2EWBA

The crystal structure of bovine lens leucine aminopeptidase in complex with zofenoprilat
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
486
structure length
486
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal Ion Substitution in the Catalytic Site Greatly Affects the Binding of Sulfhydryl-Containing Compounds to Leucyl Aminopeptidase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cytosol aminopeptidase
total genus 174
structure length 486
sequence length 486
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2ewbA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ewbA02
1PCAA 1NSAA 4NFRA 4DJLA 1QMUA 1TF9A 3L2NA 3KR4A 3D66A 1RTQA 4OC2A 2ZEEA 2CTCA 2VRIA 1F2OA 4JVVA 5LRJA 2Q51A 3V45A 3SIGA 2IMOA 3KR5A 4K0CA 4PXDA 1LCPA 3IIBA 3IO1A 4G1PA 2PJ0A 4OC4A 4YWYA 1VIXA 4J5RA 1YD9A 2IJZA 1SPVA 3PEIA 1BAVA 1CBXA 2C6PA 3D7GA 2J9AA 3PB9X 3FJUA 3SI2A 2PRQA 2X47A 4ETKA 1NJRA 3D4UA 4NGRA 1DTDA 1TXRA 3FEEA 4EMEA 1CPSA 1YW4A 4ESSA 4NJRA 4ONWA 3GQEA 2CTBA 3V38A 3HLPA 3KHZA 2PJ7A 3H8FA 5HXDA 5LYFA 5LYDA 2ZELA 4UIBA 5DS0A 4RUHA 2EWBA 4NGQA 5CMSA 3H8EA 4BD9A 3D67A 4J5SA 3WC5A 2RFHA 4J5QA 2IQ6A 4GUAA 3SIJA 7CPAA 2WYRA 2JEWA 4P45A 2PJBA 1FT7A 3RAMA 2ZOFA 5LRGA 5D8NA 1JQGA 4WJBA 2XEJA 4AXVA 4H2KA 4F9UA 1CG2A 2PJ1A 4GM5A 3I1UA 2GLFA 3NH4A 3VFQA 4MCSA 2AFCA 2PIZA 3NH5A 3B3VA 4ZX9A 1Z5RA 4OKOA 4MCRA 5F09A 2PIYA 2EEEA 3PBEA 4F9VA 4J4ZA 2PJ6A 4JYWA 3ETIA 1ELLP 2C1CA 3CT9A 4ABLA 5HVFA 1ZR3A 3GB0A 3K2KA 1IY7A 3SIHA 2PVWA 1HEEA 1YMEA 1TKJA 3EJFA 2PE3A 3SJFA 1R43A 1Q7LA 3KHXA 1ZG9A 3B3WA 3S9MA 3GPOA 4P4EA 2O4HA 3EWPA 3NH8A 4DYOA 2LGRA 1F57A 1XJOA 1ELMP 2ZEPA 3IJ3A 2V8HA 3S9LA 1ZG8A 2C6CA 1VGYA 2PJ9A 4CPAA 3EJGA 4P4BA 2BFQA 4X2TA 4FWUA 2HB6A 2XEIA 3SJGA 2ZEMA 5LYIA 2DEAA 2L8RA 4EWTA 1CP6A 2NSMA 2PJ5A 4A39A 3T8WA 2BFRA 4NGMA 3VH9A 2BOAA 2ZENA 1LANA 6CPAA 4B6ZA 4ZI6A 4R7MA 4P4DA 3SI1A 1R3NA 1HDUA 4MHZA 3KQZA 4TNUA 2V8DA 3ISXA 3MN8A 2O53A 5IB9A 4FBEA 4UEZA 4MHPA 1Z2LA 4A38A 1TKHA 2GLJA 1GYTA 2ZOGA 1F2PA 4PXCA 1PYTB 3VATA 4DUKA 4JCAA 1Y7EA 4OC1A 2QVPA 1TF8A 4YU9A 3D7FA 5D29A 1LAPA 2QYVA 3KGQA 4TWEA 2C6GA 4UF4A 4ZY0A 4FUUA 1IGBA 3TC8A 3K9TA 5HVGA 2CIJA 5K8MA 2EK9A 2PVVA 2ZEHA 4GVVA 5FSUA 1ARMA 3BXMA 3N5FA 4OIWA 2AFSA 1TY8A 2F7VA 3KASA 4X8IA 3Q71A 8CPAA 2PJ4A 2Q43A 3JRUA 1AYEA 2BO9A 4JLLA 2ZEGA 3EWQA 2JBJA 2PJ2A 1ARLA 5FSVA 5AILA 5HIHA 1OBRA 3PB8X 1XFOA 3Q6ZA 2AFXA 2ANPA 4IAVA 2V8VA 3IIDA 2AFZA 3EW5A 3CDXA 3GQOA 5JM6A 4P6YA 3V7ZA 2PJ8A 1UWYA 2OR4A 3PFOA 2G9DA 2RB7A 4ABKA 3LWUA 1ZR5A 4PXBA 1YSJA 2V8GA 3D7DA 3GPQA 1LAMA 5CB5A 1VHEA 2DX6A 2ZEDA 2OOTA 2AFWA 5K8OA 3PRTA 4FAIA 3QNVA 4MHNA 3PFEA 1H8LA 4IHMA 4UMLA 4MRIA 3B3CA 3FX6A 2AFOA 4UEEA 4NGSA 1CPXA 1LOKA 4ZX8A 5DUSA 1CP7A 3KQXA 5JH9A 1FNOA 4ZY1A 1TXZA 4D86A 2PCUA 4X3RA 3CPAA 5THWA 3LMSA 4OMEA 3FEDA 4UEFA 1AMPA 3B2YA 4F8ZA 4R6TA 3SIIA 2WZNA 4KYBA 2EK8A 3HUVA 3GPGA 3ISZA 5CB3A 3GUXA 4IQYA 2AFMA 3WC6A 3EKEA 2HC9A 2NYQA 1EE3P 4OP4A 2PJCA 3BHXA 1XRYA 5CBMA 4PXEA 4P44A 3DGVA 3B7IA 3IC1A 1Z8LA 3WABA 2XD7A 2XEGA 2ACFA 3SJXA 5FSYA 2POKA 2JBKA 4MXUA 4A37A 3EWRA 3JZTA 4IK2A 3PBBA 5E3BA 3KZWA 4MMOA 3B3TA 3VARA 5I4MA 3KL9A 1ZLHA 4OC3A 2ABZA 3TX8A 1XBUA 2VL1A 2ZEFA 4NGPA 2QJ8A 4TU0A 3FECA 3CPXA 1VHOA 3WC7A 3B3SA 2AFUA 1DE4C 4GVWA 3IWWA 5K8PA 3MRUA 2V77A 1Y0YA 1QQ9A 1TKFA 3FVLA 1YW6A 3GLJA 2XEFA 1HDQA 3B35A 3EWOA 4Z65A 4EFDA 4K3NA 4UIAA 4OC0A 5J1QA 3DLJA 5K8NA 3WT4A 5JGFA 2F8HA 4A94A 4JGKA 5HOLA 1XMBA 4NGTA 5HVHA 1Y0RA 1HJZA 1CX8A 2GU2A 4JZ0A 4ETJA 5CPAA 3PB4X 3D7HA 4W9YA 1VHUA 3FF3A 3IFEA 4NJQA 4MCPA 2GREA 2PJAA 4WWVA 3H8GA 4MHYA 4MCQA 3SI0A 5LYLA 3RZAA 3FMCA 2FXKA 2FAVA 2FVGA 2PJ3A 4OIDA 2I3CA 4P4IA 5FSZA 4LQGA 4PPZA 4PQAA 3FH4A 5ELYA 4ZYQA 3PB7X 3PB6X 3V2BA 4P4JA 3SJEA 4P10A 4KSIA 3NFZA 4R8FA 4ZY2A 2BCOA 4NGNA 4OC5A 1M4LA 1ZG7A 2ZEOA 2CF4A 5LRKA 3BI1A 1BPMA 4O23A 4Q7AA 3IEHA 3NA6A 4R76A 3RBUA 1LFWA 5FSXA 1BLLE 3S9NA 2FG1A 1BPNA 3IIFA 1ZLIA 2Q4ZA 3BI0A 3KI9A 1YLOA 4P4FA 3D68A 1KWMA
chains in the Genus database with same CATH superfamily
