2JZEA

Nmr structure of the domain 527-651 of the sars-cov nonstructural protein nsp3, single conformer closest to the mean coordinates of an ensemble of twenty energy minimized conformers
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2jzeA01
2JZFA 2JZEA 2JZDA 2RNKA 2WCTA 2KQVA 2W2GA
chains in the Genus database with same CATH superfamily
5CB3A 4K3NA 5E3BA 4ABKA 4ZX8A 3GPQA 3KZWA 4D86A 4ZY1A 2BFQA 4GVWA 3H8EA 4ETKA 3EW5A 3SIGA 5CB5A 3SIJA 3EWRA 1NJRA 1LANA 1LAMA 2X47A 5CBMA 2FG1A 3VFQA 5FSUA 3EJFA 2DX6A 5D8NA 1TY8A 4R7MA 2J9AA 2FXKA 4GVVA 4J5RA 4K0CA 5AILA 2XD7A 3GQEA 1YD9A 3GQOA 5FSZA 4TU0A 1HJZA 1BLLE 3IJ3A 4JVVA 3KQZA 4ZI6A 1BPNA 5CMSA 2JZDA 4J5QA 2BFRA 3PEIA 3EKEA 4KSIA 2VRIA 1SPVA 4ZX9A 5FSYA 2WCTA 3GPGA 4ESSA 4GUAA 4JGKA 4UMLA 1ZR5A 3Q6ZA 3Q71A 2KQVA 3IIFA 3V2BA 3H8FA 3V45A 2AFCA 1ZR3A 2EWBA 2FAVA 3IIDA 2LGRA 3T8WA 2JZEA 3EWQA 2W2GA 3EWOA 3EWPA 4R6TA 4X2TA 2JZFA 4ABLA 2RNKA 4JCAA 3EJGA 4IQYA 2EEEA 1TXZA 3GPOA 4KYBA 5FSVA 1LCPA 3KR5A 3SIIA 3KR4A 4JLLA 4ETJA 4ZYQA 3H8GA 2L8RA 3JZTA 3KQXA 5FSXA 4ZY2A 1BPMA 4R76A 1VHUA 4J5SA 5HOLA 3SIHA 3ETIA 1LAPA 1GYTA 4J4ZA 5HIHA 5DUSA 4ZY0A 3JRUA 2ACFA
chains in the Genus database with same CATH topology
2JZFA 2JZEA 2JZDA 2RNKA 2WCTA 2KQVA 2W2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZF A;  2JZE A;  2JZD A;  2RNK A;  2WCT A;  2KQV A;  2W2G A; 
#chains in the Genus database with same CATH topology
 5CB3 A;  4K3N A;  5E3B A;  4ABK A;  4ZX8 A;  3GPQ A;  3KZW A;  4D86 A;  4ZY1 A;  2BFQ A;  4GVW A;  3H8E A;  4ETK A;  3EW5 A;  3SIG A;  5CB5 A;  3SIJ A;  3EWR A;  1NJR A;  1LAN A;  1LAM A;  2X47 A;  5CBM A;  2FG1 A;  3VFQ A;  5FSU A;  3EJF A;  2DX6 A;  5D8N A;  1TY8 A;  4R7M A;  2J9A A;  2FXK A;  4GVV A;  4J5R A;  4K0C A;  5AIL A;  2XD7 A;  3GQE A;  1YD9 A;  3GQO A;  5FSZ A;  4TU0 A;  1HJZ A;  1BLL E;  3IJ3 A;  4JVV A;  3KQZ A;  4ZI6 A;  1BPN A;  5CMS A;  2JZD A;  4J5Q A;  2BFR A;  3PEI A;  3EKE A;  4KSI A;  2VRI A;  1SPV A;  4ZX9 A;  5FSY A;  2WCT A;  3GPG A;  4ESS A;  4GUA A;  4JGK A;  4UML A;  1ZR5 A;  3Q6Z A;  3Q71 A;  2KQV A;  3IIF A;  3V2B A;  3H8F A;  3V45 A;  2AFC A;  1ZR3 A;  2EWB A;  2FAV A;  3IID A;  2LGR A;  3T8W A;  2JZE A;  3EWQ A;  2W2G A;  3EWO A;  3EWP A;  4R6T A;  4X2T A;  2JZF A;  4ABL A;  2RNK A;  4JCA A;  3EJG A;  4IQY A;  2EEE A;  1TXZ A;  3GPO A;  4KYB A;  5FSV A;  1LCP A;  3KR5 A;  3SII A;  3KR4 A;  4JLL A;  4ETJ A;  4ZYQ A;  3H8G A;  2L8R A;  3JZT A;  3KQX A;  5FSX A;  4ZY2 A;  1BPM A;  4R76 A;  1VHU A;  4J5S A;  5HOL A;  3SIH A;  3ETI A;  1LAP A;  1GYT A;  4J4Z A;  5HIH A;  5DUS A;  4ZY0 A;  3JRU A;  2ACF A; 
#chains in the Genus database with same CATH homology
 2JZF A;  2JZE A;  2JZD A;  2RNK A;  2WCT A;  2KQV A;  2W2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...