4JLLA

Crystal structure of the evolved variant of the computationally designed serine hydrolase, osh55.4_h1 covalently bound with fp-alkyne, northeast structural genomics consortium (nesg) target or273
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMGEEIKKAPDTLEVTGVHGTEKSAEAYRRASLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords Evolved variant of computationally designed serine hydrolase
total genus 57
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4jllA00
2FXKA 4KSIA 1BPMA 3EWRA 3Q6ZA 1ZR5A 4TU0A 1TY8A 2ACFA 4JGKA 4J5RA 3IIFA 1SPVA 1LAMA 3H8GA 3V45A 4ETJA 4IQYA 2FG1A 2BFQA 1LCPA 1TXZA 4ZYQA 2XD7A 1LAPA 3KQZA 3EWOA 5D8NA 3SIHA 2EEEA 3IIDA 5HIHA 3SIJA 4JLLA 3Q71A 3EWQA 3PEIA 1BPNA 1BLLE 3GPGA 3H8FA 3KQXA 4GUAA 4JCAA 3EJFA 3EWPA 1ZR3A 5FSYA 5CB3A 4ZX9A 3KR5A 4ZX8A 5HOLA 5FSZA 3KR4A 3ETIA 4R76A 3GPQA 4K0CA 2EWBA 3EW5A 2AFCA 4ZY0A 3T8WA 3JZTA 4X2TA 3SIGA 3EJGA 4ZY2A 4J5QA 5DUSA 5CBMA 4ZY1A 4K3NA 2BFRA 4GVVA 3EKEA 1YD9A 4ZI6A 2VRIA 4ETKA 5CMSA 4JVVA 2L8RA 5CB5A 3GQOA 4R7MA 3V2BA 4ABKA 5AILA 3GQEA 4R6TA 4ABLA 1LANA 4UMLA 1GYTA 4D86A 1VHUA 1HJZA 4J4ZA 5FSUA 3SIIA 3JRUA 4ESSA 2J9AA 3GPOA 4GVWA 1NJRA 4J5SA 3VFQA 2FAVA 2DX6A 3IJ3A 5E3BA 5FSXA 2X47A 4KYBA 3KZWA 3H8EA 2LGRA 5FSVA
chains in the Genus database with same CATH superfamily
2FXKA 4KSIA 1BPMA 2JZFA 3EWRA 3Q6ZA 2JZEA 1ZR5A 4TU0A 1TY8A 2ACFA 4JGKA 4J5RA 3IIFA 1SPVA 1LAMA 3H8GA 3V45A 4ETJA 4IQYA 2FG1A 2BFQA 1LCPA 1TXZA 4ZYQA 2XD7A 1LAPA 3KQZA 3EWOA 5D8NA 3SIHA 2EEEA 3IIDA 5HIHA 3SIJA 2RNKA 4JLLA 3Q71A 3EWQA 3PEIA 1BPNA 1BLLE 3GPGA 3H8FA 3KQXA 4GUAA 4JCAA 3EJFA 3EWPA 1ZR3A 5FSYA 5CB3A 4ZX9A 3KR5A 4ZX8A 5HOLA 5FSZA 3KR4A 3ETIA 4R76A 3GPQA 4K0CA 2JZDA 2EWBA 3EW5A 2AFCA 4ZY0A 3T8WA 3JZTA 4X2TA 2KQVA 3SIGA 3EJGA 4ZY2A 4J5QA 5DUSA 5CBMA 4ZY1A 4K3NA 2BFRA 4GVVA 3EKEA 1YD9A 4ZI6A 2VRIA 4ETKA 5CMSA 4JVVA 2L8RA 5CB5A 3GQOA 4R7MA 3V2BA 4ABKA 5AILA 3GQEA 4R6TA 4ABLA 1LANA 4UMLA 1GYTA 4D86A 1VHUA 1HJZA 4J4ZA 5FSUA 3SIIA 3JRUA 4ESSA 2J9AA 3GPOA 4GVWA 1NJRA 4J5SA 2WCTA 3VFQA 2FAVA 2W2GA 2DX6A 3IJ3A 5E3BA 5FSXA 2X47A 4KYBA 3KZWA 3H8EA 2LGRA 5FSVA
chains in the Genus database with same CATH topology
