2EWBA

The crystal structure of bovine lens leucine aminopeptidase in complex with zofenoprilat
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
486
structure length
486
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosol aminopeptidase
publication title Metal Ion Substitution in the Catalytic Site Greatly Affects the Binding of Sulfhydryl-Containing Compounds to Leucyl Aminopeptidase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 174
structure length 486
sequence length 486
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2ewbA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ewbA02
4OC3A 2EEEA 2DEAA 2ZEHA 4K3NA 2ZEPA 4IQYA 3DGVA 4ESSA 3KGQA 1YW6A 4P4BA 1TKJA 3TX8A 1DTDA 1YMEA 1QMUA 1VGYA 1TXZA 2XEJA 5AILA 2PJ8A 4J4ZA 3FX6A 5K8OA 4UEEA 1LFWA 2QJ8A 3SJEA 2GREA 2OOTA 4YU9A 4Z65A 3NH4A 4NGTA 1Z2LA 4JZ0A 1BPMA 1ZLHA 2PJAA 4MHNA 4AXVA 3SIIA 1VHUA 5JH9A 5THWA 5LYIA 1F2OA 2XEIA 3IO1A 2CTBA 3PEIA 3V7ZA 4UMLA 4MHZA 1IGBA 2AFXA 3GUXA 4P4DA 1UWYA 3EWOA 1HDQA 3IFEA 5HIHA 1XRYA 2ZEOA 2PCUA 1CP6A 1ELMP 1Y0RA 2FVGA 3D66A 5FSYA 4P45A 4W9YA 4P4FA 4ZYQA 2AFOA 3HLPA 3WABA 2PJ4A 3GQOA 2PVWA 3CT9A 2PJ2A 4NGSA 3PB8X 3GLJA 3PBEA 1ARLA 3ETIA 4B6ZA 4MCSA 7CPAA 3TC8A 2PJ9A 1KWMA 2ZEDA 1XBUA 2JEWA 1RTQA 2V8HA 1YD9A 3IJ3A 2PIZA 3B3VA 1YSJA 1Q7LA 2IMOA 1VHEA 3PRTA 2AFZA 1R43A 4NGMA 4ETJA 2F7VA 5JGFA 2C6PA 3BXMA 4MMOA 2QYVA 2AFCA 3EJFA 3FECA 3HUVA 4TNUA 1PYTB 3SI1A 5LRKA 3GPQA 3JRUA 1TKFA 4OMEA 2PRQA 1BAVA 4F9VA 1SPVA 3T8WA 3NFZA 5LRGA 4NGQA 2PJ7A 5ELYA 1BPNA 5FSZA 1CG2A 3BI1A 3KHZA 4Q7AA 5I4MA 2PJCA 4FAIA 5D8NA 5DS0A 4R8FA 2EK8A 1CX8A 4TU0A 3NH8A 2LGRA 3BHXA 4DYOA 4MCQA 2POKA 3RAMA 1LANA 3SJXA 2Q4ZA 1ZG7A 2IJZA 4OC1A 5IB9A 3PB4X 3K2KA 3KQXA 3D7GA 2EWBA 4FUUA 2IQ6A 3B3WA 5K8NA 1ZR3A 1IY7A 4UEFA 3GB0A 4MHPA 1H8LA 