2JZEA

Nmr structure of the domain 527-651 of the sars-cov nonstructural protein nsp3, single conformer closest to the mean coordinates of an ensemble of twenty energy minimized conformers
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2jzeA01
2JZFA 2JZDA 2W2GA 2WCTA 2RNKA 2JZEA 2KQVA
chains in the Genus database with same CATH superfamily
5CB3A 4ZY1A 4J4ZA 2BFQA 5E3BA 2DX6A 4ETJA 4GVVA 3IIFA 4K0CA 4ZY0A 4ZY2A 3GPQA 1ZR5A 1HJZA 4K3NA 4ZYQA 3EWPA 5FSZA 2JZEA 2LGRA 3GQEA 3EKEA 5CB5A 2JZFA 3SIIA 1LANA 1LAPA 3VFQA 4ABKA 5HOLA 2ACFA 3EWRA 3SIHA 2WCTA 3KR5A 2EEEA 3H8FA 5FSVA 3V45A 1BPMA 4JVVA 4JGKA 3T8WA 1NJRA 3GPOA 3H8EA 1SPVA 2RNKA 1YD9A 3KZWA 2AFCA 3KQXA 1GYTA 5AILA 3Q71A 3V2BA 2EWBA 1BPNA 4D86A 3SIGA 2FG1A 2W2GA 2XD7A 1LAMA 2VRIA 4J5QA 5HIHA 4ABLA 2X47A 3EJGA 3IJ3A 3EWQA 3GPGA 4X2TA 3GQOA 5FSYA 2JZDA 4ZX9A 4ZI6A 4R76A 3EJFA 5FSXA 4GUAA 3JRUA 4J5RA 2L8RA 2BFRA 4R6TA 3EW5A 3SIJA 4ESSA 4GVWA 2KQVA 3JZTA 4ETKA 4R7MA 5D8NA 1LCPA 1BLLE 4TU0A 3KR4A 5DUSA 4UMLA 3KQZA 4IQYA 5FSUA 2J9AA 3ETIA 4JLLA 4KSIA 2FXKA 4JCAA 3H8GA 1ZR3A 3IIDA 5CBMA 4J5SA 3EWOA 4ZX8A 3Q6ZA 1VHUA 1TXZA 3PEIA 4KYBA 5CMSA 1TY8A 2FAVA
chains in the Genus database with same CATH topology
2JZFA 2JZDA 2W2GA 2WCTA 2RNKA 2JZEA 2KQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZF A;  2JZD A;  2W2G A;  2WCT A;  2RNK A;  2JZE A;  2KQV A; 
#chains in the Genus database with same CATH topology
 5CB3 A;  4ZY1 A;  4J4Z A;  2BFQ A;  5E3B A;  2DX6 A;  4ETJ A;  4GVV A;  3IIF A;  4K0C A;  4ZY0 A;  4ZY2 A;  3GPQ A;  1ZR5 A;  1HJZ A;  4K3N A;  4ZYQ A;  3EWP A;  5FSZ A;  2JZE A;  2LGR A;  3GQE A;  3EKE A;  5CB5 A;  2JZF A;  3SII A;  1LAN A;  1LAP A;  3VFQ A;  4ABK A;  5HOL A;  2ACF A;  3EWR A;  3SIH A;  2WCT A;  3KR5 A;  2EEE A;  3H8F A;  5FSV A;  3V45 A;  1BPM A;  4JVV A;  4JGK A;  3T8W A;  1NJR A;  3GPO A;  3H8E A;  1SPV A;  2RNK A;  1YD9 A;  3KZW A;  2AFC A;  3KQX A;  1GYT A;  5AIL A;  3Q71 A;  3V2B A;  2EWB A;  1BPN A;  4D86 A;  3SIG A;  2FG1 A;  2W2G A;  2XD7 A;  1LAM A;  2VRI A;  4J5Q A;  5HIH A;  4ABL A;  2X47 A;  3EJG A;  3IJ3 A;  3EWQ A;  3GPG A;  4X2T A;  3GQO A;  5FSY A;  2JZD A;  4ZX9 A;  4ZI6 A;  4R76 A;  3EJF A;  5FSX A;  4GUA A;  3JRU A;  4J5R A;  2L8R A;  2BFR A;  4R6T A;  3EW5 A;  3SIJ A;  4ESS A;  4GVW A;  2KQV A;  3JZT A;  4ETK A;  4R7M A;  5D8N A;  1LCP A;  1BLL E;  4TU0 A;  3KR4 A;  5DUS A;  4UML A;  3KQZ A;  4IQY A;  5FSU A;  2J9A A;  3ETI A;  4JLL A;  4KSI A;  2FXK A;  4JCA A;  3H8G A;  1ZR3 A;  3IID A;  5CBM A;  4J5S A;  3EWO A;  4ZX8 A;  3Q6Z A;  1VHU A;  1TXZ A;  3PEI A;  4KYB A;  5CMS A;  1TY8 A;  2FAV A; 
#chains in the Genus database with same CATH homology
 2JZF A;  2JZD A;  2W2G A;  2WCT A;  2RNK A;  2JZE A;  2KQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...