4J5QA

Targ1 (c6orf130), terminal adp-ribose glycohydrolase 1, apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
EDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-acetyl-ADP-ribose deacetylase 1
publication title Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 146
sequence length 146
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j5qA01
1LANA 5AILA 4ZI6A 1LAMA 2FG1A 4KYBA 4ESSA 5HIHA 4ZY1A 4JLLA 3PEIA 5HOLA 1BPNA 4JCAA 2VRIA 3GPOA 4R7MA 4ZX8A 5FSVA 3ETIA 1SPVA 5D8NA 3H8EA 4TU0A 5FSYA 2XD7A 5CBMA 4ABLA 1TXZA 1YD9A 2AFCA 4UMLA 4J5SA 1BPMA 3V2BA 3EKEA 2BFRA 3H8GA 1GYTA 2DX6A 5FSUA 4K0CA 3EWPA 3EW5A 4JVVA 5FSXA 3IIFA 1ZR5A 3Q71A 4ETKA 1HJZA 1LCPA 2LGRA 2ACFA 3EJGA 3EWOA 2J9AA 3GQOA 4ZX9A 3VFQA 4ZYQA 2EWBA 4GUAA 3EWQA 3KQXA 5CB5A 5DUSA 1NJRA 4IQYA 2FXKA 5FSZA 3V45A 3T8WA 2BFQA 4ZY0A 5CMSA 3KQZA 5CB3A 4J4ZA 3Q6ZA 4J5QA 1VHUA 4KSIA 1TY8A 4K3NA 3GQEA 2L8RA 2X47A 3H8FA 4R76A 4R6TA 4GVVA 3KR5A 4GVWA 1ZR3A 3GPQA 3SIGA 3GPGA 5E3BA 1LAPA 3KZWA 4X2TA 2FAVA 3EWRA 3SIIA 4D86A 4ABKA 3EJFA 4JGKA 3JZTA 4ETJA 3SIJA 3KR4A 3JRUA 4ZY2A 3SIHA 3IIDA 1BLLE 4J5RA 3IJ3A 2EEEA
chains in the Genus database with same CATH superfamily
1LANA 5AILA 4ZI6A 1LAMA 2FG1A 4KYBA 4ESSA 2JZEA 5HIHA 4ZY1A 4JLLA 3PEIA 5HOLA 1BPNA 2JZDA 4JCAA 2VRIA 3GPOA 4R7MA 4ZX8A 5FSVA 3ETIA 1SPVA 5D8NA 3H8EA 4TU0A 5FSYA 2XD7A 5CBMA 4ABLA 1TXZA 1YD9A 2AFCA 2JZFA 4UMLA 4J5SA 1BPMA 3V2BA 3EKEA 2BFRA 3H8GA 1GYTA 2DX6A 5FSUA 4K0CA 3EWPA 3EW5A 2RNKA 4JVVA 5FSXA 3IIFA 1ZR5A 2W2GA 3Q71A 4ETKA 1HJZA 1LCPA 2LGRA 2ACFA 3EJGA 3EWOA 2J9AA 3GQOA 4ZX9A 3VFQA 4ZYQA 2EWBA 4GUAA 3EWQA 3KQXA 5CB5A 5DUSA 1NJRA 4IQYA 2FXKA 5FSZA 3V45A 3T8WA 2BFQA 4ZY0A 5CMSA 3KQZA 5CB3A 4J4ZA 3Q6ZA 4J5QA 1VHUA 4KSIA 1TY8A 4K3NA 3GQEA 2L8RA 2X47A 3H8FA 4R76A 4R6TA 4GVVA 3KR5A 4GVWA 1ZR3A 3GPQA 2KQVA 3SIGA 3GPGA 5E3BA 1LAPA 3KZWA 4X2TA 2FAVA 3EWRA 3SIIA 4D86A 4ABKA 3EJFA 4JGKA 3JZTA 4ETJA 3SIJA 3KR4A 3JRUA 4ZY2A 3SIHA 2WCTA 3IIDA 1BLLE 4J5RA 3IJ3A 2EEEA
chains in the Genus database with same CATH topology