4KSIA 3PB7X 4H2KA 4IK2A 3IIDA 2EK9A 2ZELA 4PXCA 3Q6ZA 1F2PA 4ZY1A 2DX6A 3B3TA 3KL9A 4CPAA 3PFOA 3CDXA 1ZR5A 1XMBA 5K8PA 4NGPA 3K9TA 5CB5A 1CBXA 3JZTA 4R7MA 3CPAA 1ARMA 2QVPA 2GU2A 4R76A 1M4LA 3BI0A 3WC6A 5FSVA 3S9LA 2FAVA 3NH5A 3ISXA 3PB6X 4GM5A 4NJRA 4ZY2A 2OR4A 4ETKA 2C6GA 2HC9A 3V2BA 4MCRA 4OIWA 4GVVA 2FG1A 2V8GA 3ISZA 5D29A 4A39A 1HDUA 3VFQA 2NYQA 4OC4A 4FBEA 2JBKA 1QQ9A 4GVWA 5HOLA 4BD9A 3GPOA 2PJ0A 2F8HA 3N5FA 3D68A 4FWUA 2GLJA 1CP7A 3H8EA 4P44A 4JYWA 2AFMA 2BFRA 4PQAA 1TKHA 3LWUA 2XD7A 2VRIA 3SIJA 2V8VA 2ZOFA 4OC2A 1TF9A 2PJ6A 2V77A 4NJQA 1NSAA 2L8RA 3SJGA 4OP4A 1XFOA 2BO9A 5FSXA 2AFWA 3EWRA 4P4JA 2ACFA 4ZY0A 1AMPA 3DLJA 8CPAA 4J5RA 3FH4A 3IIBA 4UIAA 1JQGA 3I1UA 1HEEA 4ZX9A 5E3BA 5CB3A 5JM6A 2HB6A 3CPXA 4LQGA 4ZI6A 3EKEA 4OKOA 2RB7A 1Y0YA 2V8DA 3S9MA 2ZEGA 1Z5RA 3FEDA 4O23A 2BCOA 1FT7A 3EWPA 3SI2A 4P4IA 1Z8LA 4MXUA 2BFQA 2J9AA 3D4UA 2C1CA 4YWYA 4P4EA 3SI0A 4OIDA 1ZG9A 1EE3P 3V38A 5F09A 4X8IA 1TY8A 2ZEFA 5LRJA 1PCAA 4PXEA 1CPXA 2PJBA 4A94A 1TXRA 3B3SA 4NGRA 1FNOA 4EWTA 1OBRA 3IC1A 3KI9A 2Q51A 3KHXA 3MRUA 4DJLA 3WC7A 5FSUA 2AFUA 1ZG8A 5J1QA 4DUKA 3NA6A 4X3RA 3B3CA 4P10A 2O53A 4ZX8A 1LOKA 4GUAA 2I3CA 5HVFA 1R3NA 3S9NA 3H8FA 3Q71A 2ZOGA 4PPZA 2PVVA 4PXBA 3D7DA 3B2YA 3FVLA 1ZLIA 2Q43A 5HVGA 4OC5A 3IWWA 2G9DA 1ELLP 3PFEA 2PJ5A 2GLFA 4WWVA 3GQEA 2FXKA 2ZENA 4JCAA 4ABKA 2BOAA 3EWQA 4ONWA 3KR5A 1YLOA 5LYDA 2XEFA 4PXDA 5K8MA 4J5SA 5DUSA 2VL1A 1VIXA 3EW5A 1TF8A 2NSMA 3SIHA 3KASA 2ANPA 3IEHA 4G1PA 3FF3A 3WC5A 5LYFA 3EJGA 1Y7EA 2C6CA 3PBBA 3WT4A 2WYRA 3QNVA 5LYLA 6CPAA 3RBUA 4EMEA 4X2TA 4R6TA 2RFHA 1LCPA 3MN8A 2PE3A 3B35A 3LMSA 4D86A 3KR4A 3SJFA 4A38A 5CMSA 4JGKA 3D7HA 3D67A 2X47A 1YW4A 4J5QA 4EFDA 2JBJA 4F9UA 3VH9A 5HVHA 3D7FA 3V45A 1VHOA 3H8GA 4MRIA 2ZEEA 4WJBA 1NJRA 4MCPA 4RUHA 4JLLA 4UIBA 4UEZA 3PB9X 3VARA 3SIGA 