4J5QA

Targ1 (c6orf130), terminal adp-ribose glycohydrolase 1, apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
EDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords O-acetyl-ADP-ribose deacetylase 1
total genus 48
structure length 146
sequence length 146
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j5qA01
4R7MA 3ETIA 5CMSA 4D86A 3JRUA 4KYBA 4ZY0A 4ZX9A 3T8WA 2AFCA 4ETJA 3KQXA 3V45A 2BFQA 1TY8A 1TXZA 4GUAA 2DX6A 3EJGA 2L8RA 3EWOA 5CBMA 4R6TA 5D8NA 4ZX8A 2VRIA 1LCPA 3GPOA 3GPQA 3KR4A 4GVWA 2EWBA 5FSZA 4JCAA 2XD7A 2FAVA 4J4ZA 4J5RA 3H8GA 3EJFA 4TU0A 2EEEA 1BPNA 4JLLA 3V2BA 1NJRA 4JGKA 3SIJA 4ABKA 4X2TA 1BPMA 4J5SA 4ZI6A 4ABLA 2J9AA 3EW5A 3GPGA 4KSIA 3EWRA 5FSVA 1ZR5A 1LAPA 4ZY2A 1ZR3A 3SIIA 4ZYQA 4IQYA 5CB3A 3Q71A 2ACFA 3IIDA 5AILA 5HIHA 3VFQA 2BFRA 4ETKA 3KR5A 1LANA 5E3BA 4ZY1A 3KZWA 3H8FA 3EWPA 1GYTA 1LAMA 4UMLA 4J5QA 2FXKA 4ESSA 3EKEA 4K0CA 3PEIA 3GQEA 3H8EA 3JZTA 1YD9A 3IJ3A 5HOLA 3SIHA 4JVVA 4R76A 3KQZA 1VHUA 5DUSA 2FG1A 3GQOA 3IIFA 5CB5A 3EWQA 5FSYA 2LGRA 4K3NA 3SIGA 5FSUA 5FSXA 4GVVA 1SPVA 1HJZA 3Q6ZA 1BLLE 2X47A
chains in the Genus database with same CATH superfamily
2JZDA 4R7MA 3ETIA 5CMSA 4D86A 3JRUA 4KYBA 4ZY0A 4ZX9A 3T8WA 2AFCA 4ETJA 3KQXA 3V45A 2W2GA 2BFQA 1TY8A 1TXZA 4GUAA 2DX6A 3EJGA 2L8RA 3EWOA 5CBMA 4R6TA 2KQVA 5D8NA 4ZX8A 2VRIA 1LCPA 3GPOA 3GPQA 3KR4A 4GVWA 2EWBA 5FSZA 4JCAA 2XD7A 2FAVA 4J4ZA 4J5RA 3H8GA 3EJFA 4TU0A 2EEEA 1BPNA 4JLLA 3V2BA 1NJRA 4JGKA 3SIJA 4ABKA 4X2TA 1BPMA 4J5SA 4ZI6A 4ABLA 2J9AA 3EW5A 3GPGA 4KSIA 3EWRA 5FSVA 1ZR5A 1LAPA 4ZY2A 1ZR3A 3SIIA 4ZYQA 4IQYA 5CB3A 3Q71A 2ACFA 3IIDA 5AILA 5HIHA 3VFQA 2BFRA 2WCTA 4ETKA 3KR5A 1LANA 5E3BA 4ZY1A 3KZWA 3H8FA 3EWPA 1GYTA 1LAMA 4UMLA 4J5QA 2FXKA 4ESSA 3EKEA 4K0CA 3PEIA 3GQEA 3H8EA 3JZTA 2JZEA 1YD9A 3IJ3A 5HOLA 3SIHA 4JVVA 4R76A 3KQZA 1VHUA 5DUSA 2FG1A 3GQOA 3IIFA 5CB5A 3EWQA 5FSYA 2LGRA 4K3NA 3SIGA 5FSUA 5FSXA 4GVVA 2RNKA 1SPVA 1HJZA 3Q6ZA 1BLLE 2X47A 2JZFA
chains in the Genus database with same CATH topology