2Q44A 1PCAA 2EBJA 1KUYA 4B13A 1NSAA 2BL1A 2JDCA 4NFRA 4DJLA 4CS0B 1QMUA 2GE3A 3S6FA 3GY9A 1TF9A 3CZXA 3EO4A 3L2NA 1SQHA 3R9FA 5AG6A 3KR4A 1IOIA 3C26A 3QAHA 5H86A 3D66A 1RTQA 4OC2A 2ZEEA 5AG5A 3UY5A 2CTCA 3E0KA 5BWAB 1KZFA 2VRIA 4CAEA 1F2OA 4JVVA 4UCNA 5LRJA 2Q51A 2WUUA 3P2HA 3V45A 3SIGA 4CGPA 2IMOA 2Z3PA 4EVYA 3KR5A 2VZYA 4K0CA 3P2FA 4PXDA 3F8KA 4A33A 2D4OA 1LCPA 4KOTA 1S7LA 3WR7A 3IIBA 3T90A 3DR6A 3IO1A 4CYQA 1P4NA 2PJ0A 4G1PA 4OC4A 4YWYA 2OU2A 1S60A 4J5RA 1VIXA 5G20A 3SI1A 3SXNA 5F48A 4AB7A 1YD9A 5F46A 4BBHA 2ATRA 1SPVA 2IJZA 3PEIA 1BAVA 1CBXA 4NCZA 5IV0A 2B3VA 2C6PA 1R57A 3D7GA 2ARHA 2J9AA 3PB9X 3FJUA 3SI2A 1KUVA 2PRQA 2X47A 2CY2A 1LRZA 3W6SA 1UFHA 4ETKA 1NJRA 3D4UA 1QSOA 1DTDA 1TXRA 3EY5A 4NGRA 5HMNA 4NEXA 3FEEA 4A32A 4EMEA 1CPSA 3SHPA 2DF5A 3IU1A 1YW4A 2J8RA 4OADA 4ESSA 4E0AA 4NJRA 5C88A 4HNYB 5DWMA 1ZO0A 4ONWA 4UFXA 3GQEA 1YX0A 5H84A 4C2XA 2CTBA 3V38A 3HLPA 3KHZA 2PJ7A 3H8FA 2R8VA 3DSBA 4MFLA 4Q36A 5HXDA 5LYFA 5LYDA 2ZELA 4UIBA 2IL4A 4CRZB 5DS0A 4XPKA 4RUHA 1M44A 1CM0A 4PSWA 2FCKA 2EWBA 4NGQA 1XOVA 5CMSA 4M3SA 4QBJA 3H8EA 2AJ6A 4BD9A 3D67A 4J5SA 3WC5A 2PR8A 3FRMA 3PP9A 2OZGA 2RFHA 3I3GA 4M6IA 5FVJA 4J5QA 2IQ6A 4CGNA 2B5GA 4GUAA 3SIJA 7CPAA 2WYRA 2JEWA 2VBQA 4P45A 2PJBA 1CJWA 1FT7A 3F0AA 4KOUA 5F49A 3DDDA 3RAMA 2ZOFA 5LRGA 5D8NA 5CNPA 1JQGA 1KUXA 1N71A 1Z8TA 4WJBA 2XEJA 4AXVA 1M4IA 4KLWA 3S6KA 4H2KA 4KS9A 4AVAA 4F9UA 1CG2A 2Q4YA 2PJ1A 4UA3A 4GM5A 3I1UA 2EUIA 2GLFA 4MFKA 3NH4A 3VFQA 4MCSA 2QECA 1IOFA 3RYOA 3FIXA 4UWIA 2OZHA 2AFCA 1JWQA 2PIZA 4B11A 2YGWA 3NH5A 3B3VA 4ZX9A 1Z5RA 4OKOA 4YFJA 4MCRA 5F09A 3LD2A 2PIYA 5E96A 2EEEA 4DNCA 3PBEA 4F9VA 2Q7BA 1I21A 3MGDA 4J4ZA 2Z11A 2PJ6A 4JYWA 3ETIA 1ELLP 2C1CA 3CT9A 4ABLA 3FYNA 4QVTA 2P6FA 2PQ8A 4HKFA 5GCNA 5HVFA 3RO0A 1ZR3A 3GB0A 3K2KA 1IY7A 3SIHA 2PVWA 1HEEA 1YMEA 4UFWA 4E8OA 3TE4A 1TKJA 1PU9A 3EJFA 2PE3A 5JQ4A 4C7IA 3SJFA 4PK3A 3B8GA 1R43A 2CNSA 4B14A 1YQEA 4H6ZA 1Q7LA 3CXPA 3KHXA 1ZG9A 1YLEA 2K5TA 2H5MA 3B3WA 3S9MA 2CNTA 3GPOA 3S6GA 1QSRA 4P4EA 2O4HA 4XNHC 3EWPA 2ZW6A 1ON0A 4KOXA 3NE8A 3NH8A 4JXRA 4C7HA 4DYOA 2LGRA 1F57A 4IUSA 5IX3A 3LODA 3IU2A 1YVOA 1XJOA 2Z0ZA 4J3GA 4A30A 1ELMP 2ZEPA 3GKRA 4NSQA 4UBRA 3IJ3A 2W2GA 2V8HA 4QUSA 3S9LA 1WWZA 1ZG8A 2C6CA 4AVBA 4I49A 1VGYA 1X10A 2P0WA 2PJ9A 4CPAA 3EJGA 4P4BA 2BFQA 2QIRA 4X2TA 4H89A 4FWUA 2HB6A 2XEIA 3FBUA 4M6GA 4XNHB 5G1ZA 3SJGA 2ZEMA 5LYIA 1U6MA 4MFZA 3S6HA 3VWDA 2DEAA 2L8RA 2B4DB 2C27A 3JUWA 4KUAA 4KVME 4EWTA 1CP6A 2NSMA 4MJ8A 2PJ5A 1YR0A 1OZPA 4A39A 1XIXA 3T8WA 4PSXA 1L0CA 2BFRA 4NGMA 3VH9A 2Z3LA 3TOAA 2BOAA 2ZENA 1LANA 4MFQA 6CPAA 4B6ZA 4CAVA 4ZI6A 1XE4A 2G3TA 4R7MA 2DPTA 4FD5A 1Z9UA 3D2MA 4FD4A 2EO8A 1AUGA 1HDUA 1R3NA 2EVNA 3KQZA 1VKCA 4KLVA 4MHZA 2V8DA 2R7HA 4TNUA 4A95A 1J4JA 5KTDA 3ISXA 3MN8A 4H6UA 2O53A 3TFYA 5IB9A 2F5IA 4P4DA 5A27A 4FBEA 4UEZA 3TO7A 4MHPA 4GS4A 1NSLA 1Z2LA 4F6AA 4B12A 3I9SA 4MFJA 4A38A 3R1KA 1QSMA 4UWJA 3K9UA 5AG4A 4B5OA 2FS5A 1Q2YA 1TKHA 5EBVA 4CAFA 1IYKA 2GLJA 2B5GB 1GYTA 2DPSA 4ZGYB 2JLMA 4CRYB 2ZOGA 1F2PA 2ZPAA 1PYTB 4PXCA 3VATA 4DUKA 4KORA 4KOSA 4JCAA 1Y7EA 4OC1A 2QVPA 2VZZA 1IICA 2GFQA 1TF8A 2Y0MA 3EFAA 4YU9A 4M85A 5I0CA 2G0BA 3DR8A 3QB8A 3D7FA 4L8AA 5D29A 1LAPA 2AE6A 2QYVA 3D2PA 2J8MA 1MJAA 3KGQA 4TWEA 2C6GA 1S3ZA 4UF4A 2CNMA 2Q7SA 4X5KA 1P0HA 2JZEA 4KVOE 4ZY0A 4FUUA 3H5ZA 1S5KA 1IGBA 1YGHA 2OH1A 3TC8A 3K9TA 5HVGA 2CIJA 5K8MA 1IU8A 2VXKA 2PSWA 2DXQA 2EK9A 2PVVA 4KOVA 4R57A 2ZEHA 4GVVA 5FSUA 2I00A 1ARMA 3G3SA 4KUBA 5AG7A 3EXNA 3BXMA 4YRHA 3N5FA 4OIWA 2AFSA 4C68A 1TY8A 2Q0YA 2KQVA 2J8NA 4KOWA 1VHSA 3T9YA 2F7VA 4U9YA 1XMTA 3KASA 4X8IA 4PV6A 3BLNA 8CPAA 2HUZA 3D3SA 2PJ4A 2Q43A 3JRUA 1AYEA 2BO9A 4JLLA 3SXOA 5ISVA 1XF8A 1B87A 2ZEGA 2ZW7A 4C2YA 3EWQA 2FIAA 2JBJA 3IWGA 4K30A 2PJ2A 1ARLA 5FSVA 3EC4A 5AILA 5HIHA 1OBRA 4NF1A 1RXTA 2Z3NA 4ONUA 3ZJ0A 3PB8X 2R98A 1XFOA 1M4GA 2YNDA 3CXSA 2VEZA 4GXHA 3IGRA 4XPDB 3Q6ZA 3H4QA 4YGOA 2AFXA 4LQ6A 3R9EA 2ZW5A 2ANPA 1Z8XA 4AVCA 4IAVA 3TT2A 2V8VA 3RNZA 2WPWA 3IIDA 2X7BA 2AFZA 5J8FA 3KKWA 3EW5A 3CDXA 3GQOA 4JD6A 5JM6A 3D8PA 1A2ZA 4UFVA 4P6YA 3V7ZA 2PJ8A 4CAWA 4CYOA 1UWYA 2OR4A 3PFOA 2OB0A 2G9DA 2RB7A 2A4NA 2I79A 4MHDA 4ABKA 3LWUA 1ZR5A 4PXBA 1YSJA 2V8GA 1S7NA 3D7DA 3GPQA 1LAMA 5CB5A 1VHEA 2DX6A 3GIUA 4JJXA 2ZW4A 1B6BA 2YNCA 1XEBA 3A9LA 2ZEDA 2OOTA 4E2AA 2AFWA 2PR1A 3QAYA 4C2ZA 2KCWA 3R9GA 4B5PB 5K8OA 3PRTA 4RI1A 4A2ZA 4FAIA 4JLYA 3QNVA 4MHNA 5F47A 2GIVA 1Y7RA 3PFEA 1H8LA 4IHMA 4ORFA 4UMLA 2WCTA 4MRIA 3B3CA 3FX6A 2AFOA 3TCVA 4UEEA 4NGSA 1CPXA 4BINA 1LOKA 4KVXA 4ZX8A 5DUSA 1CP7A 1TIQA 4LX9A 3KQXA 4XPDC 5JH9A 1FNOA 3TO9A 4ZY1A 1TXZA 4D86A 2FE7A 2PCUA 1I12A 1NE9A 2P6EA 3IWEA 4XPLA 3CPAA 4X3RA 5THWA 1QSNA 3LMSA 2JZDA 5KTCA 5IB0A 5EMIA 3W6XA 5AGEA 4OMEA 2YNCC 3FEDA 4UEFA 