4UF4A 2PJ3A 1F57A 2PIYA 4P6YA 3KZWA 1GYTA 2ZEMA 4KYBA 4F8ZA 4NGNA 4ABLA 4OC0A 4TWEA 1LAPA 3GPGA 4IAVA 3B7IA 4IHMA 5HXDA 4JVVA 4A37A 3FJUA 4NFRA 2O4HA 1BLLE 1CPSA 2PJ1A 2XEGA 1LAMA 2ABZA 1DE4C 3IIFA 2WZNA 2CIJA 3RZAA 3KQZA 1AYEA 5CBMA 2CTCA 4K0CA 2AFSA 1HJZA 5CPAA 3L2NA 1XJOA 4MHYA 3FEEA 3VATA 2CF4A 3FMCA
chains in the Genus database with same CATH superfamily
1I12A 1YLEA 3TO7A 4KVXA 3R9FA 4OC3A 2EEEA 2DEAA 3TT2A 1IICA 2ZEHA 3DDDA 3S6FA 4K3NA 1Y9WA 2ZEPA 4IQYA 3DGVA 4ESSA 3KGQA 1YW6A 4P4BA 1TKJA 4C7IA 4CRYB 3TX8A 1DTDA 1YMEA 1QMUA 3IWGA 1VGYA 1TXZA 2XEJA 2ZW5A 4KLVA 5AILA 2PJ8A 1NE9A 3B8GA 4J4ZA 2FS5A 3FX6A 4J3GA 5C82A 5K8OA 2DPSA 3LD2A 3MGDA 4U9ZA 1I1DA 4UEEA 4Y49B 1LFWA 2QJ8A 1IB1E 4CS0B 4L89A 3SJEA 2BL1A 1YX0A 1B87A 2GREA 3D2MA 3DR6A 4KSFA 4JWPA 2OOTA 4AVBA 4YU9A 4CYOA 4MFPA 3UY5A 1QSTA 4A2ZA 4Z65A 5F46A 3NH4A 4NGTA 4UCPA 1Z2LA 4JZ0A 5F48A 1BPMA 1ZLHA 2PJAA 3JTKA 4MHNA 5C88A 4AXVA 3SIIA 1VHUA 5JH9A 1ON0A 5THWA 5LYIA 1MJAA 4DNCA 2BEIA 4UWJA 2REFA 2FCKA 4PSWA 4H6UA 3DNSA 2YGWA 3IGRA 1F2OA 2I79A 2XEIA 1J4JA 3IO1A 1XE4A 4NXYA 4B13A 2CTBA 2P6GA 3V8IA 4KSAA 5BWAB 3PEIA 3F0AA 1S7FA 3V7ZA 4UMLA 4MHZA 4OLLA 1PU9A 2Z3KA 5G21A 1IGBA 2AFXA 3EXNA 3GUXA 4P4DA 3PZJA 4UBRA 3S6HA 1UWYA 2P6EA 4QVTA 2JEVA 2HV2A 3EWOA 2GIVA 2VQYA 4UA3A 3G8WA 1HDQA 3F5BA 2GFQA 3IFEA 4OADA 5HIHA 3JUWA 4M6GA 4UFWA 4KOWA 4R3LA 1V0CA 1XRYA 3FB3A 2ZEOA 1QSRA 2PCUA 1CP6A 1ELMP 1Y0RA 2F5IA 2FVGA 5FSYA 3D66A 4P45A 4W9YA 4P4FA 4C2ZA 4ZYQA 4KOSA 2AFOA 3HLPA 1OZPA 2PJ4A 3WABA 5FVJA 3GQOA 2CNMA 2PVWA 4UFVA 3CT9A 2PJ2A 4NGSA 3PB8X 3GLJA 4UWIA 4UCNA 3GYAA 4GXHA 3PBEA 1ARLA 3ETIA 2CNSA 4H6ZA 2C27A 4MCSA 4B6ZA 5A27A 5AG4A 4CAXA 7CPAA 1IYKA 2EBJA 3TC8A 5H84A 2R1IA 2PJ9A 2Q4YA 4ORFA 4R87A 1KWMA 3TOBA 3R95A 2ZEDA 1XBUA 2JEWA 1RTQA 2V8HA 2PR8A 1YD9A 1YK3A 2DPTA 4U9YA 