A;  2EBJ A;  2D4O A;  3SIH A;  2ZOG A;  2PJ7 A;  5THW A;  3W91 A;  2AJ6 A;  4LQ6 A;  4JLL A;  4U5Y A;  5DS0 A;  3WT4 A;  5AG5 A;  2Y0M A;  2C6C A;  1FNO A;  4OID A;  4MFQ A;  2CXA A;  2RFH A;  1PUA A;  3BHX A;  4R76 A;  3CZX A;  4LX9 A;  1J4J A;  1XRY A;  2FCK A;  4KOV A;  1Z8X A;  1KUX A;  3UY5 A;  4B5O A;  5GCN A;  3RNZ A;  2FIA A;  5KTD A;  3ISZ A;  4KVO E;  3VAT A;  2GE3 A;  3D2M A;  4ORF A;  4E0A A;  3KZW A;  4UCP A;  3SJX A;  3D2P A;  1ZG8 A;  5F09 A;  2H5M A;  1VHS A;  4OME A;  4QUS A;  4ZY1 A;  3W6S A;  5HVG A;  3D66 A;  4AXV A;  3B2Y A;  4AVC A;  4CRY B;  4X2T A;  4UIA A;  3IIB A;  3S6F A;  4AG7 A;  4CPA A;  3H8E A;  2PJ8 A;  2VEZ A;  1TY8 A;  2QJ8 A;  2OZH A;  4MRI A;  2GFQ A;  3ISX A;  4EME A;  1SPV A;  3L2N A;  3EWO A;  4CAX A;  4MY0 A;  5HH1 A;  5I0C A;  6CPA A;  2AFU A;  4KLV A;  2P6F A;  3T8W A;  5K8N A;  4P4B A;  4MXU A;  4P10 A;  5FSY A;  2JEW A;  3IWG A;  1IU8 A;  2OB0 A;  2YNC A;  5CB5 A;  3LD2 A;  5LRJ A;  3R9E A;  2ZEO A;  1I12 A;  4AB7 A;  4UEE A;  4UCN A;  3IJ3 A;  4UA3 A;  2FG1 A;  2DEA A;  1TKH A;  2O4H A;  2ZEN A;  4PK2 A;  2PR1 A;  4DYO A;  1CG2 A;  4KOR A;  5H84 A;  1Z8W A;  4MCS A;  3VWE A;  4EWT A;  2Z3L A;  3PB9 X;  2ZOF A;  4F6A A;  2X47 A;  3FED A;  1VKC A;  2PJ0 A;  4GXH A;  3GB0 A;  3TE4 A;  3OWC A;  1SQH A;  4MCQ A;  4CAV A;  2B4B A;  2B4D B;  2YNE A;  3S9L A;  4HNW B;  2BL1 A;  2XEJ A;  3S9M A;  2JZD A;  1IGB A;  2O28 A;  3FH4 A;  5EMI A;  3FNC A;  1TKF A;  1IYK A;  2O53 A;  2WPX A;  1R3N A;  4MFL A;  4NEX A;  3WC5 A;  5FSV A;  2FS5 A;  2ZEH A;  4UFX A;  5K8M A;  2K5T A;  3SXN A;  4BMH A;  1M4G A;  2JBJ A;  2AE6 A;  4ABL A;  1IOF A;  4XNH C;  1L0C A; 
#chains in the Genus database with same CATH homology
 1HEE A;  4OKO A;  2PJ1 A;  3D7H A;  4X3R A;  2WZN A;  1PYT B;  4JGK A;  5JGF A;  4MHN A;  5FSX A;  3NH8 A;  2ABZ A;  1Y0R A;  1ZG7 A;  3EJF A;  1QMU A;  4MHZ A;  4PPZ A;  1VHO A;  2CTC A;  1VGY A;  2PJ5 A;  4R8F A;  5K8P A;  4P6Y A;  4JVV A;  1M4L A;  2XEI A;  2PIZ A;  2EK8 A;  3IID A;  1VHE A;  1UWY A;  4ETJ A;  4ZYQ A;  1LAM A;  2DX6 A;  1JQG A;  3K9T A;  1CX8 A;  4UEZ A;  4UIB A;  1YSJ A;  2ZEP A;  2ZEL A;  1BLL E;  1ZR3 A;  4P4F A;  2POK A;  3PFO A;  4PXB A;  4UML A;  3FMC A;  