3GPOA

Crystal structure of macro domain of chikungunya virus in complex with adp-ribose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
HHAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYSESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of Chikungunya and Venezuelan equine encephalitis virus nsP3 macro domains define a conserved adenosine binding pocket
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
molecule keywords Non-structural protein 3
total genus 51
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3gpoA00
3ETIA 3EJFA 4ETJA 5E3BA 1GYTA 4JVVA 1ZR3A 2BFRA 4R6TA 4X2TA 4J5QA 4R7MA 3GPOA 4GVVA 4JLLA 4J5SA 1LCPA 3Q6ZA 3SIGA 4ETKA 2FAVA 3KR5A 4J4ZA 3GQOA 2FXKA 4ESSA 2XD7A 3KQXA 3KR4A 5DUSA 3EWOA 3JRUA 4KYBA 4ZX9A 3KZWA 5FSVA 4JCAA 1ZR5A 1TY8A 3JZTA 4UMLA 3T8WA 2BFQA 3Q71A 3GPGA 2ACFA 5FSXA 3EWPA 3SIJA 5AILA 1VHUA 1BPMA 3H8GA 5CMSA 1BLLE 3GPQA 4K0CA 4TU0A 2LGRA 4ZX8A 4ZYQA 3EWRA 4R76A 4ZY0A 3EWQA 3EKEA 3SIHA 4ABKA 1BPNA 3IIDA 5HOLA 5CB3A 2J9AA 4GUAA 4ZY1A 3GQEA 3IIFA 5CBMA 1HJZA 5D8NA 2VRIA 2DX6A 1LAMA 4IQYA 5CB5A 2AFCA 3IJ3A 4J5RA 3PEIA 2FG1A 3H8FA 3SIIA 4JGKA 3H8EA 1NJRA 2L8RA 2X47A 5FSUA 3V45A 2EEEA 1YD9A 2EWBA 5HIHA 5FSYA 4ZY2A 4GVWA 1SPVA 4D86A 4ZI6A 1TXZA 3VFQA 4KSIA 4ABLA 1LANA 3EJGA 4K3NA 3EW5A 1LAPA 5FSZA 3KQZA 3V2BA
chains in the Genus database with same CATH superfamily
3ETIA 3EJFA 4ETJA 5E3BA 1GYTA 4JVVA 1ZR3A 2BFRA 4R6TA 4X2TA 4J5QA 4R7MA 3GPOA 4GVVA 4JLLA 4J5SA 1LCPA 3Q6ZA 3SIGA 4ETKA 2FAVA 3KR5A 4J4ZA 3GQOA 2FXKA 4ESSA 2XD7A 3KQXA 3KR4A 5DUSA 3EWOA 3JRUA 4KYBA 4ZX9A 3KZWA 5FSVA 4JCAA 1ZR5A 1TY8A 3JZTA 4UMLA 3T8WA 2RNKA 2BFQA 3Q71A 3GPGA 2ACFA 2W2GA 5FSXA 3EWPA 3SIJA 2JZEA 5AILA 1VHUA 1BPMA 3H8GA 5CMSA 1BLLE 3GPQA 4K0CA 4TU0A 2LGRA 4ZX8A 4ZYQA 2JZDA 3EWRA 2KQVA 4R76A 2WCTA 4ZY0A 3EWQA 3EKEA 3SIHA 4ABKA 1BPNA 3IIDA 5HOLA 5CB3A 2J9AA 4GUAA 4ZY1A 3GQEA 3IIFA 5CBMA 1HJZA 5D8NA 2VRIA 2DX6A 1LAMA 4IQYA 5CB5A 2AFCA 3IJ3A 2JZFA 4J5RA 3PEIA 2FG1A 3H8FA 3SIIA 4JGKA 3H8EA 1NJRA 2L8RA 2X47A 5FSUA 3V45A 2EEEA 1YD9A 2EWBA 5HIHA 5FSYA 4ZY2A 4GVWA 1SPVA 4D86A 4ZI6A 1TXZA 3VFQA 4KSIA 4ABLA 1LANA 3EJGA 4K3NA 3EW5A 1LAPA 5FSZA 3KQZA 3V2BA
chains in the Genus database with same CATH topology