2J8NA 3IJ3A 3SXOA 2PIZA 3B3VA 1YSJA 3BJ7A 1Q7LA 2IMOA 4KZTA 1VHEA 3PRTA 2AFZA 1YGHA 4F9VA 5HMNA 3P2FA 1FY7A 3GKRA 3IU2A 1R43A 4NGMA 3RNZA 4ETJA 2FXFA 5KTAA 4JD6A 2F7VA 1CJWA 5JGFA 2C6PA 3BXMA 4MMOA 2A4NA 2QYVA 2YNCA 4XNHC 2ZW6A 2AFCA 3EJFA 3FECA 3HUVA 4TNUA 1PYTB 3SI1A 3FXTA 2EVNA 5LRKA 3GPQA 3JRUA 2PRBA 1TKFA 4OMEA 2PRQA 1BAVA 4U5YA 1SPVA 3T8WA 3NFZA 4XPDC 4NGQA 5LRGA 3CXQA 1S60A 2PJ7A 5ELYA 1BPNA 5FSZA 1CG2A 3BI1A 3KHZA 4LUAA 4Q7AA 1XF8A 3H5ZA 1NSLA 2JLMA 2PJCA 4A32A 4AG7A 4B5PB 4FAIA 5D8NA 4KUBA 5AG7A 5I4MA 4MFJA 5DS0A 4R8FA 1RO5A 1CX8A 2EK8A 4MFQA 5I0CA 4CYQA 4TU0A 3NH8A 2LGRA 2B4DB 3EO4A 3BHXA 4DYOA 3DSBA 2B5GA 4CAEA 2PC1A 3G3SA 4MCQA 2POKA 1VKCA 1XIXA 5CNPA 2YNEA 3RAMA 2OB0A 4A30A 4A33A 1LANA 4CAFA 3SJXA 2Q4ZA 1ZG7A 2IJZA 4OC1A 5IB9A 3CXSA 3PB4X 3P2HA 4FD7A 3PGPA 3K2KA 4FD5A 4CGOA 3FNCA 2AE6A 4NSQA 3FIXA 4YFJA 3KQXA 1YVOA 4LQ6A 4A95A 3D7GA 2EWBA 4FUUA 4BMHA 2IQ6A 2WCTA 3B3WA 5K8NA 1ZR3A 4KOXA 4OAEA 1IY7A 1XOVA 3D3SA 1Z4RA 4UEFA 1KUVA 1KZFA 3GB0A 3GY9A 1MJBA 4MHPA 1I21A 1M44A 1H8LA 4CGPA 4KSIA 3PB7X 2D4PA 4NCZA 2BSWA 4H2KA 4IK2A 3IIDA 1IOIA 5IV0A 1WWZA 2EK9A 2ZELA 4PXCA 3Q6ZA 2OH1A 1M4DA 1F2PA 4ZY1A 4XNHB 2DX6A 1U6MA 4AVCA 2QECA 3B3TA 3KL9A 4CPAA 3PFOA 3CDXA 1ZR5A 4XPDB 1XMBA 5K8PA 4NGPA 3K9TA 3S6KA 5CB5A 1CBXA 2ODFA 1Q2CA 3JZTA 4R7MA 1QSNA 1ARMA 3CPAA 3N7ZA 4A31A 4KS9A 1Y9KA 2QVPA 2GU2A 1Z8TA 2O28A 3W6SA 4R76A 3TOAA 4C68A 5J8CA 2Z3MA 4KUAA 1M4LA 2Z3LA 3BI0A 2JDCA 4IUSA 3WC6A 3CZXA 5FSVA 3S9LA 1KUYA 4L8AA 3RO0A 2FAVA 3NH5A 2VZZA 3ISXA 4QC6A 5H86A 2Z10A 3PB6X 3SHPA 2Q4VA 3KKWA 3QAHA 4GM5A 4NJRA 4ZY2A 4UCMA 4E2AA 2OR4A 4ETKA 4HNYB 3CXPA 4AB7A 2C6GA 4X5KA 3IU1A 2HC9A 3V2BA 4MCRA 4OIWA 4GVVA 2FG1A 2V8GA 3ISZA 5D29A 2IL4A 4A39A 1S7NA 2JZEA 3VFQA 1HDUA 2NYQA 4OC4A 4FBEA 4C7HA 4AG9A 2JBKA 1QQ9A 4EVYA 4GVWA 