4K3N A;  1YW6 A;  3GUX A;  5LYD A;  2I3C A;  4PXE A;  2IQ6 A;  2PJA A;  3IFE A;  3LMS A;  3FVL A;  4J5S A;  1LFW A;  3KHZ A;  3TX8 A;  8CPA A;  4F8Z A;  3EWR A;  1ARM A;  2AFZ A;  1CPS A;  3I1U A;  3PRT A;  3SJG A;  1LOK A;  1TF8 A;  4R6T A;  4IQY A;  2PJ3 A;  2PIY A;  3MRU A;  4TNU A;  4OC0 A;  3HUV A;  5CPA A;  2Q4Z A;  4ZY2 A;  5HXD A;  1XMB A;  3IIF A;  2V8H A;  4R7M A;  3RAM A;  1NJR A;  4UEF A;  4O23 A;  4A39 A;  3EJG A;  3B3W A;  2ZEF A;  3D4U A;  2C1C A;  4W9Y A;  5LYL A;  4OC5 A;  1YME A;  2GLJ A;  1NSA A;  3H8F A;  3EKE A;  2PJ9 A;  3DLJ A;  1DTD A;  2ACF A;  5HVF A;  3FJU A;  3NFZ A;  1XBU A;  4F9V A;  3FX6 A;  3FEC A;  2GLF A;  2ZEG A;  4WWV A;  4DJL A;  5HOL A;  3RBU A;  2IJZ A;  3NH5 A;  4X8I A;  2PE3 A;  3GQE A;  4P45 A;  4NGN A;  2OR4 A;  4B6Z A;  2AFM A;  2C6P A;  3WC7 A;  4FUU A;  3PBE A;  4GM5 A;  4FAI A;  2AFC A;  3H8G A;  4FWU A;  4D86 A;  4PXD A;  2C6G A;  4IAV A;  3JZT A;  2V77 A;  3KQZ A;  3SIJ A;  1KWM A;  2PVV A;  1F2P A;  1TKJ A;  4P4I A;  4TU0 A;  2HB6 A;  3GPQ A;  3VAR A;  5ELY A;  2PJ6 A;  3B7I A;  3Q71 A;  4PXC A;  2J9A A;  3SJE A;  2CTB A;  2F7V A;  1CP7 A;  3EW5 A;  2PRQ A;  3D7D A;  1Z2L A;  2PJB A;  4BD9 A;  3N5F A;  3V7Z A;  4NGT A;  4A37 A;  5LRK A;  3S9N A;  4ZY0 A;  4MCR A;  1LCP A;  2BFR A;  1ARL A;  4GVW A;  3GPG A;  3JRU A;  4H2K A;  2OOT A;  3IC1 A;  3NH4 A;  3CT9 A;  1Y0Y A;  3CPX A;  4MHP A;  4JCA A;  3KI9 A;  1F57 A;  1HDU A;  1AYE A;  4IK2 A;  3V45 A;  5JM6 A;  1IY7 A;  1VIX A;  1OBR A;  2ZEE A;  4Z65 A;  5I4M A;  2PJ4 A;  2EK9 A;  5FSZ A;  4OC1 A;  2RB7 A;  3EWQ A;  1BPM A;  1Z8L A;  3PB6 X;  4MHY A;  2AFO A;  2V8D A;  4UF4 A;  2F8H A;  3PB8 X;  4YU9 A;  3B3S A;  4MMO A;  4OC3 A;  1Y7E A;  2G9D A;  3KR5 A;  3IWW A;  3K2K A;  1XFO A;  4JZ0 A;  1F2O A;  5HIH A;  2JBK A;  1ELL P;  1PCA A;  4NGQ A;  3FEE A;  4PQA A;  3IEH A;  4WJB A;  4ONW A;  3HLP A;  2PCU A;  3CPA A;  2VRI A;  1Z5R A;  4F9U A;  3SJF A;  2FVG A;  3B3T A;  3Q6Z A;  3D7G A;  4NJR A;  3D7F A;  1BPN A;  1BAV A;  2NYQ A;  2V8G A;  2QVP A;  3PEI A;  1HDQ A;  5CMS A;  2PJ2 A;  4J4Z A;  2NSM A;  1EE3 P;  2L8R A;  5JH9 A;  2Q51 A;  1HJZ A;  4A38 A;  3SII A;  1ZG9 A;  3TC8 A;  3V2B A;  5E3B A;  1TXZ A;  2VL1 A;  3SI2 A;  