3ETIA 3EJFA 4ETJA 5E3BA 1GYTA 4JVVA 1ZR3A 2BFRA 4R6TA 4X2TA 4J5QA 4R7MA 3GPOA 4GVVA 4JLLA 4J5SA 1LCPA 3Q6ZA 3SIGA 4ETKA 2FAVA 3KR5A 4J4ZA 3GQOA 2FXKA 4ESSA 2XD7A 3KQXA 3KR4A 5DUSA 3EWOA 3JRUA 4KYBA 4ZX9A 3KZWA 5FSVA 4JCAA 1ZR5A 1TY8A 3JZTA 4UMLA 3T8WA 2BFQA 3Q71A 3GPGA 2ACFA 5FSXA 3EWPA 3SIJA 5AILA 1VHUA 1BPMA 3H8GA 5CMSA 1BLLE 3GPQA 4K0CA 4TU0A 2LGRA 4ZX8A 4ZYQA 3EWRA 4R76A 4ZY0A 3EWQA 3EKEA 3SIHA 4ABKA 1BPNA 3IIDA 5HOLA 5CB3A 2J9AA 4GUAA 4ZY1A 3GQEA 3IIFA 5CBMA 1HJZA 5D8NA 2VRIA 2DX6A 1LAMA 4IQYA 5CB5A 2AFCA 3IJ3A 4J5RA 3PEIA 2FG1A 3H8FA 3SIIA 4JGKA 3H8EA 1NJRA 2L8RA 2X47A 5FSUA 3V45A 2EEEA 1YD9A 2EWBA 5HIHA 5FSYA 4ZY2A 4GVWA 1SPVA 4D86A 4ZI6A 1TXZA 3VFQA 4KSIA 4ABLA 1LANA 3EJGA 4K3NA 3EW5A 1LAPA 5FSZA 3KQZA 3V2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETI A;  3EJF A;  4ETJ A;  5E3B A;  1GYT A;  4JVV A;  1ZR3 A;  2BFR A;  4R6T A;  4X2T A;  4J5Q A;  4R7M A;  3GPO A;  4GVV A;  4JLL A;  4J5S A;  1LCP A;  3Q6Z A;  3SIG A;  4ETK A;  2FAV A;  3KR5 A;  4J4Z A;  3GQO A;  2FXK A;  4ESS A;  2XD7 A;  3KQX A;  3KR4 A;  5DUS A;  3EWO A;  3JRU A;  4KYB A;  4ZX9 A;  3KZW A;  5FSV A;  4JCA A;  1ZR5 A;  1TY8 A;  3JZT A;  4UML A;  3T8W A;  2BFQ A;  3Q71 A;  3GPG A;  2ACF A;  5FSX A;  3EWP A;  3SIJ A;  5AIL A;  1VHU A;  1BPM A;  3H8G A;  5CMS A;  1BLL E;  3GPQ A;  4K0C A;  4TU0 A;  2LGR A;  4ZX8 A;  4ZYQ A;  3EWR A;  4R76 A;  4ZY0 A;  3EWQ A;  3EKE A;  3SIH A;  4ABK A;  1BPN A;  3IID A;  5HOL A;  5CB3 A;  2J9A A;  4GUA A;  4ZY1 A;  3GQE A;  3IIF A;  5CBM A;  1HJZ A;  5D8N A;  2VRI A;  2DX6 A;  1LAM A;  4IQY A;  5CB5 A;  2AFC A;  3IJ3 A;  4J5R A;  3PEI A;  2FG1 A;  3H8F A;  3SII A;  4JGK A;  3H8E A;  1NJR A;  2L8R A;  2X47 A;  5FSU A;  3V45 A;  2EEE A;  1YD9 A;  2EWB A;  5HIH A;  5FSY A;  4ZY2 A;  4GVW A;  1SPV A;  4D86 A;  4ZI6 A;  1TXZ A;  3VFQ A;  4KSI A;  4ABL A;  1LAN A;  3EJG A;  4K3N A;  3EW5 A;  1LAP A;  5FSZ A;  3KQZ A;  3V2B A; 
#chains in the Genus database with same CATH topology
