4J5QA

Targ1 (c6orf130), terminal adp-ribose glycohydrolase 1, apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
EDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords O-acetyl-ADP-ribose deacetylase 1
publication title Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 146
sequence length 146
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j5qA01
4K0CA 4ZYQA 3ETIA 3EKEA 4GUAA 4R6TA 4ESSA 3Q71A 3IJ3A 4K3NA 3GPGA 4ZY2A 1NJRA 1LCPA 2AFCA 3GQEA 3EW5A 4KSIA 4JCAA 3JRUA 2BFRA 4J5RA 3SIJA 4J4ZA 4R7MA 2EEEA 3T8WA 4ZX9A 4JLLA 5HOLA 4J5SA 1HJZA 4X2TA 3EWQA 5FSVA 3VFQA 3EWPA 4J5QA 3EWRA 4TU0A 1BPMA 5E3BA 3KQXA 4ABKA 3H8FA 3H8EA 4ABLA 2EWBA 4GVWA 4IQYA 1YD9A 3EJGA 3KR5A 5FSUA 3IIFA 3KQZA 1LANA 3SIHA 4R76A 5HIHA 2ACFA 3Q6ZA 4JGKA 3GQOA 4UMLA 4GVVA 1ZR5A 2FXKA 5FSZA 1TXZA 4ZI6A 2LGRA 3H8GA 1LAPA 3SIGA 2BFQA 5FSYA 5CB5A 3GPQA 1ZR3A 4JVVA 5CB3A 3SIIA 5FSXA 2FAVA 1TY8A 5CBMA 4ETJA 5CMSA 1SPVA 2DX6A 3PEIA 1VHUA 5D8NA 4ETKA 2XD7A 2J9AA 3V45A 4ZY1A 1GYTA 3EJFA 2FG1A 3KR4A 2X47A 3EWOA 1LAMA 4ZY0A 3JZTA 4D86A 3V2BA 1BLLE 4KYBA 4ZX8A 2L8RA 5DUSA 3KZWA 1BPNA 5AILA 3GPOA 3IIDA 2VRIA
chains in the Genus database with same CATH superfamily
4K0CA 4ZYQA 3ETIA 3EKEA 2WCTA 4GUAA 4R6TA 4ESSA 3Q71A 3IJ3A 4K3NA 3GPGA 4ZY2A 1NJRA 1LCPA 2AFCA 3GQEA 3EW5A 4KSIA 4JCAA 3JRUA 2BFRA 4J5RA 3SIJA 4J4ZA 4R7MA 2EEEA 3T8WA 4ZX9A 4JLLA 5HOLA 4J5SA 1HJZA 4X2TA 2W2GA 3EWQA 5FSVA 3VFQA 3EWPA 4J5QA 3EWRA 4TU0A 1BPMA 5E3BA 3KQXA 4ABKA 3H8FA 3H8EA 4ABLA 2EWBA 4GVWA 4IQYA 1YD9A 3EJGA 2JZEA 3KR5A 5FSUA 3IIFA 3KQZA 1LANA 3SIHA 4R76A 5HIHA 2ACFA 3Q6ZA 4JGKA 3GQOA 2JZFA 4UMLA 4GVVA 1ZR5A 2FXKA 5FSZA 1TXZA 4ZI6A 2LGRA 3H8GA 1LAPA 2RNKA 3SIGA 2BFQA 2KQVA 5FSYA 5CB5A 3GPQA 1ZR3A 4JVVA 5CB3A 3SIIA 5FSXA 2FAVA 1TY8A 5CBMA 4ETJA 5CMSA 1SPVA 2DX6A 3PEIA 1VHUA 5D8NA 4ETKA 2XD7A 2J9AA 3V45A 4ZY1A 1GYTA 3EJFA 2FG1A 3KR4A 2X47A 3EWOA 1LAMA 4ZY0A 3JZTA 4D86A 3V2BA 1BLLE 4KYBA 4ZX8A 2L8RA 5DUSA 2JZDA 3KZWA 1BPNA 5AILA 3GPOA 3IIDA 2VRIA
chains in the Genus database with same CATH topology
