4JLLA

Crystal structure of the evolved variant of the computationally designed serine hydrolase, osh55.4_h1 covalently bound with fp-alkyne, northeast structural genomics consortium (nesg) target or273
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMGEEIKKAPDTLEVTGVHGTEKSAEAYRRASLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evolved variant of computationally designed serine hydrolase
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
total genus 57
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4jllA00
1HJZA 5FSVA 3EWQA 3EWOA 2L8RA 3KZWA 4ZY1A 3PEIA 4TU0A 2XD7A 3GQOA 1YD9A 1TY8A 3JZTA 5HOLA 5CBMA 3EKEA 4R76A 3EJGA 4J4ZA 1LAMA 4GVWA 3EWPA 1TXZA 5FSXA 3JRUA 4JLLA 5CB5A 4X2TA 1SPVA 3V2BA 4JGKA 4K0CA 3GPQA 4ZI6A 3KR5A 3KQXA 1VHUA 4GVVA 2FAVA 3EJFA 4R7MA 1BPMA 4ZX9A 2EEEA 3H8GA 4ZY0A 2X47A 4ABLA 1ZR5A 1BLLE 3SIIA 3GQEA 4JVVA 1NJRA 5D8NA 3Q6ZA 4ZY2A 3EWRA 1LCPA 4ETKA 2AFCA 2BFQA 5CB3A 4J5RA 3IIDA 5FSUA 4K3NA 4J5QA 2FXKA 3IIFA 4J5SA 4IQYA 4ZYQA 3Q71A 3GPGA 2LGRA 2EWBA 5DUSA 3SIGA 3KR4A 3EW5A 2BFRA 1ZR3A 5HIHA 5E3BA 4ETJA 3T8WA 2VRIA 4GUAA 3SIHA 3H8EA 3IJ3A 4KYBA 5CMSA 5FSZA 4JCAA 4KSIA 3V45A 3VFQA 4D86A 4ABKA 1LAPA 3KQZA 1BPNA 4UMLA 5FSYA 5AILA 1GYTA 1LANA 4ZX8A 2DX6A 4R6TA 2J9AA 3ETIA 2FG1A 3SIJA 2ACFA 3GPOA 4ESSA 3H8FA
chains in the Genus database with same CATH superfamily
1HJZA 5FSVA 3EWQA 3EWOA 2L8RA 3KZWA 4ZY1A 3PEIA 4TU0A 2XD7A 3GQOA 1YD9A 1TY8A 3JZTA 5HOLA 5CBMA 3EKEA 4R76A 3EJGA 4J4ZA 2RNKA 1LAMA 4GVWA 3EWPA 1TXZA 5FSXA 3JRUA 4JLLA 5CB5A 4X2TA 1SPVA 3V2BA 4JGKA 4K0CA 3GPQA 4ZI6A 3KR5A 3KQXA 1VHUA 4GVVA 2FAVA 3EJFA 4R7MA 1BPMA 2KQVA 4ZX9A 2EEEA 3H8GA 4ZY0A 2X47A 4ABLA 1ZR5A 1BLLE 3SIIA 3GQEA 4JVVA 2WCTA 1NJRA 2JZEA 5D8NA 3Q6ZA 4ZY2A 3EWRA 1LCPA 4ETKA 2AFCA 2BFQA 2JZDA 4J5RA 3IIDA 5FSUA 4K3NA 5CB3A 4J5QA 2FXKA 4J5SA 3IIFA 4IQYA 4ZYQA 3Q71A 3GPGA 2LGRA 2EWBA 5DUSA 3SIGA 3KR4A 3EW5A 2W2GA 2BFRA 1ZR3A 5HIHA 5E3BA 4ETJA 3T8WA 2VRIA 4GUAA 3SIHA 3H8EA 3IJ3A 2JZFA 4KYBA 5CMSA 5FSZA 4JCAA 4KSIA 3V45A 3VFQA 4D86A 4ABKA 1LAPA 3KQZA 1BPNA 4UMLA 5FSYA 5AILA 1GYTA 1LANA 4ZX8A 2DX6A 4R6TA 2J9AA 3ETIA 2FG1A 3SIJA 2ACFA 3GPOA 4ESSA 3H8FA
chains in the Genus database with same CATH topology