1AMPA 1RO5A 3B2YA 4F8ZA 4R6TA 4MI4A 3TTHA 3SIIA 2YNEA 2WZNA 2ZXVA 4KYBA 2EK8A 4AG7A 3HUVA 3GPGA 2WPXA 3ISZA 4CGLA 5CB3A 3GUXA 4IQYA 2AFMA 2HQYA 3EKEA 3WC6A 2REFA 4MY3A 4RN7A 4Y49C 2HC9A 2NYQA 1EE3P 4OP4A 2PJCA 3BHXA 4NXYA 1XRYA 5CBMA 4PXEA 4UCPA 4P44A 4L89A 4UCMA 3DGVA 3B7IA 4JXQA 2RC4A 1Y9WA 3IC1A 4KSAA 1Z8LA 3WABA 4HNXB 3W91A 2XD7A 2XEGA 2ACFA 1MJBA 3SJXA 5A28A 3BJ8A 1Z8WA 5FSYA 2POKA 1Y9KA 2JBKA 2G3AA 2PRBA 3JTKA 4MXUA 4OLLA 4A37A 3EWRA 3FB3A 3JZTA 4IK2A 4M6HA 2Q4VA 3F5BA 1PUAA 3PBBA 3PZJA 1S7KA 3FXTA 5KTAA 1X12A 3CXQA 5E3BA 3KZWA 4MMOA 2PDOA 3B3TA 3VARA 4B5PA 5I4MA 3KL9A 1ZLHA 4CYPA 4OC3A 2ABZA 3TX8A 5C82A 1XBUA 2VL1A 3D68A 2ZEFA 1K4JA 4NGPA 2QJ8A 2B4BA 4TU0A 2WSAA 2CXAA 2JDDA 2Z3OA 3NE7A 4R3KA 2HV2A 3FECA 3CPXA 4FD6A 4OAEA 4ZBGA 1VHOA 3WC7A 3B3SA 2AFUA 4Q38A 1DE4C 2RNKA 1IB1E 4KZTA 4GVWA 3IWWA 4RS2A 3MRUA 2FIWA 5K8PA 2B4DA 2B3UA 2V77A 4U9ZA 1Y0YA 3TOBA 1QQ9A 1TKFA 1BOBA 3FVLA 1YW6A 3GLJA 2JEVA 2XEFA 1HDQA 3LACA 1Z4RA 1BO4A 3B35A 4LUAA 3OWCA 3EWOA 3TO6A 2D4PA 4F0YA 4EFDA 4K3NA 4Z65A 2FL4A 4UIAA 4OC0A 5JPHA 4R87A 5J1QA 4QC6A 3DLJA 5K8NA 2Z3MA 3WT4A 5JGFA 2JZFA 2F8HA 3R95A 4A94A 3BJ7A 3PGPA 4JGKA 5HOLA 1XMBA 4NGTA 5HVHA 2GANA 4CGMA 1Y0RA 1HJZA 1CX8A 1V0CA 2GU2A 4JZ0A 4ETJA 3GYAA 1MK4A 4PK2A 3PB4X 3D7HA 4W9YA 5CPAA 5HH1A 1VHUA 3FF3A 3ZZIA 4R9MA 4A31A 3IFEA 4NJQA 4MCPA 1Q2DA 3R96A 4U5YA 4F0XA 4MY0A 4MBUA 2GREA 2PJAA 4WWVA 3G8WA 4AG9A 3H8GA 4MHYA 4QB9A 1FY7A 2FXFA 4KSFA 4MCQA 3SI0A 3FNCA 1Q2CA 5LYLA 3JVNA 3RZAA 3FMCA 2FXKA 2VQYA 1M4DA 2FAVA 2REEA 1YREA 2NMTA 5DWNA 2BEIA 2FVGA 5G22A 2PJ3A 2QMLA 4IF5A 4OIDA 4II9A 2I3CA 4P4IA 5FSZA 1Z4EA 4LQGA 4PPZA 4CYNA 4PQAA 1S7FA 3FH4A 4HNWB 5ELYA 4ZYQA 3PB7X 3PB6X 3V2BA 4P4JA 2B58A 4Y49B 3SJEA 2BSWA 4R3LA 4P10A 2FT0A 4KSIA 4BMHA 4MFPA 4JWPA 4CGOA 3NFZA 4R8FA 4ZY2A 2BCOA 4FD7A 4NGNA 4OC5A 5J8CA 2Z3KA 1M4LA 1YK3A 1YVKA 2BUEA 1ZG7A 1I1DA 2ZEOA 3VWEA 4HPSA 1IYLA 2O28A 2VI7A 2CF4A 3DNSA 4KOYA 4B10A 2OZUA 2PC1A 2R1IA 3V8IA 5G21A 5LRKA 1GHEA 1MJ9A 3BI1A 1BPMA 1IIDA 2FSRA 4O23A 4Q7AA 1QSTA 3IEHA 2ODFA 4R76A 3NA6A 1WK4A 1LFWA 5FSXA 1BLLE 5EC4A 3RBUA 3S9NA 4CAXA 2FG1A 2Q04A 1BPNA 3IIFA 1ZLIA 2Q4ZA 3BI0A 3KI9A 1YLOA 4P4FA 2P6GA 2Z10A 1M1DA 1NMTA 3N7ZA 3Q71A 1KWMA
chains in the Genus database with same CATH topology
1PCAA 1NSAA 4NFRA 4DJLA 1QMUA 1TF9A 3L2NA 3KR4A 3D66A 1RTQA 4OC2A 2ZEEA 2CTCA 2VRIA 1F2OA 4JVVA 5LRJA 2Q51A 3V45A 3SIGA 2IMOA 3KR5A 4K0CA 4PXDA 1LCPA 3IIBA 3IO1A 4G1PA 2PJ0A 4OC4A 4YWYA 1VIXA 4J5RA 1YD9A 2IJZA 1SPVA 3PEIA 1BAVA 1CBXA 2C6PA 3D7GA 2J9AA 3PB9X 3FJUA 3SI2A 2PRQA 2X47A 4ETKA 1NJRA 3D4UA 4NGRA 1DTDA 1TXRA 3FEEA 4EMEA 1CPSA 1YW4A 4ESSA 4NJRA 4ONWA 3GQEA 2CTBA 3V38A 3HLPA 3KHZA 2PJ7A 3H8FA 5HXDA 5LYFA 5LYDA 2ZELA 4UIBA 5DS0A 4RUHA 2EWBA 4NGQA 5CMSA 3H8EA 4BD9A 3D67A 4J5SA 3WC5A 2RFHA 4J5QA 2IQ6A 4GUAA 3SIJA 7CPAA 2WYRA 2JEWA 4P45A 2PJBA 1FT7A 3RAMA 2ZOFA 5LRGA 5D8NA 1JQGA 4WJBA 2XEJA 4AXVA 4H2KA 4F9UA 1CG2A 2PJ1A 4GM5A 3I1UA 2GLFA 3NH4A 3VFQA 4MCSA 2AFCA 2PIZA 3NH5A 3B3VA 4ZX9A 1Z5RA 4OKOA 4MCRA 5F09A 2PIYA 2EEEA 3PBEA 4F9VA 4J4ZA 2PJ6A 4JYWA 3ETIA 1ELLP 2C1CA 3CT9A 4ABLA 5HVFA 1ZR3A 3GB0A 3K2KA 1IY7A 3SIHA 2PVWA 1HEEA 1YMEA 1TKJA 3EJFA 2PE3A 3SJFA 1R43A 1Q7LA 3KHXA 1ZG9A 3B3WA 3S9MA 3GPOA 4P4EA 2O4HA 3EWPA 3NH8A 4DYOA 2LGRA 1F57A 1XJOA 1ELMP 2ZEPA 3IJ3A 2V8HA 3S9LA 1ZG8A 2C6CA 1VGYA 2PJ9A 4CPAA 3EJGA 4P4BA 2BFQA 4X2TA 4FWUA 2HB6A 2XEIA 3SJGA 2ZEMA 5LYIA 2DEAA 2L8RA 4EWTA 1CP6A 2NSMA 2PJ5A 4A39A 3T8WA 2BFRA 4NGMA 3VH9A 2BOAA 2ZENA 1LANA 6CPAA 4B6ZA 4ZI6A 4R7MA 4P4DA 3SI1A 1R3NA 1HDUA 4MHZA 3KQZA 4TNUA 2V8DA 3ISXA 3MN8A 2O53A 5IB9A 4FBEA 4UEZA 4MHPA 1Z2LA 4A38A 1TKHA 2GLJA 1GYTA 2ZOGA 1F2PA 4PXCA 1PYTB 3VATA 4DUKA 4JCAA 1Y7EA 4OC1A 2QVPA 1TF8A 4YU9A 3D7FA 5D29A 1LAPA 2QYVA 3KGQA 4TWEA 2C6GA 4UF4A 4ZY0A 4FUUA 1IGBA 3TC8A 3K9TA 5HVGA 2CIJA 5K8MA 2EK9A 2PVVA 2ZEHA 4GVVA 5FSUA 1ARMA 3BXMA 3N5FA 4OIWA 2AFSA 1TY8A 2F7VA 3KASA 4X8IA 3Q71A 8CPAA 2PJ4A 2Q43A 3JRUA 1AYEA 2BO9A 4JLLA 2ZEGA 3EWQA 2JBJA 2PJ2A 1ARLA 5FSVA 5AILA 5HIHA 1OBRA 3PB8X 1XFOA 3Q6ZA 2AFXA 2ANPA 4IAVA 2V8VA 3IIDA 2AFZA 3EW5A 3CDXA 3GQOA 5JM6A 4P6YA 3V7ZA 2PJ8A 1UWYA 2OR4A 3PFOA 2G9DA 2RB7A 4ABKA 3LWUA 1ZR5A 4PXBA 1YSJA 2V8GA 3D7DA 3GPQA 1LAMA 5CB5A 1VHEA 2DX6A 2ZEDA 2OOTA 2AFWA 5K8OA 3PRTA 4FAIA 3QNVA 4MHNA 3PFEA 1H8LA 4IHMA 4UMLA 4MRIA 3B3CA 3FX6A 2AFOA 4UEEA 4NGSA 1CPXA 1LOKA 4ZX8A 