4K0CA 4ZYQA 3ETIA 3EKEA 4GUAA 4R6TA 4ESSA 3Q71A 3IJ3A 4K3NA 3GPGA 4ZY2A 1NJRA 1LCPA 2AFCA 3GQEA 3EW5A 4KSIA 4JCAA 3JRUA 2BFRA 4J5RA 3SIJA 4J4ZA 4R7MA 2EEEA 3T8WA 4ZX9A 4JLLA 5HOLA 4J5SA 1HJZA 4X2TA 3EWQA 5FSVA 3VFQA 3EWPA 4J5QA 3EWRA 4TU0A 1BPMA 5E3BA 3KQXA 4ABKA 3H8FA 3H8EA 4ABLA 2EWBA 4GVWA 4IQYA 1YD9A 3EJGA 3KR5A 5FSUA 3IIFA 3KQZA 1LANA 3SIHA 4R76A 5HIHA 2ACFA 3Q6ZA 4JGKA 3GQOA 4UMLA 4GVVA 1ZR5A 2FXKA 5FSZA 1TXZA 4ZI6A 2LGRA 3H8GA 1LAPA 3SIGA 2BFQA 5FSYA 5CB5A 3GPQA 1ZR3A 4JVVA 5CB3A 3SIIA 5FSXA 2FAVA 1TY8A 5CBMA 4ETJA 5CMSA 1SPVA 2DX6A 3PEIA 1VHUA 5D8NA 4ETKA 2XD7A 2J9AA 3V45A 4ZY1A 1GYTA 3EJFA 2FG1A 3KR4A 2X47A 3EWOA 1LAMA 4ZY0A 3JZTA 4D86A 3V2BA 1BLLE 4KYBA 4ZX8A 2L8RA 5DUSA 3KZWA 1BPNA 5AILA 3GPOA 3IIDA 2VRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0C A;  4ZYQ A;  3ETI A;  3EKE A;  4GUA A;  4R6T A;  4ESS A;  3Q71 A;  3IJ3 A;  4K3N A;  3GPG A;  4ZY2 A;  1NJR A;  1LCP A;  2AFC A;  3GQE A;  3EW5 A;  4KSI A;  4JCA A;  3JRU A;  2BFR A;  4J5R A;  3SIJ A;  4J4Z A;  4R7M A;  2EEE A;  3T8W A;  4ZX9 A;  4JLL A;  5HOL A;  4J5S A;  1HJZ A;  4X2T A;  3EWQ A;  5FSV A;  3VFQ A;  3EWP A;  4J5Q A;  3EWR A;  4TU0 A;  1BPM A;  5E3B A;  3KQX A;  4ABK A;  3H8F A;  3H8E A;  4ABL A;  2EWB A;  4GVW A;  4IQY A;  1YD9 A;  3EJG A;  3KR5 A;  5FSU A;  3IIF A;  3KQZ A;  1LAN A;  3SIH A;  4R76 A;  5HIH A;  2ACF A;  3Q6Z A;  4JGK A;  3GQO A;  4UML A;  4GVV A;  1ZR5 A;  2FXK A;  5FSZ A;  1TXZ A;  4ZI6 A;  2LGR A;  3H8G A;  1LAP A;  3SIG A;  2BFQ A;  5FSY A;  5CB5 A;  3GPQ A;  1ZR3 A;  4JVV A;  5CB3 A;  3SII A;  5FSX A;  2FAV A;  1TY8 A;  5CBM A;  4ETJ A;  5CMS A;  1SPV A;  2DX6 A;  3PEI A;  1VHU A;  5D8N A;  4ETK A;  2XD7 A;  2J9A A;  3V45 A;  4ZY1 A;  1GYT A;  3EJF A;  2FG1 A;  3KR4 A;  2X47 A;  3EWO A;  1LAM A;  4ZY0 A;  3JZT A;  4D86 A;  3V2B A;  1BLL E;  4KYB A;  4ZX8 A;  2L8R A;  5DUS A;  3KZW A;  1BPN A;  5AIL A;  3GPO A;  3IID A;  2VRI A; 
#chains in the Genus database with same CATH topology