2FXKA 4KSIA 1BPMA 3EWRA 3Q6ZA 1ZR5A 4TU0A 1TY8A 2ACFA 4JGKA 4J5RA 3IIFA 1SPVA 1LAMA 3H8GA 3V45A 4ETJA 4IQYA 2FG1A 2BFQA 1LCPA 1TXZA 4ZYQA 2XD7A 1LAPA 3KQZA 3EWOA 5D8NA 3SIHA 2EEEA 3IIDA 5HIHA 3SIJA 4JLLA 3Q71A 3EWQA 3PEIA 1BPNA 1BLLE 3GPGA 3H8FA 3KQXA 4GUAA 4JCAA 3EJFA 3EWPA 1ZR3A 5FSYA 5CB3A 4ZX9A 3KR5A 4ZX8A 5HOLA 5FSZA 3KR4A 3ETIA 4R76A 3GPQA 4K0CA 2EWBA 3EW5A 2AFCA 4ZY0A 3T8WA 3JZTA 4X2TA 3SIGA 3EJGA 4ZY2A 4J5QA 5DUSA 5CBMA 4ZY1A 4K3NA 2BFRA 4GVVA 3EKEA 1YD9A 4ZI6A 2VRIA 4ETKA 5CMSA 4JVVA 2L8RA 5CB5A 3GQOA 4R7MA 3V2BA 4ABKA 5AILA 3GQEA 4R6TA 4ABLA 1LANA 4UMLA 1GYTA 4D86A 1VHUA 1HJZA 4J4ZA 5FSUA 3SIIA 3JRUA 4ESSA 2J9AA 3GPOA 4GVWA 1NJRA 4J5SA 3VFQA 2FAVA 2DX6A 3IJ3A 5E3BA 5FSXA 2X47A 4KYBA 3KZWA 3H8EA 2LGRA 5FSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXK A;  4KSI A;  1BPM A;  3EWR A;  3Q6Z A;  1ZR5 A;  4TU0 A;  1TY8 A;  2ACF A;  4JGK A;  4J5R A;  3IIF A;  1SPV A;  1LAM A;  3H8G A;  3V45 A;  4ETJ A;  4IQY A;  2FG1 A;  2BFQ A;  1LCP A;  1TXZ A;  4ZYQ A;  2XD7 A;  1LAP A;  3KQZ A;  3EWO A;  5D8N A;  3SIH A;  2EEE A;  3IID A;  5HIH A;  3SIJ A;  4JLL A;  3Q71 A;  3EWQ A;  3PEI A;  1BPN A;  1BLL E;  3GPG A;  3H8F A;  3KQX A;  4GUA A;  4JCA A;  3EJF A;  3EWP A;  1ZR3 A;  5FSY A;  5CB3 A;  4ZX9 A;  3KR5 A;  4ZX8 A;  5HOL A;  5FSZ A;  3KR4 A;  3ETI A;  4R76 A;  3GPQ A;  4K0C A;  2EWB A;  3EW5 A;  2AFC A;  4ZY0 A;  3T8W A;  3JZT A;  4X2T A;  3SIG A;  3EJG A;  4ZY2 A;  4J5Q A;  5DUS A;  5CBM A;  4ZY1 A;  4K3N A;  2BFR A;  4GVV A;  3EKE A;  1YD9 A;  4ZI6 A;  2VRI A;  4ETK A;  5CMS A;  4JVV A;  2L8R A;  5CB5 A;  3GQO A;  4R7M A;  3V2B A;  4ABK A;  5AIL A;  3GQE A;  4R6T A;  4ABL A;  1LAN A;  4UML A;  1GYT A;  4D86 A;  1VHU A;  1HJZ A;  4J4Z A;  5FSU A;  3SII A;  3JRU A;  4ESS A;  2J9A A;  3GPO A;  4GVW A;  1NJR A;  4J5S A;  3VFQ A;  2FAV A;  2DX6 A;  3IJ3 A;  5E3B A;  5FSX A;  2X47 A;  4KYB A;  3KZW A;  3H8E A;  2LGR A;  5FSV A; 
#chains in the Genus database with same CATH topology