5DUSA 1CP7A 3KQXA 5JH9A 1FNOA 4ZY1A 1TXZA 4D86A 2PCUA 4X3RA 3CPAA 5THWA 3LMSA 4OMEA 3FEDA 4UEFA 1AMPA 3B2YA 4F8ZA 4R6TA 3SIIA 2WZNA 4KYBA 2EK8A 3HUVA 3GPGA 3ISZA 5CB3A 3GUXA 4IQYA 2AFMA 3WC6A 3EKEA 2HC9A 2NYQA 1EE3P 4OP4A 2PJCA 3BHXA 1XRYA 5CBMA 4PXEA 4P44A 3DGVA 3B7IA 3IC1A 1Z8LA 3WABA 2XD7A 2XEGA 2ACFA 3SJXA 5FSYA 2POKA 2JBKA 4MXUA 4A37A 3EWRA 3JZTA 4IK2A 3PBBA 5E3BA 3KZWA 4MMOA 3B3TA 3VARA 5I4MA 3KL9A 1ZLHA 4OC3A 2ABZA 3TX8A 1XBUA 2VL1A 2ZEFA 4NGPA 2QJ8A 4TU0A 3FECA 3CPXA 1VHOA 3WC7A 3B3SA 2AFUA 1DE4C 4GVWA 3IWWA 5K8PA 3MRUA 2V77A 1Y0YA 1QQ9A 1TKFA 3FVLA 1YW6A 3GLJA 2XEFA 1HDQA 3B35A 3EWOA 4Z65A 4EFDA 4K3NA 4UIAA 4OC0A 5J1QA 3DLJA 5K8NA 3WT4A 5JGFA 2F8HA 4A94A 4JGKA 5HOLA 1XMBA 4NGTA 5HVHA 1Y0RA 1HJZA 1CX8A 2GU2A 4JZ0A 4ETJA 5CPAA 3PB4X 3D7HA 4W9YA 1VHUA 3FF3A 3IFEA 4NJQA 4MCPA 2GREA 2PJAA 4WWVA 3H8GA 4MHYA 4MCQA 3SI0A 5LYLA 3RZAA 3FMCA 2FXKA 2FAVA 2FVGA 2PJ3A 4OIDA 2I3CA 4P4IA 5FSZA 4LQGA 4PPZA 4PQAA 3FH4A 5ELYA 4ZYQA 3PB7X 3PB6X 3V2BA 4P4JA 3SJEA 4P10A 4KSIA 3NFZA 4R8FA 4ZY2A 2BCOA 4NGNA 4OC5A 1M4LA 1ZG7A 2ZEOA 2CF4A 5LRKA 3BI1A 1BPMA 4O23A 4Q7AA 3IEHA 3NA6A 4R76A 3RBUA 1LFWA 5FSXA 1BLLE 3S9NA 2FG1A 1BPNA 3IIFA 1ZLIA 2Q4ZA 3BI0A 3KI9A 1YLOA 4P4FA 3D68A 1KWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCA A;  1NSA A;  4NFR A;  4DJL A;  1QMU A;  1TF9 A;  3L2N A;  3KR4 A;  3D66 A;  1RTQ A;  4OC2 A;  2ZEE A;  2CTC A;  2VRI A;  1F2O A;  4JVV A;  5LRJ A;  2Q51 A;  3V45 A;  3SIG A;  2IMO A;  3KR5 A;  4K0C A;  4PXD A;  1LCP A;  3IIB A;  3IO1 A;  4G1P A;  2PJ0 A;  4OC4 A;  4YWY A;  1VIX A;  4J5R A;  1YD9 A;  2IJZ A;  1SPV A;  3PEI A;  1BAV A;  1CBX A;  2C6P A;  3D7G A;  2J9A A;  3PB9 X;  3FJU A;  3SI2 A;  2PRQ A;  2X47 A;  4ETK A;  1NJR A;  3D4U A;  4NGR A;  1DTD A;  1TXR A;  3FEE A;  4EME A;  1CPS A;  1YW4 A;  4ESS A;  4NJR A;  4ONW A;  3GQE A;  2CTB A;  3V38 A;  3HLP A;  3KHZ A;  2PJ7 A;  3H8F A;  5HXD A;  5LYF A;  5LYD A;  2ZEL A;  4UIB A;  5DS0 A;  4RUH A;  2EWB A;  4NGQ A;  5CMS A;  3H8E A;  4BD9 A;  3D67 A;  4J5S A;  3WC5 A;  2RFH A;  4J5Q A;  2IQ6 A;  4GUA A;  3SIJ A;  7CPA A;  2WYR A;  2JEW A;  4P45 A;  2PJB A;  1FT7 A;  3RAM A;  2ZOF A;  5LRG A;  5D8N A;  1JQG A;  4WJB A;  2XEJ A;  4AXV A;  4H2K A;  4F9U A;  1CG2 A;  2PJ1 A;  4GM5 A;  3I1U A;  2GLF A;  3NH4 A;  3VFQ A;  4MCS A;  2AFC A;  2PIZ A;  3NH5 A;  3B3V A;  4ZX9 A;  1Z5R A;  4OKO A;  4MCR A;  5F09 A;  2PIY A;  2EEE A;  3PBE A;  4F9V A;  4J4Z A;  2PJ6 A;  4JYW A;  3ETI A;  1ELL P;  2C1C A;  3CT9 A;  4ABL A;  5HVF A;  1ZR3 A;  3GB0 A;  3K2K A;  1IY7 A;  3SIH A;  2PVW A;  1HEE A;  1YME A;  1TKJ A;  3EJF A;  2PE3 A;  3SJF A;  1R43 A;  1Q7L A;  3KHX A;  1ZG9 A;  3B3W A;  3S9M A;  3GPO A;  4P4E A;  2O4H A;  3EWP A;  3NH8 A;  4DYO A;  2LGR A;  1F57 A;  1XJO A;  1ELM P;  2ZEP A;  3IJ3 A;  2V8H A;  3S9L A;  1ZG8 A;  2C6C A;  1VGY A;  2PJ9 A;  4CPA A;  3EJG A;  4P4B A;  2BFQ A;  4X2T A;  4FWU A;  2HB6 A;  2XEI A;  3SJG A;  2ZEM A;  5LYI A;  2DEA A;  2L8R A;  4EWT A;  1CP6 A;  2NSM A;  2PJ5 A;  4A39 A;  3T8W A;  2BFR A;  4NGM A;  3VH9 A;  2BOA A;  2ZEN A;  1LAN A;  6CPA A;  4B6Z A;  4ZI6 A;  4R7M A;  4P4D A;  3SI1 A;  1R3N A;  1HDU A;  4MHZ A;  3KQZ A;  4TNU A;  2V8D A;  3ISX A;  3MN8 A;  2O53 A;  5IB9 A;  4FBE A;  4UEZ A;  4MHP A;  1Z2L A;  4A38 A;  1TKH A;  2GLJ A;  1GYT A;  2ZOG A;  1F2P A;  4PXC A;  1PYT B;  3VAT A;  4DUK A;  4JCA A;  1Y7E A;  4OC1 A;  2QVP A;  1TF8 A;  4YU9 A;  3D7F A;  5D29 A;  1LAP A;  2QYV A;  3KGQ A;  4TWE A;  2C6G A;  4UF4 A;  4ZY0 A;  4FUU A;  1IGB A;  3TC8 A;  3K9T A;  5HVG A;  2CIJ A;  5K8M A;  2EK9 A;  2PVV A;  2ZEH A;  4GVV A;  5FSU A;  1ARM A;  3BXM A;  3N5F A;  4OIW A;  2AFS A;  1TY8 A;  2F7V A;  3KAS A;  4X8I A;  3Q71 A;  8CPA A;  2PJ4 A;  2Q43 A;  3JRU A;  1AYE A;  2BO9 A;  4JLL A;  2ZEG A;  3EWQ A;  2JBJ A;  2PJ2 A;  1ARL A;  5FSV A;  5AIL A;  5HIH A;  1OBR A;  3PB8 X;  1XFO A;  3Q6Z A;  2AFX A;  2ANP A;  4IAV A;  2V8V A;  3IID A;  2AFZ A;  3EW5 A;  3CDX A;  3GQO A;  5JM6 A;  4P6Y A;  3V7Z A;  2PJ8 A;  1UWY A;  2OR4 A;  3PFO A;  2G9D A;  2RB7 A;  4ABK A;  3LWU A;  1ZR5 A;  4PXB A;  1YSJ A;  2V8G A;  3D7D A;  3GPQ A;  1LAM A;  5CB5 A;  1VHE A;  2DX6 A;  2ZED A;  2OOT A;  2AFW A;  5K8O A;  3PRT A;  4FAI A;  3QNV A;  4MHN A;  3PFE A;  1H8L A;  4IHM A;  4UML A;  4MRI A;  3B3C A;  3FX6 A;  2AFO A;  4UEE