1Z8WA 5HOLA 4KOYA 3GPOA 2PJ0A 3D8PA 4BD9A 2F8HA 2R7HA 2BUEA 4M3SA 3N5FA 3NE8A 4CGMA 2YNDA 4QBJA 3D68A 2FIAA 4FWUA 5KTCA 2GLJA 1CP7A 3H8EA 4RS2A 2FIWA 4YRHA 4P44A 2J8MA 4ONUA 1Y7RA 2I00A 4XPKA 4JYWA 5AG6A 2AFMA 1X12A 4B10A 2BFRA 2EUIA 4ZBGA 4PQAA 1YREA 2CY2A 2K5TA 1TKHA 3ZJ0A 4M6HA 3R9GA 4F0YA 3LWUA 2XD7A 2YNCC 2RNKA 2VRIA 4B14A 3SIJA 2V8VA 2WPWA 2VI7A 2ZOFA 4YGOA 4F0XA 4OC2A 5EBVA 3DR8A 3WR7A 1TF9A 4NEXA 2JZFA 2PJ6A 2Q7SA 2V77A 4KOUA 1GHEA 1NSAA 4NJQA 2L8RA 3EY5A 1P4NA 1XFOA 4OP4A 3SJGA 1K4JA 2BO9A 4PK2A 5FSXA 5GCNA 2ZPAA 2AFWA 3TCVA 1QSOA 2P6FA 3EWRA 4KVOE 4P4JA 2ACFA 4ZY0A 1AMPA 3DLJA 5G1ZA 4J5RA 3FH4A 3IIBA 2B3VA 4FD4A 1JQGA 4UIAA 4I49A 4M6IA 2VXKA 1HEEA 3D2PA 3I1UA 4ZX9A 5E3BA 2CXAA 5CB3A 4RI1A 5ISVA 2WUUA 2HB6A 5JM6A 3CPXA 4LQGA 4ZI6A 3EKEA 3I3GA 4JJXA 4OKOA 2RB7A 1Y0YA 2V8DA 5DWMA 3IWEA 4MHDA 3S9MA 2W2GA 2ZEGA 3T9YA 1Z5RA 4R3KA 3R9EA 1M4GA 3FEDA 2FE7A 5J8FA 4QUSA 4KVME 2KQVA 1SQHA 4HKFA 1BO4A 2DF5A 4KOTA 2WPXA 2BCOA 2KCWA 3QAYA 4O23A 4CYPA 1FT7A 2FSRA 2JZDA 2VEZA 2Q04A 3EWPA 1NMTA 4B5PA 5IX3A 4LX9A 4JXQA 3SI2A 4P4IA 1Z8LA 4MXUA 1QSMA 3T90A 2BFQA 2J9AA 3D4UA 5F47A 2G0BA 2C1CA 2B4DA 4YWYA 4P4EA 3SI0A 4OIDA 5IB0A 1ZG9A 1EE3P 3TO6A 4II9A 3V38A 5F09A 3RYOA 1IIDA 4X8IA 3BLNA 1M1DA 1TY8A 3JVNA 2J8RA 4AVAA 4H89A 2ZEFA 3W91A 2FT0A 1YVKA 5LRJA 1PCAA 2QIRA 4E8OA 4PK3A 4M85A 1LRZA 4PXEA 3R96A 1CPXA 2AJ6A 4FD6A 2FL4A 2PJBA 2ZXVA 1S7KA 4A94A 1TXRA 3B3SA 4KOVA 4NGRA 2Z3OA 2ZW4A 3H4QA 1FNOA 2Z0ZA 4IF5A 4EWTA 5KTDA 1OBRA 1XEBA 3IC1A 3KI9A 2Q51A 3KHXA 3MRUA 4DJLA 4MJ8A 5JQ4A 3WC7A 4BINA 1IOFA 4BBHA 5FSUA 2AFUA 4PV6A 1ZG8A 5J1QA 1MJ9A 2X7BA 4CRZB 4DUKA 4XPLA 3NA6A 4X3RA 3A9LA 3E0KA 4CAWA 3SXNA 3B3CA 4P10A 4MI4A 2Q7BA 5A28A 1L0CA 2O53A 4ZX8A 1LOKA 4GUAA 2I3CA 5DWNA 5HVFA 1IYLA 3F8KA 4RN7A 3VWEA 2B4BA 1R3NA 4B11A 4B5OA 3S9NA 