1LANA 5AILA 4ZI6A 1LAMA 2FG1A 4KYBA 4ESSA 5HIHA 4ZY1A 4JLLA 3PEIA 5HOLA 1BPNA 4JCAA 2VRIA 3GPOA 4R7MA 4ZX8A 5FSVA 3ETIA 1SPVA 5D8NA 3H8EA 4TU0A 5FSYA 2XD7A 5CBMA 4ABLA 1TXZA 1YD9A 2AFCA 4UMLA 4J5SA 1BPMA 3V2BA 3EKEA 2BFRA 3H8GA 1GYTA 2DX6A 5FSUA 4K0CA 3EWPA 3EW5A 4JVVA 5FSXA 3IIFA 1ZR5A 3Q71A 4ETKA 1HJZA 1LCPA 2LGRA 2ACFA 3EJGA 3EWOA 2J9AA 3GQOA 4ZX9A 3VFQA 4ZYQA 2EWBA 4GUAA 3EWQA 3KQXA 5CB5A 5DUSA 1NJRA 4IQYA 2FXKA 5FSZA 3V45A 3T8WA 2BFQA 4ZY0A 5CMSA 3KQZA 5CB3A 4J4ZA 3Q6ZA 4J5QA 1VHUA 4KSIA 1TY8A 4K3NA 3GQEA 2L8RA 2X47A 3H8FA 4R76A 4R6TA 4GVVA 3KR5A 4GVWA 1ZR3A 3GPQA 3SIGA 3GPGA 5E3BA 1LAPA 3KZWA 4X2TA 2FAVA 3EWRA 3SIIA 4D86A 4ABKA 3EJFA 4JGKA 3JZTA 4ETJA 3SIJA 3KR4A 3JRUA 4ZY2A 3SIHA 3IIDA 1BLLE 4J5RA 3IJ3A 2EEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAN A;  5AIL A;  4ZI6 A;  1LAM A;  2FG1 A;  4KYB A;  4ESS A;  5HIH A;  4ZY1 A;  4JLL A;  3PEI A;  5HOL A;  1BPN A;  4JCA A;  2VRI A;  3GPO A;  4R7M A;  4ZX8 A;  5FSV A;  3ETI A;  1SPV A;  5D8N A;  3H8E A;  4TU0 A;  5FSY A;  2XD7 A;  5CBM A;  4ABL A;  1TXZ A;  1YD9 A;  2AFC A;  4UML A;  4J5S A;  1BPM A;  3V2B A;  3EKE A;  2BFR A;  3H8G A;  1GYT A;  2DX6 A;  5FSU A;  4K0C A;  3EWP A;  3EW5 A;  4JVV A;  5FSX A;  3IIF A;  1ZR5 A;  3Q71 A;  4ETK A;  1HJZ A;  1LCP A;  2LGR A;  2ACF A;  3EJG A;  3EWO A;  2J9A A;  3GQO A;  4ZX9 A;  3VFQ A;  4ZYQ A;  2EWB A;  4GUA A;  3EWQ A;  3KQX A;  5CB5 A;  5DUS A;  1NJR A;  4IQY A;  2FXK A;  5FSZ A;  3V45 A;  3T8W A;  2BFQ A;  4ZY0 A;  5CMS A;  3KQZ A;  5CB3 A;  4J4Z A;  3Q6Z A;  4J5Q A;  1VHU A;  4KSI A;  1TY8 A;  4K3N A;  3GQE A;  2L8R A;  2X47 A;  3H8F A;  4R76 A;  4R6T A;  4GVV A;  3KR5 A;  4GVW A;  1ZR3 A;  3GPQ A;  3SIG A;  3GPG A;  5E3B A;  1LAP A;  3KZW A;  4X2T A;  2FAV A;  3EWR A;  3SII A;  4D86 A;  4ABK A;  3EJF A;  4JGK A;  3JZT A;  4ETJ A;  3SIJ A;  3KR4 A;  3JRU A;  4ZY2 A;  3SIH A;  3IID A;  1BLL E;  4J5R A;  3IJ3 A;  2EEE A; 
#chains in the Genus database with same CATH topology