A;  4NGS A;  1CPX A;  1LOK A;  4ZX8 A;  5DUS A;  1CP7 A;  3KQX A;  5JH9 A;  1FNO A;  4ZY1 A;  1TXZ A;  4D86 A;  2PCU A;  4X3R A;  3CPA A;  5THW A;  3LMS A;  4OME A;  3FED A;  4UEF A;  1AMP A;  3B2Y A;  4F8Z A;  4R6T A;  3SII A;  2WZN A;  4KYB A;  2EK8 A;  3HUV A;  3GPG A;  3ISZ A;  5CB3 A;  3GUX A;  4IQY A;  2AFM A;  3WC6 A;  3EKE A;  2HC9 A;  2NYQ A;  1EE3 P;  4OP4 A;  2PJC A;  3BHX A;  1XRY A;  5CBM A;  4PXE A;  4P44 A;  3DGV A;  3B7I A;  3IC1 A;  1Z8L A;  3WAB A;  2XD7 A;  2XEG A;  2ACF A;  3SJX A;  5FSY A;  2POK A;  2JBK A;  4MXU A;  4A37 A;  3EWR A;  3JZT A;  4IK2 A;  3PBB A;  5E3B A;  3KZW A;  4MMO A;  3B3T A;  3VAR A;  5I4M A;  3KL9 A;  1ZLH A;  4OC3 A;  2ABZ A;  3TX8 A;  1XBU A;  2VL1 A;  2ZEF A;  4NGP A;  2QJ8 A;  4TU0 A;  3FEC A;  3CPX A;  1VHO A;  3WC7 A;  3B3S A;  2AFU A;  1DE4 C;  4GVW A;  3IWW A;  5K8P A;  3MRU A;  2V77 A;  1Y0Y A;  1QQ9 A;  1TKF A;  3FVL A;  1YW6 A;  3GLJ A;  2XEF A;  1HDQ A;  3B35 A;  3EWO A;  4Z65 A;  4EFD A;  4K3N A;  4UIA A;  4OC0 A;  5J1Q A;  3DLJ A;  5K8N A;  3WT4 A;  5JGF A;  2F8H A;  4A94 A;  4JGK A;  5HOL A;  1XMB A;  4NGT A;  5HVH A;  1Y0R A;  1HJZ A;  1CX8 A;  2GU2 A;  4JZ0 A;  4ETJ A;  5CPA A;  3PB4 X;  3D7H A;  4W9Y A;  1VHU A;  3FF3 A;  3IFE A;  4NJQ A;  4MCP A;  2GRE A;  2PJA A;  4WWV A;  3H8G A;  4MHY A;  4MCQ A;  3SI0 A;  5LYL A;  3RZA A;  3FMC A;  2FXK A;  2FAV A;  2FVG A;  2PJ3 A;  4OID A;  2I3C A;  4P4I A;  5FSZ A;  4LQG A;  4PPZ A;  4PQA A;  3FH4 A;  5ELY A;  4ZYQ A;  3PB7 X;  3PB6 X;  3V2B A;  4P4J A;  3SJE A;  4P10 A;  4KSI A;  3NFZ A;  4R8F A;  4ZY2 A;  2BCO A;  4NGN A;  4OC5 A;  1M4L A;  1ZG7 A;  2ZEO A;  2CF4 A;  5LRK A;  3BI1 A;  1BPM A;  4O23 A;  4Q7A A;  3IEH A;  3NA6 A;  4R76 A;  3RBU A;  1LFW A;  5FSX A;  1BLL E;  3S9N A;  2FG1 A;  1BPN A;  3IIF A;  1ZLI A;  2Q4Z A;  3BI0 A;  3KI9 A;  1YLO A;  4P4F A;  3D68 A;  1KWM A; 
#chains in the Genus database with same CATH topology
 2Q44 A;  1PCA A;  2EBJ A;  1KUY A;  4B13 A;  1NSA A;  2BL1 A;  2JDC A;  4NFR A;  4DJL A;  4CS0 B;  1QMU A;  2GE3 A;  3S6F A;  3GY9 A;  1TF9 A;  3CZX A;  3EO4 A;  3L2N A;  1SQH A;  3R9F A;  5AG6 A;  3KR4 A;  1IOI A;  3C26 A;  3QAH A;  5H86 A;  3D66 A;  1RTQ A;  4OC2 A;  2ZEE A;  5AG5 A;  3UY5 A;  2CTC A;  3E0K A;  5BWA B;  1KZF A;  2VRI A;  4CAE A;  1F2O A;  4JVV A;  4UCN A;  5LRJ A;  2Q51 A;  2WUU A;  3P2H A;  3V45 A;  3SIG A;  4CGP A;  2IMO A;  2Z3P A;  4EVY A;  3KR5 A;  2VZY A;  4K0C A;  3P2F A;  4PXD A;  3F8K A;  4A33 A;  2D4O A;  1LCP A;  4KOT A;  1S7L A;  3WR7 A;  3IIB A;  3T90 A;  3DR6 A;  3IO1 A;  4CYQ A;  1P4N A;  2PJ0 A;  4G1P A;  4OC4 A;  4YWY A;  2OU2 A;  1S60 A;  4J5R A;  1VIX A;  5G20 A;  3SI1 A;  3SXN A;  5F48 A;  4AB7 A;  1YD9 A;  5F46 A;  4BBH A;  2ATR A;  1SPV A;  2IJZ A;  3PEI A;  1BAV A;  1CBX A;  4NCZ A;  5IV0 A;  2B3V A;  2C6P A;  1R57 A;  3D7G A;  2ARH A;  2J9A A;  3PB9 X;  3FJU A;  3SI2 A;  1KUV A;  2PRQ A;  2X47 A;  2CY2 A;  1LRZ A;  3W6S A;  1UFH A;  4ETK A;  1NJR A;  3D4U A;  1QSO A;  1DTD A;  1TXR A;  3EY5 A;  4NGR A;  5HMN A;  4NEX A;  3FEE A;  4A32 A;  4EME A;  1CPS A;  3SHP A;  2DF5 A;  3IU1 A;  1YW4 A;  2J8R A;  4OAD A;  4ESS A;  4E0A A;  4NJR A;  5C88 A;  4HNY B;  5DWM A;  1ZO0 A;  4ONW A;  4UFX A;  3GQE A;  1YX0 A;  5H84 A;  4C2X A;  2CTB A;  3V38 A;  3HLP A;  3KHZ A;  2PJ7 A;  3H8F A;  2R8V A;  3DSB A;  4MFL A;  4Q36 A;  5HXD A;  5LYF A;  5LYD A;  2ZEL A;  4UIB A;  2IL4 A;  4CRZ B;  5DS0 A;  4XPK A;  4RUH A;  1M44 A;  1CM0 A;  4PSW A;  2FCK A;  2EWB A;  4NGQ A;  1XOV A;  5CMS A;  4M3S A;  4QBJ A;  3H8E A;  2AJ6 A;  4BD9 A;  3D67 A;  4J5S A;  3WC5 A;  2PR8 A;  3FRM A;  3PP9 A;  2OZG A;  2RFH A;  3I3G A;  4M6I A;  5FVJ A;  4J5Q A;  2IQ6 A;  4CGN A;  2B5G A;  4GUA A;  3SIJ A;  7CPA A;  2WYR A;  2JEW A;  2VBQ A;  4P45 A;  2PJB A;  1CJW A;  1FT7 A;  3F0A A;  4KOU A;  5F49 A;  3DDD A;  3RAM A;  2ZOF A;  5LRG A;  5D8N A;  5CNP A;  1JQG A;  1KUX A;  1N71 A;  1Z8T A;  4WJB A;  2XEJ A;  4AXV A;  1M4I A;  4KLW A;  3S6K A;  4H2K A;  4KS9 A;  4AVA A;  4F9U A;  1CG2 A;  2Q4Y A;  2PJ1 A;  4UA3 A;  4GM5 A;  3I1U A;  2EUI A;  2GLF A;  4MFK A;  3NH4 A;  3VFQ A;  4MCS A;  2QEC A;  1IOF A;  3RYO A;  3FIX A;  4UWI A;  2OZH A;  2AFC A;  1JWQ A;  2PIZ A;  4B11 A;  2YGW A;  3NH5 A;  3B3V A;  4ZX9 A;  1Z5R A;  4OKO A;  4YFJ A;  4MCR A;  5F09 A;  