1HJZA 5FSVA 3EWQA 3EWOA 2L8RA 3KZWA 4ZY1A 3PEIA 4TU0A 2XD7A 3GQOA 1YD9A 1TY8A 3JZTA 5HOLA 5CBMA 3EKEA 4R76A 3EJGA 4J4ZA 1LAMA 4GVWA 3EWPA 1TXZA 5FSXA 3JRUA 4JLLA 5CB5A 4X2TA 1SPVA 3V2BA 4JGKA 4K0CA 3GPQA 4ZI6A 3KR5A 3KQXA 1VHUA 4GVVA 2FAVA 3EJFA 4R7MA 1BPMA 4ZX9A 2EEEA 3H8GA 4ZY0A 2X47A 4ABLA 1ZR5A 1BLLE 3SIIA 3GQEA 4JVVA 1NJRA 5D8NA 3Q6ZA 4ZY2A 3EWRA 1LCPA 4ETKA 2AFCA 2BFQA 5CB3A 4J5RA 3IIDA 5FSUA 4K3NA 4J5QA 2FXKA 3IIFA 4J5SA 4IQYA 4ZYQA 3Q71A 3GPGA 2LGRA 2EWBA 5DUSA 3SIGA 3KR4A 3EW5A 2BFRA 1ZR3A 5HIHA 5E3BA 4ETJA 3T8WA 2VRIA 4GUAA 3SIHA 3H8EA 3IJ3A 4KYBA 5CMSA 5FSZA 4JCAA 4KSIA 3V45A 3VFQA 4D86A 4ABKA 1LAPA 3KQZA 1BPNA 4UMLA 5FSYA 5AILA 1GYTA 1LANA 4ZX8A 2DX6A 4R6TA 2J9AA 3ETIA 2FG1A 3SIJA 2ACFA 3GPOA 4ESSA 3H8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJZ A;  5FSV A;  3EWQ A;  3EWO A;  2L8R A;  3KZW A;  4ZY1 A;  3PEI A;  4TU0 A;  2XD7 A;  3GQO A;  1YD9 A;  1TY8 A;  3JZT A;  5HOL A;  5CBM A;  3EKE A;  4R76 A;  3EJG A;  4J4Z A;  1LAM A;  4GVW A;  3EWP A;  1TXZ A;  5FSX A;  3JRU A;  4JLL A;  5CB5 A;  4X2T A;  1SPV A;  3V2B A;  4JGK A;  4K0C A;  3GPQ A;  4ZI6 A;  3KR5 A;  3KQX A;  1VHU A;  4GVV A;  2FAV A;  3EJF A;  4R7M A;  1BPM A;  4ZX9 A;  2EEE A;  3H8G A;  4ZY0 A;  2X47 A;  4ABL A;  1ZR5 A;  1BLL E;  3SII A;  3GQE A;  4JVV A;  1NJR A;  5D8N A;  3Q6Z A;  4ZY2 A;  3EWR A;  1LCP A;  4ETK A;  2AFC A;  2BFQ A;  5CB3 A;  4J5R A;  3IID A;  5FSU A;  4K3N A;  4J5Q A;  2FXK A;  3IIF A;  4J5S A;  4IQY A;  4ZYQ A;  3Q71 A;  3GPG A;  2LGR A;  2EWB A;  5DUS A;  3SIG A;  3KR4 A;  3EW5 A;  2BFR A;  1ZR3 A;  5HIH A;  5E3B A;  4ETJ A;  3T8W A;  2VRI A;  4GUA A;  3SIH A;  3H8E A;  3IJ3 A;  4KYB A;  5CMS A;  5FSZ A;  4JCA A;  4KSI A;  3V45 A;  3VFQ A;  4D86 A;  4ABK A;  1LAP A;  3KQZ A;  1BPN A;  4UML A;  5FSY A;  5AIL A;  1GYT A;  1LAN A;  4ZX8 A;  2DX6 A;  4R6T A;  2J9A A;  3ETI A;  2FG1 A;  3SIJ A;  2ACF A;  3GPO A;  4ESS A;  3H8F A; 
#chains in the Genus database with same CATH topology