4G1P A;  2ZED A;  4IHM A;  4NGS A;  4KYB A;  4OC4 A;  3D67 A;  1FT7 A;  1YW4 A;  1QQ9 A;  3RZA A;  3SI1 A;  4P4D A;  4Q7A A;  5FSU A;  1ELM P;  4P4J A;  2ANP A;  5D8N A;  3SI0 A;  4J5Q A;  4OIW A;  3NA6 A;  4P44 A;  4ZX8 A;  2BCO A;  3GPO A;  5DUS A;  2XD7 A;  1GYT A;  1CP6 A;  3SIG A;  4YWY A;  1ZR5 A;  3B3V A;  1ZLI A;  3GLJ A;  5D29 A;  4RUH A;  3PBB A;  4DUK A;  3GQO A;  4GUA A;  7CPA A;  2FAV A;  3VFQ A;  2PVW A;  1YLO A;  3B35 A;  2BFQ A;  2Q43 A;  1YD9 A;  3B3C A;  3FF3 A;  4KSI A;  4NFR A;  2PJC A;  5CBM A;  2AFW A;  5LYI A;  2AFS A;  2BOA A;  1Q7L A;  1CPX A;  2BO9 A;  4J5R A;  4FBE A;  2CF4 A;  3D68 A;  4NGM A;  3PB4 X;  4NGR A;  3BI1 A;  3KL9 A;  3LWU A;  2WYR A;  2FXK A;  1DE4 C;  3KAS A;  5J1Q A;  3WC6 A;  2ZEM A;  3BXM A;  5K8O A;  5IB9 A;  3V38 A;  5AIL A;  1AMP A;  2EEE A;  1TF9 A;  4P4E A;  2QYV A;  1CBX A;  4JYW A;  4ABK A;  1H8L A;  4TWE A;  1LAP A;  4OC2 A;  2LGR A;  4NGP A;  1ZLH A;  4NJQ A;  4ESS A;  2V8V A;  4GVV A;  1XJO A;  2HC9 A;  2XEG A;  3QNV A;  3CDX A;  4LQG A;  3EWP A;  4A94 A;  2AFX A;  4ETK A;  3BI0 A;  3KGQ A;  3MN8 A;  3WAB A;  2XEF A;  2GRE A;  4OP4 A;  5HVH A;  3PFE A;  4MCP A;  5LYF A;  3ETI A;  3VH9 A;  5LRG A;  3KHX A;  2EWB A;  3KQX A;  1R43 A;  1LAN A;  3DGV A;  5CB3 A;  4EFD A;  4K0C A;  3IO1 A;  2GU2 A;  1VHU A;  3PB7 X;  1TXR A;  4ZI6 A;  4ZX9 A;  2IMO A;  1RTQ A;  3KR4 A;  2CIJ A;  2ZOG A;  3SIH A;  2PJ7 A;  5THW A;  4JLL A;  3WT4 A;  5DS0 A;  2C6C A;  1FNO A;  4OID A;  2RFH A;  3BHX A;  4R76 A;  1XRY A;  3ISZ A;  3VAT A;  3KZW A;  3SJX A;  1ZG8 A;  5F09 A;  4OME A;  5HVG A;  4ZY1 A;  3D66 A;  4AXV A;  3B2Y A;  4X2T A;  4UIA A;  3IIB A;  4CPA A;  3H8E A;  2PJ8 A;  1TY8 A;  2QJ8 A;  4MRI A;  3ISX A;  4EME A;  1SPV A;  3L2N A;  3EWO A;  6CPA A;  2AFU A;  3T8W A;  5K8N A;  4P4B A;  4MXU A;  4P10 A;  5FSY A;  2JEW A;  5LRJ A;  5CB5 A;  2ZEO A;  4UEE A;  3IJ3 A;  2FG1 A;  2DEA A;  1TKH A;  2O4H A;  2ZEN A;  4DYO A;  1CG2 A;  4MCS A;  4EWT A;  3PB9 X;  2ZOF A;  2X47 A;  3FED A;  2PJ0 A;  3GB0 A;  4MCQ A;  3S9L A;  2XEJ A;  3S9M A;  1IGB A;  3FH4 A;  1TKF A;  2O53 A;  1R3N A;  3WC5 A;  5K8M A;  5FSV A;  2ZEH A;  2JBJ A;  4ABL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...