3LD2 A;  2PIY A;  5E96 A;  2EEE A;  4DNC A;  3PBE A;  4F9V A;  2Q7B A;  1I21 A;  3MGD A;  4J4Z A;  2Z11 A;  2PJ6 A;  4JYW A;  3ETI A;  1ELL P;  2C1C A;  3CT9 A;  4ABL A;  3FYN A;  4QVT A;  2P6F A;  2PQ8 A;  4HKF A;  5GCN A;  5HVF A;  3RO0 A;  1ZR3 A;  3GB0 A;  3K2K A;  1IY7 A;  3SIH A;  2PVW A;  1HEE A;  1YME A;  4UFW A;  4E8O A;  3TE4 A;  1TKJ A;  1PU9 A;  3EJF A;  2PE3 A;  5JQ4 A;  4C7I A;  3SJF A;  4PK3 A;  3B8G A;  1R43 A;  2CNS A;  4B14 A;  1YQE A;  4H6Z A;  1Q7L A;  3CXP A;  3KHX A;  1ZG9 A;  1YLE A;  2K5T A;  2H5M A;  3B3W A;  3S9M A;  2CNT A;  3GPO A;  3S6G A;  1QSR A;  4P4E A;  2O4H A;  4XNH C;  3EWP A;  2ZW6 A;  1ON0 A;  4KOX A;  3NE8 A;  3NH8 A;  4JXR A;  4C7H A;  4DYO A;  2LGR A;  1F57 A;  4IUS A;  5IX3 A;  3LOD A;  3IU2 A;  1YVO A;  1XJO A;  2Z0Z A;  4J3G A;  4A30 A;  1ELM P;  2ZEP A;  3GKR A;  4NSQ A;  4UBR A;  3IJ3 A;  2W2G A;  2V8H A;  4QUS A;  3S9L A;  1WWZ A;  1ZG8 A;  2C6C A;  4AVB A;  4I49 A;  1VGY A;  1X10 A;  2P0W A;  2PJ9 A;  4CPA A;  3EJG A;  4P4B A;  2BFQ A;  2QIR A;  4X2T A;  4H89 A;  4FWU A;  2HB6 A;  2XEI A;  3FBU A;  4M6G A;  4XNH B;  5G1Z A;  3SJG A;  2ZEM A;  5LYI A;  1U6M A;  4MFZ A;  3S6H A;  3VWD A;  2DEA A;  2L8R A;  2B4D B;  2C27 A;  3JUW A;  4KUA A;  4KVM E;  4EWT A;  1CP6 A;  2NSM A;  4MJ8 A;  2PJ5 A;  1YR0 A;  1OZP A;  4A39 A;  1XIX A;  3T8W A;  4PSX A;  1L0C A;  2BFR A;  4NGM A;  3VH9 A;  2Z3L A;  3TOA A;  2BOA A;  2ZEN A;  1LAN A;  4MFQ A;  6CPA A;  4B6Z A;  4CAV A;  4ZI6 A;  1XE4 A;  2G3T A;  4R7M A;  2DPT A;  4FD5 A;  1Z9U A;  3D2M A;  4FD4 A;  2EO8 A;  1AUG A;  1HDU A;  1R3N A;  2EVN A;  3KQZ A;  1VKC A;  4KLV A;  4MHZ A;  2V8D A;  2R7H A;  4TNU A;  4A95 A;  1J4J A;  5KTD A;  3ISX A;  3MN8 A;  4H6U A;  2O53 A;  3TFY A;  5IB9 A;  2F5I A;  4P4D A;  5A27 A;  4FBE A;  4UEZ A;  3TO7 A;  4MHP A;  4GS4 A;  1NSL A;  1Z2L A;  4F6A A;  4B12 A;  3I9S A;  4MFJ A;  4A38 A;  3R1K A;  1QSM A;  4UWJ A;  3K9U A;  5AG4 A;  4B5O A;  2FS5 A;  1Q2Y A;  1TKH A;  5EBV A;  4CAF A;  1IYK A;  2GLJ A;  2B5G B;  1GYT A;  2DPS A;  4ZGY B;  2JLM A;  4CRY B;  2ZOG A;  1F2P A;  2ZPA A;  1PYT B;  4PXC A;  3VAT A;  4DUK A;  4KOR A;  4KOS A;  4JCA A;  1Y7E A;  4OC1 A;  2QVP A;  2VZZ A;  1IIC A;  2GFQ A;  1TF8 A;  2Y0M A;  3EFA A;  4YU9 A;  4M85 A;  5I0C A;  2G0B A;  3DR8 A;  3QB8 A;  3D7F A;  4L8A A;  5D29 A;  1LAP A;  2AE6 A;  2QYV A;  3D2P A;  2J8M A;  1MJA A;  3KGQ A;  4TWE A;  2C6G A;  1S3Z A;  4UF4 A;  2CNM A;  2Q7S A;  4X5K A;  1P0H A;  2JZE A;  4KVO E;  4ZY0 A;  4FUU A;  3H5Z A;  1S5K A;  1IGB A;  1YGH A;  2OH1 A;  3TC8 A;  3K9T A;  5HVG A;  2CIJ A;  5K8M A;  1IU8 A;  2VXK A;  2PSW A;  2DXQ A;  2EK9 A;  2PVV A;  4KOV A;  4R57 A;  2ZEH A;  4GVV A;  5FSU A;  2I00 A;  1ARM A;  3G3S A;  4KUB A;  5AG7 A;  3EXN A;  3BXM A;  4YRH A;  3N5F A;  4OIW A;  2AFS A;  4C68 A;  1TY8 A;  2Q0Y A;  2KQV A;  2J8N A;  4KOW A;  1VHS A;  3T9Y A;  2F7V A;  4U9Y A;  1XMT A;  3KAS A;  4X8I A;  4PV6 A;  3BLN A;  8CPA A;  2HUZ A;  3D3S A;  2PJ4 A;  2Q43 A;  3JRU A;  1AYE A;  2BO9 A;  4JLL A;  3SXO A;  5ISV A;  1XF8 A;  1B87 A;  2ZEG A;  2ZW7 A;  4C2Y A;  3EWQ A;  2FIA A;  2JBJ A;  3IWG A;  4K30 A;  2PJ2 A;  1ARL A;  5FSV A;  3EC4 A;  5AIL A;  5HIH A;  1OBR A;  4NF1 A;  1RXT A;  2Z3N A;  4ONU A;  3ZJ0 A;  3PB8 X;  2R98 A;  1XFO A;  1M4G A;  2YND A;  3CXS A;  2VEZ A;  4GXH A;  3IGR A;  4XPD B;  3Q6Z A;  3H4Q A;  4YGO A;  2AFX A;  4LQ6 A;  3R9E A;  2ZW5 A;  2ANP A;  1Z8X A;  4AVC A;  4IAV A;  3TT2 A;  2V8V A;  3RNZ A;  2WPW A;  3IID A;  2X7B A;  2AFZ A;  5J8F A;  3KKW A;  3EW5 A;  3CDX A;  3GQO A;  4JD6 A;  5JM6 A;  3D8P A;  1A2Z A;  4UFV A;  4P6Y A;  3V7Z A;  2PJ8 A;  4CAW A;  4CYO A;  1UWY A;  2OR4 A;  3PFO A;  2OB0 A;  2G9D A;  2RB7 A;  2A4N A;  2I79 A;  4MHD A;  4ABK A;  3LWU A;  1ZR5 A;  4PXB A;  1YSJ A;  2V8G A;  1S7N A;  3D7D A;  3GPQ A;  1LAM A;  5CB5 A;  1VHE A;  2DX6 A;  3GIU A;  4JJX A;  2ZW4 A;  1B6B A;  2YNC A;  1XEB A;  3A9L A;  2ZED A;  2OOT A;  4E2A A;  2AFW A;  2PR1 A;  3QAY A;  4C2Z A;  2KCW A;  3R9G A;  4B5P B;  5K8O A;  3PRT A;  4RI1 A;  4A2Z A;  4FAI A;  4JLY A;  3QNV A;  4MHN A;  5F47 A;  2GIV A;  1Y7R A;  3PFE A;  1H8L A;  4IHM A;  4ORF A;  4UML A;  2WCT A;  4MRI A;  3B3C A;  3FX6 A;  2AFO A;  3TCV A;  4UEE A;  4NGS A;  1CPX A;  4BIN A;  1LOK A;  4KVX A;  4ZX8 A;  5DUS A;  1CP7 A;  