4R7MA 3ETIA 5CMSA 4D86A 3JRUA 4KYBA 4ZY0A 4ZX9A 3T8WA 2AFCA 4ETJA 3KQXA 3V45A 2BFQA 1TY8A 1TXZA 4GUAA 2DX6A 3EJGA 2L8RA 3EWOA 5CBMA 4R6TA 5D8NA 4ZX8A 2VRIA 1LCPA 3GPOA 3GPQA 3KR4A 4GVWA 2EWBA 5FSZA 4JCAA 2XD7A 2FAVA 4J4ZA 4J5RA 3H8GA 3EJFA 4TU0A 2EEEA 1BPNA 4JLLA 3V2BA 1NJRA 4JGKA 3SIJA 4ABKA 4X2TA 1BPMA 4J5SA 4ZI6A 4ABLA 2J9AA 3EW5A 3GPGA 4KSIA 3EWRA 5FSVA 1ZR5A 1LAPA 4ZY2A 1ZR3A 3SIIA 4ZYQA 4IQYA 5CB3A 3Q71A 2ACFA 3IIDA 5AILA 5HIHA 3VFQA 2BFRA 4ETKA 3KR5A 1LANA 5E3BA 4ZY1A 3KZWA 3H8FA 3EWPA 1GYTA 1LAMA 4UMLA 4J5QA 2FXKA 4ESSA 3EKEA 4K0CA 3PEIA 3GQEA 3H8EA 3JZTA 1YD9A 3IJ3A 5HOLA 3SIHA 4JVVA 4R76A 3KQZA 1VHUA 5DUSA 2FG1A 3GQOA 3IIFA 5CB5A 3EWQA 5FSYA 2LGRA 4K3NA 3SIGA 5FSUA 5FSXA 4GVVA 1SPVA 1HJZA 3Q6ZA 1BLLE 2X47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7M A;  3ETI A;  5CMS A;  4D86 A;  3JRU A;  4KYB A;  4ZY0 A;  4ZX9 A;  3T8W A;  2AFC A;  4ETJ A;  3KQX A;  3V45 A;  2BFQ A;  1TY8 A;  1TXZ A;  4GUA A;  2DX6 A;  3EJG A;  2L8R A;  3EWO A;  5CBM A;  4R6T A;  5D8N A;  4ZX8 A;  2VRI A;  1LCP A;  3GPO A;  3GPQ A;  3KR4 A;  4GVW A;  2EWB A;  5FSZ A;  4JCA A;  2XD7 A;  2FAV A;  4J4Z A;  4J5R A;  3H8G A;  3EJF A;  4TU0 A;  2EEE A;  1BPN A;  4JLL A;  3V2B A;  1NJR A;  4JGK A;  3SIJ A;  4ABK A;  4X2T A;  1BPM A;  4J5S A;  4ZI6 A;  4ABL A;  2J9A A;  3EW5 A;  3GPG A;  4KSI A;  3EWR A;  5FSV A;  1ZR5 A;  1LAP A;  4ZY2 A;  1ZR3 A;  3SII A;  4ZYQ A;  4IQY A;  5CB3 A;  3Q71 A;  2ACF A;  3IID A;  5AIL A;  5HIH A;  3VFQ A;  2BFR A;  4ETK A;  3KR5 A;  1LAN A;  5E3B A;  4ZY1 A;  3KZW A;  3H8F A;  3EWP A;  1GYT A;  1LAM A;  4UML A;  4J5Q A;  2FXK A;  4ESS A;  3EKE A;  4K0C A;  3PEI A;  3GQE A;  3H8E A;  3JZT A;  1YD9 A;  3IJ3 A;  5HOL A;  3SIH A;  4JVV A;  4R76 A;  3KQZ A;  1VHU A;  5DUS A;  2FG1 A;  3GQO A;  3IIF A;  5CB5 A;  3EWQ A;  5FSY A;  2LGR A;  4K3N A;  3SIG A;  5FSU A;  5FSX A;  4GVV A;  1SPV A;  1HJZ A;  3Q6Z A;  1BLL E;  2X47 A; 
#chains in the Genus database with same CATH topology