 3ETI A;  3EJF A;  4ETJ A;  5E3B A;  1GYT A;  4JVV A;  1ZR3 A;  2BFR A;  4R6T A;  4X2T A;  4J5Q A;  4R7M A;  3GPO A;  4GVV A;  4JLL A;  4J5S A;  1LCP A;  3Q6Z A;  3SIG A;  4ETK A;  2FAV A;  3KR5 A;  4J4Z A;  3GQO A;  2FXK A;  4ESS A;  2XD7 A;  3KQX A;  3KR4 A;  5DUS A;  3EWO A;  3JRU A;  4KYB A;  4ZX9 A;  3KZW A;  5FSV A;  4JCA A;  1ZR5 A;  1TY8 A;  3JZT A;  4UML A;  3T8W A;  2RNK A;  2BFQ A;  3Q71 A;  3GPG A;  2ACF A;  2W2G A;  5FSX A;  3EWP A;  3SIJ A;  2JZE A;  5AIL A;  1VHU A;  1BPM A;  3H8G A;  5CMS A;  1BLL E;  3GPQ A;  4K0C A;  4TU0 A;  2LGR A;  4ZX8 A;  4ZYQ A;  2JZD A;  3EWR A;  2KQV A;  4R76 A;  2WCT A;  4ZY0 A;  3EWQ A;  3EKE A;  3SIH A;  4ABK A;  1BPN A;  3IID A;  5HOL A;  5CB3 A;  2J9A A;  4GUA A;  4ZY1 A;  3GQE A;  3IIF A;  5CBM A;  1HJZ A;  5D8N A;  2VRI A;  2DX6 A;  1LAM A;  4IQY A;  5CB5 A;  2AFC A;  3IJ3 A;  2JZF A;  4J5R A;  3PEI A;  2FG1 A;  3H8F A;  3SII A;  4JGK A;  3H8E A;  1NJR A;  2L8R A;  2X47 A;  5FSU A;  3V45 A;  2EEE A;  1YD9 A;  2EWB A;  5HIH A;  5FSY A;  4ZY2 A;  4GVW A;  1SPV A;  4D86 A;  4ZI6 A;  1TXZ A;  3VFQ A;  4KSI A;  4ABL A;  1LAN A;  3EJG A;  4K3N A;  3EW5 A;  1LAP A;  5FSZ A;  3KQZ A;  3V2B A; 
#chains in the Genus database with same CATH homology
 3ETI A;  3EJF A;  4ETJ A;  5E3B A;  1GYT A;  4JVV A;  1ZR3 A;  2BFR A;  4R6T A;  4X2T A;  4J5Q A;  4R7M A;  3GPO A;  4GVV A;  4JLL A;  4J5S A;  1LCP A;  3Q6Z A;  3SIG A;  4ETK A;  2FAV A;  3KR5 A;  4J4Z A;  3GQO A;  2FXK A;  4ESS A;  2XD7 A;  3KQX A;  3KR4 A;  5DUS A;  3EWO A;  3JRU A;  4KYB A;  4ZX9 A;  3KZW A;  5FSV A;  4JCA A;  1ZR5 A;  1TY8 A;  3JZT A;  4UML A;  3T8W A;  2BFQ A;  3Q71 A;  3GPG A;  2ACF A;  5FSX A;  3EWP A;  3SIJ A;  5AIL A;  1VHU A;  1BPM A;  3H8G A;  5CMS A;  1BLL E;  3GPQ A;  4K0C A;  4TU0 A;  2LGR A;  4ZX8 A;  4ZYQ A;  3EWR A;  4R76 A;  4ZY0 A;  3EWQ A;  3EKE A;  3SIH A;  4ABK A;  1BPN A;  3IID A;  5HOL A;  5CB3 A;  2J9A A;  4GUA A;  4ZY1 A;  3GQE A;  3IIF A;  5CBM A;  1HJZ A;  5D8N A;  2VRI A;  2DX6 A;  1LAM A;  4IQY A;  5CB5 A;  2AFC A;  3IJ3 A;  4J5R A;  3PEI A;  2FG1 A;  3H8F A;  3SII A;  4JGK A;  3H8E A;  1NJR A;  2L8R A;  2X47 A;  5FSU A;  3V45 A;  2EEE A;  1YD9 A;  2EWB A;  5HIH A;  5FSY A;  4ZY2 A;  4GVW A;  1SPV A;  4D86 A;  4ZI6 A;  1TXZ A;  3VFQ A;  4KSI A;  4ABL A;  1LAN A;  3EJG A;  4K3N A;  3EW5 A;  1LAP A;  5FSZ A;  3KQZ A;  3V2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...