1TIQ A;  4LX9 A;  3KQX A;  4XPD C;  5JH9 A;  1FNO A;  3TO9 A;  4ZY1 A;  1TXZ A;  4D86 A;  2FE7 A;  2PCU A;  1I12 A;  1NE9 A;  2P6E A;  3IWE A;  4XPL A;  3CPA A;  4X3R A;  5THW A;  1QSN A;  3LMS A;  2JZD A;  5KTC A;  5IB0 A;  5EMI A;  3W6X A;  5AGE A;  4OME A;  2YNC C;  3FED A;  4UEF A;  1AMP A;  1RO5 A;  3B2Y A;  4F8Z A;  4R6T A;  4MI4 A;  3TTH A;  3SII A;  2YNE A;  2WZN A;  2ZXV A;  4KYB A;  2EK8 A;  4AG7 A;  3HUV A;  3GPG A;  2WPX A;  3ISZ A;  4CGL A;  5CB3 A;  3GUX A;  4IQY A;  2AFM A;  2HQY A;  3EKE A;  3WC6 A;  2REF A;  4MY3 A;  4RN7 A;  4Y49 C;  2HC9 A;  2NYQ A;  1EE3 P;  4OP4 A;  2PJC A;  3BHX A;  4NXY A;  1XRY A;  5CBM A;  4PXE A;  4UCP A;  4P44 A;  4L89 A;  4UCM A;  3DGV A;  3B7I A;  4JXQ A;  2RC4 A;  1Y9W A;  3IC1 A;  4KSA A;  1Z8L A;  3WAB A;  4HNX B;  3W91 A;  2XD7 A;  2XEG A;  2ACF A;  1MJB A;  3SJX A;  5A28 A;  3BJ8 A;  1Z8W A;  5FSY A;  2POK A;  1Y9K A;  2JBK A;  2G3A A;  2PRB A;  3JTK A;  4MXU A;  4OLL A;  4A37 A;  3EWR A;  3FB3 A;  3JZT A;  4IK2 A;  4M6H A;  2Q4V A;  3F5B A;  1PUA A;  3PBB A;  3PZJ A;  1S7K A;  3FXT A;  5KTA A;  1X12 A;  3CXQ A;  5E3B A;  3KZW A;  4MMO A;  2PDO A;  3B3T A;  3VAR A;  4B5P A;  5I4M A;  3KL9 A;  1ZLH A;  4CYP A;  4OC3 A;  2ABZ A;  3TX8 A;  5C82 A;  1XBU A;  2VL1 A;  3D68 A;  2ZEF A;  1K4J A;  4NGP A;  2QJ8 A;  2B4B A;  4TU0 A;  2WSA A;  2CXA A;  2JDD A;  2Z3O A;  3NE7 A;  4R3K A;  2HV2 A;  3FEC A;  3CPX A;  4FD6 A;  4OAE A;  4ZBG A;  1VHO A;  3WC7 A;  3B3S A;  2AFU A;  4Q38 A;  1DE4 C;  2RNK A;  1IB1 E;  4KZT A;  4GVW A;  3IWW A;  4RS2 A;  3MRU A;  2FIW A;  5K8P A;  2B4D A;  2B3U A;  2V77 A;  4U9Z A;  1Y0Y A;  3TOB A;  1QQ9 A;  1TKF A;  1BOB A;  3FVL A;  1YW6 A;  3GLJ A;  2JEV A;  2XEF A;  1HDQ A;  3LAC A;  1Z4R A;  1BO4 A;  3B35 A;  4LUA A;  3OWC A;  3EWO A;  3TO6 A;  2D4P A;  4F0Y A;  4EFD A;  4K3N A;  4Z65 A;  2FL4 A;  4UIA A;  4OC0 A;  5JPH A;  4R87 A;  5J1Q A;  4QC6 A;  3DLJ A;  5K8N A;  2Z3M A;  3WT4 A;  5JGF A;  2JZF A;  2F8H A;  3R95 A;  4A94 A;  3BJ7 A;  3PGP A;  4JGK A;  5HOL A;  1XMB A;  4NGT A;  5HVH A;  2GAN A;  4CGM A;  1Y0R A;  1HJZ A;  1CX8 A;  1V0C A;  2GU2 A;  4JZ0 A;  4ETJ A;  3GYA A;  1MK4 A;  4PK2 A;  3PB4 X;  3D7H A;  4W9Y A;  5CPA A;  5HH1 A;  1VHU A;  3FF3 A;  3ZZI A;  4R9M A;  4A31 A;  3IFE A;  4NJQ A;  4MCP A;  1Q2D A;  3R96 A;  4U5Y A;  4F0X A;  4MY0 A;  4MBU A;  2GRE A;  2PJA A;  4WWV A;  3G8W A;  4AG9 A;  3H8G A;  4MHY A;  4QB9 A;  1FY7 A;  2FXF A;  4KSF A;  4MCQ A;  3SI0 A;  3FNC A;  1Q2C A;  5LYL A;  3JVN A;  3RZA A;  3FMC A;  2FXK A;  2VQY A;  1M4D A;  2FAV A;  2REE A;  1YRE A;  2NMT A;  5DWN A;  2BEI A;  2FVG A;  5G22 A;  2PJ3 A;  2QML A;  4IF5 A;  4OID A;  4II9 A;  2I3C A;  4P4I A;  5FSZ A;  1Z4E A;  4LQG A;  4PPZ A;  4CYN A;  4PQA A;  1S7F A;  3FH4 A;  4HNW B;  5ELY A;  4ZYQ A;  3PB7 X;  3PB6 X;  3V2B A;  4P4J A;  2B58 A;  4Y49 B;  3SJE A;  2BSW A;  4R3L A;  4P10 A;  2FT0 A;  4KSI A;  4BMH A;  4MFP A;  4JWP A;  4CGO A;  3NFZ A;  4R8F A;  4ZY2 A;  2BCO A;  4FD7 A;  4NGN A;  4OC5 A;  5J8C A;  2Z3K A;  1M4L A;  1YK3 A;  1YVK A;  2BUE A;  1ZG7 A;  1I1D A;  2ZEO A;  3VWE A;  4HPS A;  1IYL A;  2O28 A;  2VI7 A;  2CF4 A;  3DNS A;  4KOY A;  4B10 A;  2OZU A;  2PC1 A;  2R1I A;  3V8I A;  5G21 A;  5LRK A;  1GHE A;  1MJ9 A;  3BI1 A;  1BPM A;  1IID A;  2FSR A;  4O23 A;  4Q7A A;  1QST A;  3IEH A;  2ODF A;  4R76 A;  3NA6 A;  1WK4 A;  1LFW A;  5FSX A;  1BLL E;  5EC4 A;  3RBU A;  3S9N A;  4CAX A;  2FG1 A;  2Q04 A;  1BPN A;  3IIF A;  1ZLI A;  2Q4Z A;  3BI0 A;  3KI9 A;  1YLO A;  4P4F A;  2P6G A;  2Z10 A;  1M1D A;  1NMT A;  3N7Z A;  3Q71 A;  1KWM A; 
#chains in the Genus database with same CATH homology
 1PCA A;  1NSA A;  4NFR A;  4DJL A;  1QMU A;  1TF9 A;  3L2N A;  3KR4 A;  3D66 A;  1RTQ A;  4OC2 A;  2ZEE A;  2CTC A;  2VRI A;  1F2O A;  4JVV A;  5LRJ A;  2Q51 A;  3V45 A;  3SIG A;  2IMO A;  3KR5 A;  4K0C A;  4PXD A;  1LCP A;  3IIB A;  3IO1 A;  4G1P A;  2PJ0 A;  4OC4 A;  4YWY A;  1VIX A;  4J5R A;  1YD9 A;  2IJZ A;  1SPV A;  3PEI A;  1BAV A;  1CBX A;  2C6P A;  3D7G A;  2J9A A;  3PB9 X;  3FJU A;  3SI2 A;  2PRQ A;  2X47 A;  4ETK A;  1NJR A;  3D4U A;  4NGR A;  1DTD A;  1TXR A;  3FEE A;  4EME A;  1CPS A;  1YW4 A;  4ESS A;  4NJR A;  4ONW A;  3GQE A;  2CTB A;  3V38 A;  3HLP A;  3KHZ A;  2PJ7 A;  3H8F A;  5HXD A;  5LYF A;  5LYD A;  2ZEL