 2FXK A;  4KSI A;  1BPM A;  2JZF A;  3EWR A;  3Q6Z A;  2JZE A;  1ZR5 A;  4TU0 A;  1TY8 A;  2ACF A;  4JGK A;  4J5R A;  3IIF A;  1SPV A;  1LAM A;  3H8G A;  3V45 A;  4ETJ A;  4IQY A;  2FG1 A;  2BFQ A;  1LCP A;  1TXZ A;  4ZYQ A;  2XD7 A;  1LAP A;  3KQZ A;  3EWO A;  5D8N A;  3SIH A;  2EEE A;  3IID A;  5HIH A;  3SIJ A;  2RNK A;  4JLL A;  3Q71 A;  3EWQ A;  3PEI A;  1BPN A;  1BLL E;  3GPG A;  3H8F A;  3KQX A;  4GUA A;  4JCA A;  3EJF A;  3EWP A;  1ZR3 A;  5FSY A;  5CB3 A;  4ZX9 A;  3KR5 A;  4ZX8 A;  5HOL A;  5FSZ A;  3KR4 A;  3ETI A;  4R76 A;  3GPQ A;  4K0C A;  2JZD A;  2EWB A;  3EW5 A;  2AFC A;  4ZY0 A;  3T8W A;  3JZT A;  4X2T A;  2KQV A;  3SIG A;  3EJG A;  4ZY2 A;  4J5Q A;  5DUS A;  5CBM A;  4ZY1 A;  4K3N A;  2BFR A;  4GVV A;  3EKE A;  1YD9 A;  4ZI6 A;  2VRI A;  4ETK A;  5CMS A;  4JVV A;  2L8R A;  5CB5 A;  3GQO A;  4R7M A;  3V2B A;  4ABK A;  5AIL A;  3GQE A;  4R6T A;  4ABL A;  1LAN A;  4UML A;  1GYT A;  4D86 A;  1VHU A;  1HJZ A;  4J4Z A;  5FSU A;  3SII A;  3JRU A;  4ESS A;  2J9A A;  3GPO A;  4GVW A;  1NJR A;  4J5S A;  2WCT A;  3VFQ A;  2FAV A;  2W2G A;  2DX6 A;  3IJ3 A;  5E3B A;  5FSX A;  2X47 A;  4KYB A;  3KZW A;  3H8E A;  2LGR A;  5FSV A; 
#chains in the Genus database with same CATH homology
 2FXK A;  4KSI A;  1BPM A;  3EWR A;  3Q6Z A;  1ZR5 A;  4TU0 A;  1TY8 A;  2ACF A;  4JGK A;  4J5R A;  3IIF A;  1SPV A;  1LAM A;  3H8G A;  3V45 A;  4ETJ A;  4IQY A;  2FG1 A;  2BFQ A;  1LCP A;  1TXZ A;  4ZYQ A;  2XD7 A;  1LAP A;  3KQZ A;  3EWO A;  5D8N A;  3SIH A;  2EEE A;  3IID A;  5HIH A;  3SIJ A;  4JLL A;  3Q71 A;  3EWQ A;  3PEI A;  1BPN A;  1BLL E;  3GPG A;  3H8F A;  3KQX A;  4GUA A;  4JCA A;  3EJF A;  3EWP A;  1ZR3 A;  5FSY A;  5CB3 A;  4ZX9 A;  3KR5 A;  4ZX8 A;  5HOL A;  5FSZ A;  3KR4 A;  3ETI A;  4R76 A;  3GPQ A;  4K0C A;  2EWB A;  3EW5 A;  2AFC A;  4ZY0 A;  3T8W A;  3JZT A;  4X2T A;  3SIG A;  3EJG A;  4ZY2 A;  4J5Q A;  5DUS A;  5CBM A;  4ZY1 A;  4K3N A;  2BFR A;  4GVV A;  3EKE A;  1YD9 A;  4ZI6 A;  2VRI A;  4ETK A;  5CMS A;  4JVV A;  2L8R A;  5CB5 A;  3GQO A;  4R7M A;  3V2B A;  4ABK A;  5AIL A;  3GQE A;  4R6T A;  4ABL A;  1LAN A;  4UML A;  1GYT A;  4D86 A;  1VHU A;  1HJZ A;  4J4Z A;  5FSU A;  3SII A;  3JRU A;  4ESS A;  2J9A A;  3GPO A;  4GVW A;  1NJR A;  4J5S A;  3VFQ A;  2FAV A;  2DX6 A;  3IJ3 A;  5E3B A;  5FSX A;  2X47 A;  4KYB A;  3KZW A;  3H8E A;  2LGR A;  5FSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...