3H8FA 3Q71A 3FRMA 3TTHA 2ZOGA 4PPZA 5HH1A 4QB9A 2PVVA 2Z3NA 4PXBA 1B6BA 2ATRA 3NE7A 3D7DA 3B2YA 3FVLA 2VZYA 2HQYA 1ZLIA 2Q43A 3LACA 1BOBA 4F6AA 5HVGA 1TIQA 4OC5A 4MFLA 1Q2YA 2G9DA 1ELLP 1M4IA 2PJ5A 3IWWA 3PFEA 3FBUA 2GLFA 2Q0YA 3I9SA 2JDDA 5AG5A 3C26A 2R8VA 3TFYA 2PDOA 4WWVA 3GQEA 1XMTA 2FXKA 1JWQA 1YR0A 2ZENA 2WSAA 4JCAA 4ABKA 2BOAA 4JLYA 4NF1A 1WK4A 3EWQA 4ONWA 4CGLA 3LODA 1S7LA 4JXRA 3KR5A 1YLOA 1YQEA 1MK4A 5G20A 1RXTA 2HUZA 5LYDA 2XEFA 4PXDA 2B58A 3K9UA 5K8MA 4J5SA 5DUSA 2PSWA 1VIXA 3EW5A 1TF8A 1S3ZA 1VHSA 3SIHA 2NSMA 2ANPA 3KASA 4K30A 1IU8A 3IEHA 4G1PA 3S6GA 1R57A 3FF3A 2CNTA 3WC5A 5LYFA 3EJGA 1Y7EA 2C6CA 2VBQA 3PBBA 3ZZIA 3WT4A 2OZUA 2WYRA 3QNVA 3TO9A 4E0AA 3FYNA 6CPAA 3RBUA 4MFZA 5LYLA 4EMEA 4X2TA 4R6TA 1X10A 2RFHA 1LCPA 3BJ8A 3MN8A 4HNXB 2PE3A 2Q44A 3B35A 2ARHA 2OZGA 3LMSA 4Q38A 4D86A 2PQ8A 3KR4A 3SJFA 3OWCA 4A38A 5CMSA 4JGKA 3D7HA 3D67A 2X47A 1YW4A 4HNWB 4C2XA 4J5QA 4EFDA 2JBJA 4F9UA 3VH9A 5HVHA 3D7FA 3V45A 1VHOA 3H8GA 2OZHA 4MRIA 2ZEEA 3PP9A 2RC4A 1Z9UA 4WJBA 4ZGYB 1NJRA 3W6XA 4C2YA 4CYNA 8CPAA 3TE4A 2GANA 4MCPA 2ZW7A 4RUHA 4JLLA 4UIBA 4KORA 4UEZA 5EC4A 2EO8A 3PB9X 1Z4EA 2B3UA 2D4OA 4MY3A 4MY0A 3VARA 2Y0MA 3SIGA 4UF4A 2PJ3A 5E96A 1F57A 2PIYA 2R98A 4P6YA 3KZWA 5EMIA 1GYTA 5F49A 1A2ZA 2ZEMA 4KYBA 4F8ZA 4CGNA 1S5KA 4NGNA 4R9MA 4ABLA 4MBUA 4OC0A 4TWEA 4PSXA 5G22A 1LAPA 3GPGA 3GIUA 4B12A 4IAVA 3B7IA 1PUAA 2DXQA 1P0HA 3R1KA 4IHMA 2P0WA 4KLWA 4JVVA 5HXDA 4A37A 1UFHA 3FJUA 4NFRA 2O4HA 4Y49C 5AGEA 2G3AA 1BLLE 1CPSA 2PJ1A 1Q2DA 1CM0A 4UFXA 2XEGA 1LAMA 2ABZA 4GS4A 2QMLA 1DE4C 2REEA 3IIFA 2WZNA 2CIJA 3RZAA 3KQZA 1AYEA 3EFAA 4HPSA 1Z8XA 4Q36A 1AUGA 2NMTA 1ZO0A 2H5MA 5CBMA 1N71A 2CTCA 2Z11A 4K0CA 2B5GB 2AFSA 2VL1A 1KUXA 3QB8A 4MFKA 1HJZA 5CPAA 3L2NA 5JPHA 3EC4A 2Z3PA 2GE3A 4R57A 4CAVA 1XJOA 2PR1A 4MHYA 2OU2A 3FEEA 3VATA 2G3TA 2CF4A 3VWDA 3FMCA