 1LAN A;  5AIL A;  4ZI6 A;  1LAM A;  2FG1 A;  4KYB A;  4ESS A;  2JZE A;  5HIH A;  4ZY1 A;  4JLL A;  3PEI A;  5HOL A;  1BPN A;  2JZD A;  4JCA A;  2VRI A;  3GPO A;  4R7M A;  4ZX8 A;  5FSV A;  3ETI A;  1SPV A;  5D8N A;  3H8E A;  4TU0 A;  5FSY A;  2XD7 A;  5CBM A;  4ABL A;  1TXZ A;  1YD9 A;  2AFC A;  2JZF A;  4UML A;  4J5S A;  1BPM A;  3V2B A;  3EKE A;  2BFR A;  3H8G A;  1GYT A;  2DX6 A;  5FSU A;  4K0C A;  3EWP A;  3EW5 A;  2RNK A;  4JVV A;  5FSX A;  3IIF A;  1ZR5 A;  2W2G A;  3Q71 A;  4ETK A;  1HJZ A;  1LCP A;  2LGR A;  2ACF A;  3EJG A;  3EWO A;  2J9A A;  3GQO A;  4ZX9 A;  3VFQ A;  4ZYQ A;  2EWB A;  4GUA A;  3EWQ A;  3KQX A;  5CB5 A;  5DUS A;  1NJR A;  4IQY A;  2FXK A;  5FSZ A;  3V45 A;  3T8W A;  2BFQ A;  4ZY0 A;  5CMS A;  3KQZ A;  5CB3 A;  4J4Z A;  3Q6Z A;  4J5Q A;  1VHU A;  4KSI A;  1TY8 A;  4K3N A;  3GQE A;  2L8R A;  2X47 A;  3H8F A;  4R76 A;  4R6T A;  4GVV A;  3KR5 A;  4GVW A;  1ZR3 A;  3GPQ A;  2KQV A;  3SIG A;  3GPG A;  5E3B A;  1LAP A;  3KZW A;  4X2T A;  2FAV A;  3EWR A;  3SII A;  4D86 A;  4ABK A;  3EJF A;  4JGK A;  3JZT A;  4ETJ A;  3SIJ A;  3KR4 A;  3JRU A;  4ZY2 A;  3SIH A;  2WCT A;  3IID A;  1BLL E;  4J5R A;  3IJ3 A;  2EEE A; 
#chains in the Genus database with same CATH homology
 1LAN A;  5AIL A;  4ZI6 A;  1LAM A;  2FG1 A;  4KYB A;  4ESS A;  5HIH A;  4ZY1 A;  4JLL A;  3PEI A;  5HOL A;  1BPN A;  4JCA A;  2VRI A;  3GPO A;  4R7M A;  4ZX8 A;  5FSV A;  3ETI A;  1SPV A;  5D8N A;  3H8E A;  4TU0 A;  5FSY A;  2XD7 A;  5CBM A;  4ABL A;  1TXZ A;  1YD9 A;  2AFC A;  4UML A;  4J5S A;  1BPM A;  3V2B A;  3EKE A;  2BFR A;  3H8G A;  1GYT A;  2DX6 A;  5FSU A;  4K0C A;  3EWP A;  3EW5 A;  4JVV A;  5FSX A;  3IIF A;  1ZR5 A;  3Q71 A;  4ETK A;  1HJZ A;  1LCP A;  2LGR A;  2ACF A;  3EJG A;  3EWO A;  2J9A A;  3GQO A;  4ZX9 A;  3VFQ A;  4ZYQ A;  2EWB A;  4GUA A;  3EWQ A;  3KQX A;  5CB5 A;  5DUS A;  1NJR A;  4IQY A;  2FXK A;  5FSZ A;  3V45 A;  3T8W A;  2BFQ A;  4ZY0 A;  5CMS A;  3KQZ A;  5CB3 A;  4J4Z A;  3Q6Z A;  4J5Q A;  1VHU A;  4KSI A;  1TY8 A;  4K3N A;  3GQE A;  2L8R A;  2X47 A;  3H8F A;  4R76 A;  4R6T A;  4GVV A;  3KR5 A;  4GVW A;  1ZR3 A;  3GPQ A;  3SIG A;  3GPG A;  5E3B A;  1LAP A;  3KZW A;  4X2T A;  2FAV A;  3EWR A;  3SII A;  4D86 A;  4ABK A;  3EJF A;  4JGK A;  3JZT A;  4ETJ A;  3SIJ A;  3KR4 A;  3JRU A;  4ZY2 A;  3SIH A;  3IID A;  1BLL E;  4J5R A;  3IJ3 A;  2EEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...