A;  4UIB A;  5DS0 A;  4RUH A;  2EWB A;  4NGQ A;  5CMS A;  3H8E A;  4BD9 A;  3D67 A;  4J5S A;  3WC5 A;  2RFH A;  4J5Q A;  2IQ6 A;  4GUA A;  3SIJ A;  7CPA A;  2WYR A;  2JEW A;  4P45 A;  2PJB A;  1FT7 A;  3RAM A;  2ZOF A;  5LRG A;  5D8N A;  1JQG A;  4WJB A;  2XEJ A;  4AXV A;  4H2K A;  4F9U A;  1CG2 A;  2PJ1 A;  4GM5 A;  3I1U A;  2GLF A;  3NH4 A;  3VFQ A;  4MCS A;  2AFC A;  2PIZ A;  3NH5 A;  3B3V A;  4ZX9 A;  1Z5R A;  4OKO A;  4MCR A;  5F09 A;  2PIY A;  2EEE A;  3PBE A;  4F9V A;  4J4Z A;  2PJ6 A;  4JYW A;  3ETI A;  1ELL P;  2C1C A;  3CT9 A;  4ABL A;  5HVF A;  1ZR3 A;  3GB0 A;  3K2K A;  1IY7 A;  3SIH A;  2PVW A;  1HEE A;  1YME A;  1TKJ A;  3EJF A;  2PE3 A;  3SJF A;  1R43 A;  1Q7L A;  3KHX A;  1ZG9 A;  3B3W A;  3S9M A;  3GPO A;  4P4E A;  2O4H A;  3EWP A;  3NH8 A;  4DYO A;  2LGR A;  1F57 A;  1XJO A;  1ELM P;  2ZEP A;  3IJ3 A;  2V8H A;  3S9L A;  1ZG8 A;  2C6C A;  1VGY A;  2PJ9 A;  4CPA A;  3EJG A;  4P4B A;  2BFQ A;  4X2T A;  4FWU A;  2HB6 A;  2XEI A;  3SJG A;  2ZEM A;  5LYI A;  2DEA A;  2L8R A;  4EWT A;  1CP6 A;  2NSM A;  2PJ5 A;  4A39 A;  3T8W A;  2BFR A;  4NGM A;  3VH9 A;  2BOA A;  2ZEN A;  1LAN A;  6CPA A;  4B6Z A;  4ZI6 A;  4R7M A;  4P4D A;  3SI1 A;  1R3N A;  1HDU A;  4MHZ A;  3KQZ A;  4TNU A;  2V8D A;  3ISX A;  3MN8 A;  2O53 A;  5IB9 A;  4FBE A;  4UEZ A;  4MHP A;  1Z2L A;  4A38 A;  1TKH A;  2GLJ A;  1GYT A;  2ZOG A;  1F2P A;  4PXC A;  1PYT B;  3VAT A;  4DUK A;  4JCA A;  1Y7E A;  4OC1 A;  2QVP A;  1TF8 A;  4YU9 A;  3D7F A;  5D29 A;  1LAP A;  2QYV A;  3KGQ A;  4TWE A;  2C6G A;  4UF4 A;  4ZY0 A;  4FUU A;  1IGB A;  3TC8 A;  3K9T A;  5HVG A;  2CIJ A;  5K8M A;  2EK9 A;  2PVV A;  2ZEH A;  4GVV A;  5FSU A;  1ARM A;  3BXM A;  3N5F A;  4OIW A;  2AFS A;  1TY8 A;  2F7V A;  3KAS A;  4X8I A;  3Q71 A;  8CPA A;  2PJ4 A;  2Q43 A;  3JRU A;  1AYE A;  2BO9 A;  4JLL A;  2ZEG A;  3EWQ A;  2JBJ A;  2PJ2 A;  1ARL A;  5FSV A;  5AIL A;  5HIH A;  1OBR A;  3PB8 X;  1XFO A;  3Q6Z A;  2AFX A;  2ANP A;  4IAV A;  2V8V A;  3IID A;  2AFZ A;  3EW5 A;  3CDX A;  3GQO A;  5JM6 A;  4P6Y A;  3V7Z A;  2PJ8 A;  1UWY A;  2OR4 A;  3PFO A;  2G9D A;  2RB7 A;  4ABK A;  3LWU A;  1ZR5 A;  4PXB A;  1YSJ A;  2V8G A;  3D7D A;  3GPQ A;  1LAM A;  5CB5 A;  1VHE A;  2DX6 A;  2ZED A;  2OOT A;  2AFW A;  5K8O A;  3PRT A;  4FAI A;  3QNV A;  4MHN A;  3PFE A;  1H8L A;  4IHM A;  4UML A;  4MRI A;  3B3C A;  3FX6 A;  2AFO A;  4UEE A;  4NGS A;  1CPX A;  1LOK A;  4ZX8 A;  5DUS A;  1CP7 A;  3KQX A;  5JH9 A;  1FNO A;  4ZY1 A;  1TXZ A;  4D86 A;  2PCU A;  4X3R A;  3CPA A;  5THW A;  3LMS A;  4OME A;  3FED A;  4UEF A;  1AMP A;  3B2Y A;  4F8Z A;  4R6T A;  3SII A;  2WZN A;  4KYB A;  2EK8 A;  3HUV A;  3GPG A;  3ISZ A;  5CB3 A;  3GUX A;  4IQY A;  2AFM A;  3WC6 A;  3EKE A;  2HC9 A;  2NYQ A;  1EE3 P;  4OP4 A;  2PJC A;  3BHX A;  1XRY A;  5CBM A;  4PXE A;  4P44 A;  3DGV A;  3B7I A;  3IC1 A;  1Z8L A;  3WAB A;  2XD7 A;  2XEG A;  2ACF A;  3SJX A;  5FSY A;  2POK A;  2JBK A;  4MXU A;  4A37 A;  3EWR A;  3JZT A;  4IK2 A;  3PBB A;  5E3B A;  3KZW A;  4MMO A;  3B3T A;  3VAR A;  5I4M A;  3KL9 A;  1ZLH A;  4OC3 A;  2ABZ A;  3TX8 A;  1XBU A;  2VL1 A;  2ZEF A;  4NGP A;  2QJ8 A;  4TU0 A;  3FEC A;  3CPX A;  1VHO A;  3WC7 A;  3B3S A;  2AFU A;  1DE4 C;  4GVW A;  3IWW A;  5K8P A;  3MRU A;  2V77 A;  1Y0Y A;  1QQ9 A;  1TKF A;  3FVL A;  1YW6 A;  3GLJ A;  2XEF A;  1HDQ A;  3B35 A;  3EWO A;  4Z65 A;  4EFD A;  4K3N A;  4UIA A;  4OC0 A;  5J1Q A;  3DLJ A;  5K8N A;  3WT4 A;  5JGF A;  2F8H A;  4A94 A;  4JGK A;  5HOL A;  1XMB A;  4NGT A;  5HVH A;  1Y0R A;  1HJZ A;  1CX8 A;  2GU2 A;  4JZ0 A;  4ETJ A;  5CPA A;  3PB4 X;  3D7H A;  4W9Y A;  1VHU A;  3FF3 A;  3IFE A;  4NJQ A;  4MCP A;  2GRE A;  2PJA A;  4WWV A;  3H8G A;  4MHY A;  4MCQ A;  3SI0 A;  5LYL A;  3RZA A;  3FMC A;  2FXK A;  2FAV A;  2FVG A;  2PJ3 A;  4OID A;  2I3C A;  4P4I A;  5FSZ A;  4LQG A;  4PPZ A;  4PQA A;  3FH4 A;  5ELY A;  4ZYQ A;  3PB7 X;  3PB6 X;  3V2B A;  4P4J A;  3SJE A;  4P10 A;  4KSI A;  3NFZ A;  4R8F A;  4ZY2 A;  2BCO A;  4NGN A;  4OC5 A;  1M4L A;  1ZG7 A;  2ZEO A;  2CF4 A;  5LRK A;  3BI1 A;  1BPM A;  4O23 A;  4Q7A A;  3IEH A;  3NA6 A;  4R76 A;  3RBU A;  1LFW A;  5FSX A;  1BLL E;  3S9N A;  2FG1 A;  1BPN A;  3IIF A;  1ZLI A;  2Q4Z A;  3BI0 A;  3KI9 A;  1YLO A;  4P4F A;  3D68 A;  1KWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...