 2JZD A;  4R7M A;  3ETI A;  5CMS A;  4D86 A;  3JRU A;  4KYB A;  4ZY0 A;  4ZX9 A;  3T8W A;  2AFC A;  4ETJ A;  3KQX A;  3V45 A;  2W2G A;  2BFQ A;  1TY8 A;  1TXZ A;  4GUA A;  2DX6 A;  3EJG A;  2L8R A;  3EWO A;  5CBM A;  4R6T A;  2KQV A;  5D8N A;  4ZX8 A;  2VRI A;  1LCP A;  3GPO A;  3GPQ A;  3KR4 A;  4GVW A;  2EWB A;  5FSZ A;  4JCA A;  2XD7 A;  2FAV A;  4J4Z A;  4J5R A;  3H8G A;  3EJF A;  4TU0 A;  2EEE A;  1BPN A;  4JLL A;  3V2B A;  1NJR A;  4JGK A;  3SIJ A;  4ABK A;  4X2T A;  1BPM A;  4J5S A;  4ZI6 A;  4ABL A;  2J9A A;  3EW5 A;  3GPG A;  4KSI A;  3EWR A;  5FSV A;  1ZR5 A;  1LAP A;  4ZY2 A;  1ZR3 A;  3SII A;  4ZYQ A;  4IQY A;  5CB3 A;  3Q71 A;  2ACF A;  3IID A;  5AIL A;  5HIH A;  3VFQ A;  2BFR A;  2WCT A;  4ETK A;  3KR5 A;  1LAN A;  5E3B A;  4ZY1 A;  3KZW A;  3H8F A;  3EWP A;  1GYT A;  1LAM A;  4UML A;  4J5Q A;  2FXK A;  4ESS A;  3EKE A;  4K0C A;  3PEI A;  3GQE A;  3H8E A;  3JZT A;  2JZE A;  1YD9 A;  3IJ3 A;  5HOL A;  3SIH A;  4JVV A;  4R76 A;  3KQZ A;  1VHU A;  5DUS A;  2FG1 A;  3GQO A;  3IIF A;  5CB5 A;  3EWQ A;  5FSY A;  2LGR A;  4K3N A;  3SIG A;  5FSU A;  5FSX A;  4GVV A;  2RNK A;  1SPV A;  1HJZ A;  3Q6Z A;  1BLL E;  2X47 A;  2JZF A; 
#chains in the Genus database with same CATH homology
 4R7M A;  3ETI A;  5CMS A;  4D86 A;  3JRU A;  4KYB A;  4ZY0 A;  4ZX9 A;  3T8W A;  2AFC A;  4ETJ A;  3KQX A;  3V45 A;  2BFQ A;  1TY8 A;  1TXZ A;  4GUA A;  2DX6 A;  3EJG A;  2L8R A;  3EWO A;  5CBM A;  4R6T A;  5D8N A;  4ZX8 A;  2VRI A;  1LCP A;  3GPO A;  3GPQ A;  3KR4 A;  4GVW A;  2EWB A;  5FSZ A;  4JCA A;  2XD7 A;  2FAV A;  4J4Z A;  4J5R A;  3H8G A;  3EJF A;  4TU0 A;  2EEE A;  1BPN A;  4JLL A;  3V2B A;  1NJR A;  4JGK A;  3SIJ A;  4ABK A;  4X2T A;  1BPM A;  4J5S A;  4ZI6 A;  4ABL A;  2J9A A;  3EW5 A;  3GPG A;  4KSI A;  3EWR A;  5FSV A;  1ZR5 A;  1LAP A;  4ZY2 A;  1ZR3 A;  3SII A;  4ZYQ A;  4IQY A;  5CB3 A;  3Q71 A;  2ACF A;  3IID A;  5AIL A;  5HIH A;  3VFQ A;  2BFR A;  4ETK A;  3KR5 A;  1LAN A;  5E3B A;  4ZY1 A;  3KZW A;  3H8F A;  3EWP A;  1GYT A;  1LAM A;  4UML A;  4J5Q A;  2FXK A;  4ESS A;  3EKE A;  4K0C A;  3PEI A;  3GQE A;  3H8E A;  3JZT A;  1YD9 A;  3IJ3 A;  5HOL A;  3SIH A;  4JVV A;  4R76 A;  3KQZ A;  1VHU A;  5DUS A;  2FG1 A;  3GQO A;  3IIF A;  5CB5 A;  3EWQ A;  5FSY A;  2LGR A;  4K3N A;  3SIG A;  5FSU A;  5FSX A;  4GVV A;  1SPV A;  1HJZ A;  3Q6Z A;  1BLL E;  2X47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...