 4K0C A;  4ZYQ A;  3ETI A;  3EKE A;  2WCT A;  4GUA A;  4R6T A;  4ESS A;  3Q71 A;  3IJ3 A;  4K3N A;  3GPG A;  4ZY2 A;  1NJR A;  1LCP A;  2AFC A;  3GQE A;  3EW5 A;  4KSI A;  4JCA A;  3JRU A;  2BFR A;  4J5R A;  3SIJ A;  4J4Z A;  4R7M A;  2EEE A;  3T8W A;  4ZX9 A;  4JLL A;  5HOL A;  4J5S A;  1HJZ A;  4X2T A;  2W2G A;  3EWQ A;  5FSV A;  3VFQ A;  3EWP A;  4J5Q A;  3EWR A;  4TU0 A;  1BPM A;  5E3B A;  3KQX A;  4ABK A;  3H8F A;  3H8E A;  4ABL A;  2EWB A;  4GVW A;  4IQY A;  1YD9 A;  3EJG A;  2JZE A;  3KR5 A;  5FSU A;  3IIF A;  3KQZ A;  1LAN A;  3SIH A;  4R76 A;  5HIH A;  2ACF A;  3Q6Z A;  4JGK A;  3GQO A;  2JZF A;  4UML A;  4GVV A;  1ZR5 A;  2FXK A;  5FSZ A;  1TXZ A;  4ZI6 A;  2LGR A;  3H8G A;  1LAP A;  2RNK A;  3SIG A;  2BFQ A;  2KQV A;  5FSY A;  5CB5 A;  3GPQ A;  1ZR3 A;  4JVV A;  5CB3 A;  3SII A;  5FSX A;  2FAV A;  1TY8 A;  5CBM A;  4ETJ A;  5CMS A;  1SPV A;  2DX6 A;  3PEI A;  1VHU A;  5D8N A;  4ETK A;  2XD7 A;  2J9A A;  3V45 A;  4ZY1 A;  1GYT A;  3EJF A;  2FG1 A;  3KR4 A;  2X47 A;  3EWO A;  1LAM A;  4ZY0 A;  3JZT A;  4D86 A;  3V2B A;  1BLL E;  4KYB A;  4ZX8 A;  2L8R A;  5DUS A;  2JZD A;  3KZW A;  1BPN A;  5AIL A;  3GPO A;  3IID A;  2VRI A; 
#chains in the Genus database with same CATH homology
 4K0C A;  4ZYQ A;  3ETI A;  3EKE A;  4GUA A;  4R6T A;  4ESS A;  3Q71 A;  3IJ3 A;  4K3N A;  3GPG A;  4ZY2 A;  1NJR A;  1LCP A;  2AFC A;  3GQE A;  3EW5 A;  4KSI A;  4JCA A;  3JRU A;  2BFR A;  4J5R A;  3SIJ A;  4J4Z A;  4R7M A;  2EEE A;  3T8W A;  4ZX9 A;  4JLL A;  5HOL A;  4J5S A;  1HJZ A;  4X2T A;  3EWQ A;  5FSV A;  3VFQ A;  3EWP A;  4J5Q A;  3EWR A;  4TU0 A;  1BPM A;  5E3B A;  3KQX A;  4ABK A;  3H8F A;  3H8E A;  4ABL A;  2EWB A;  4GVW A;  4IQY A;  1YD9 A;  3EJG A;  3KR5 A;  5FSU A;  3IIF A;  3KQZ A;  1LAN A;  3SIH A;  4R76 A;  5HIH A;  2ACF A;  3Q6Z A;  4JGK A;  3GQO A;  4UML A;  4GVV A;  1ZR5 A;  2FXK A;  5FSZ A;  1TXZ A;  4ZI6 A;  2LGR A;  3H8G A;  1LAP A;  3SIG A;  2BFQ A;  5FSY A;  5CB5 A;  3GPQ A;  1ZR3 A;  4JVV A;  5CB3 A;  3SII A;  5FSX A;  2FAV A;  1TY8 A;  5CBM A;  4ETJ A;  5CMS A;  1SPV A;  2DX6 A;  3PEI A;  1VHU A;  5D8N A;  4ETK A;  2XD7 A;  2J9A A;  3V45 A;  4ZY1 A;  1GYT A;  3EJF A;  2FG1 A;  3KR4 A;  2X47 A;  3EWO A;  1LAM A;  4ZY0 A;  3JZT A;  4D86 A;  3V2B A;  1BLL E;  4KYB A;  4ZX8 A;  2L8R A;  5DUS A;  3KZW A;  1BPN A;  5AIL A;  3GPO A;  3IID A;  2VRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...