 1HJZ A;  5FSV A;  3EWQ A;  3EWO A;  2L8R A;  3KZW A;  4ZY1 A;  3PEI A;  4TU0 A;  2XD7 A;  3GQO A;  1YD9 A;  1TY8 A;  3JZT A;  5HOL A;  5CBM A;  3EKE A;  4R76 A;  3EJG A;  4J4Z A;  2RNK A;  1LAM A;  4GVW A;  3EWP A;  1TXZ A;  5FSX A;  3JRU A;  4JLL A;  5CB5 A;  4X2T A;  1SPV A;  3V2B A;  4JGK A;  4K0C A;  3GPQ A;  4ZI6 A;  3KR5 A;  3KQX A;  1VHU A;  4GVV A;  2FAV A;  3EJF A;  4R7M A;  1BPM A;  2KQV A;  4ZX9 A;  2EEE A;  3H8G A;  4ZY0 A;  2X47 A;  4ABL A;  1ZR5 A;  1BLL E;  3SII A;  3GQE A;  4JVV A;  2WCT A;  1NJR A;  2JZE A;  5D8N A;  3Q6Z A;  4ZY2 A;  3EWR A;  1LCP A;  4ETK A;  2AFC A;  2BFQ A;  2JZD A;  4J5R A;  3IID A;  5FSU A;  4K3N A;  5CB3 A;  4J5Q A;  2FXK A;  4J5S A;  3IIF A;  4IQY A;  4ZYQ A;  3Q71 A;  3GPG A;  2LGR A;  2EWB A;  5DUS A;  3SIG A;  3KR4 A;  3EW5 A;  2W2G A;  2BFR A;  1ZR3 A;  5HIH A;  5E3B A;  4ETJ A;  3T8W A;  2VRI A;  4GUA A;  3SIH A;  3H8E A;  3IJ3 A;  2JZF A;  4KYB A;  5CMS A;  5FSZ A;  4JCA A;  4KSI A;  3V45 A;  3VFQ A;  4D86 A;  4ABK A;  1LAP A;  3KQZ A;  1BPN A;  4UML A;  5FSY A;  5AIL A;  1GYT A;  1LAN A;  4ZX8 A;  2DX6 A;  4R6T A;  2J9A A;  3ETI A;  2FG1 A;  3SIJ A;  2ACF A;  3GPO A;  4ESS A;  3H8F A; 
#chains in the Genus database with same CATH homology
 1HJZ A;  5FSV A;  3EWQ A;  3EWO A;  2L8R A;  3KZW A;  4ZY1 A;  3PEI A;  4TU0 A;  2XD7 A;  3GQO A;  1YD9 A;  1TY8 A;  3JZT A;  5HOL A;  5CBM A;  3EKE A;  4R76 A;  3EJG A;  4J4Z A;  1LAM A;  4GVW A;  3EWP A;  1TXZ A;  5FSX A;  3JRU A;  4JLL A;  5CB5 A;  4X2T A;  1SPV A;  3V2B A;  4JGK A;  4K0C A;  3GPQ A;  4ZI6 A;  3KR5 A;  3KQX A;  1VHU A;  4GVV A;  2FAV A;  3EJF A;  4R7M A;  1BPM A;  4ZX9 A;  2EEE A;  3H8G A;  4ZY0 A;  2X47 A;  4ABL A;  1ZR5 A;  1BLL E;  3SII A;  3GQE A;  4JVV A;  1NJR A;  5D8N A;  3Q6Z A;  4ZY2 A;  3EWR A;  1LCP A;  4ETK A;  2AFC A;  2BFQ A;  5CB3 A;  4J5R A;  3IID A;  5FSU A;  4K3N A;  4J5Q A;  2FXK A;  3IIF A;  4J5S A;  4IQY A;  4ZYQ A;  3Q71 A;  3GPG A;  2LGR A;  2EWB A;  5DUS A;  3SIG A;  3KR4 A;  3EW5 A;  2BFR A;  1ZR3 A;  5HIH A;  5E3B A;  4ETJ A;  3T8W A;  2VRI A;  4GUA A;  3SIH A;  3H8E A;  3IJ3 A;  4KYB A;  5CMS A;  5FSZ A;  4JCA A;  4KSI A;  3V45 A;  3VFQ A;  4D86 A;  4ABK A;  1LAP A;  3KQZ A;  1BPN A;  4UML A;  5FSY A;  5AIL A;  1GYT A;  1LAN A;  4ZX8 A;  2DX6 A;  4R6T A;  2J9A A;  3ETI A;  2FG1 A;  3SIJ A;  2ACF A;  3GPO A;  4ESS A;  3H8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...