chains in the Genus database with same CATH topology
4OC3A 2EEEA 2DEAA 2ZEHA 4K3NA 2ZEPA 4IQYA 3DGVA 4ESSA 3KGQA 1YW6A 4P4BA 1TKJA 3TX8A 1DTDA 1YMEA 1QMUA 1VGYA 1TXZA 2XEJA 5AILA 2PJ8A 4J4ZA 3FX6A 5K8OA 4UEEA 1LFWA 2QJ8A 3SJEA 2GREA 2OOTA 4YU9A 4Z65A 3NH4A 4NGTA 1Z2LA 4JZ0A 1BPMA 1ZLHA 2PJAA 4MHNA 4AXVA 3SIIA 1VHUA 5JH9A 5THWA 5LYIA 1F2OA 2XEIA 3IO1A 2CTBA 3PEIA 3V7ZA 4UMLA 4MHZA 1IGBA 2AFXA 3GUXA 4P4DA 1UWYA 3EWOA 1HDQA 3IFEA 5HIHA 1XRYA 2ZEOA 2PCUA 1CP6A 1ELMP 1Y0RA 2FVGA 3D66A 5FSYA 4P45A 4W9YA 4P4FA 4ZYQA 2AFOA 3HLPA 3WABA 2PJ4A 3GQOA 2PVWA 3CT9A 2PJ2A 4NGSA 3PB8X 3GLJA 3PBEA 1ARLA 3ETIA 4B6ZA 4MCSA 7CPAA 3TC8A 2PJ9A 1KWMA 2ZEDA 1XBUA 2JEWA 1RTQA 2V8HA 1YD9A 3IJ3A 2PIZA 3B3VA 1YSJA 1Q7LA 2IMOA 1VHEA 3PRTA 2AFZA 1R43A 4NGMA 4ETJA 2F7VA 5JGFA 2C6PA 3BXMA 4MMOA 2QYVA 2AFCA 3EJFA 3FECA 3HUVA 4TNUA 1PYTB 3SI1A 5LRKA 3GPQA 3JRUA 1TKFA 4OMEA 2PRQA 1BAVA 4F9VA 1SPVA 3T8WA 3NFZA 5LRGA 4NGQA 2PJ7A 5ELYA 1BPNA 5FSZA 1CG2A 3BI1A 3KHZA 4Q7AA 5I4MA 2PJCA 4FAIA 5D8NA 5DS0A 4R8FA 2EK8A 1CX8A 4TU0A 3NH8A 2LGRA 3BHXA 4DYOA 4MCQA 2POKA 3RAMA 1LANA 3SJXA 2Q4ZA 1ZG7A 2IJZA 4OC1A 5IB9A 3PB4X 3K2KA 3KQXA 3D7GA 2EWBA 4FUUA 2IQ6A 3B3WA 5K8NA 1ZR3A 1IY7A 4UEFA 3GB0A 4MHPA 1H8LA 4KSIA 3PB7X 4H2KA 4IK2A 3IIDA 2EK9A 2ZELA 4PXCA 3Q6ZA 1F2PA 4ZY1A 2DX6A 3B3TA 3KL9A 4CPAA 3PFOA 3CDXA 1ZR5A 1XMBA 5K8PA 4NGPA 3K9TA 5CB5A 1CBXA 3JZTA 4R7MA 3CPAA 1ARMA 2QVPA 2GU2A 4R76A 1M4LA 3BI0A 3WC6A 5FSVA 3S9LA 2FAVA 3NH5A 3ISXA 3PB6X 4GM5A 4NJRA 4ZY2A 2OR4A 4ETKA 2C6GA 2HC9A 3V2BA 4MCRA 4OIWA 4GVVA 2FG1A 2V8GA 3ISZA 5D29A 4A39A 1HDUA 3VFQA 2NYQA 4OC4A 4FBEA 2JBKA 1QQ9A 4GVWA 5HOLA 4BD9A 3GPOA 2PJ0A 2F8HA 3N5FA 3D68A 4FWUA 2GLJA 1CP7A 3H8EA 4P44A 4JYWA 2AFMA 2BFRA 4PQAA 1TKHA 3LWUA 2XD7A 2VRIA 3SIJA 2V8VA 2ZOFA 4OC2A 1TF9A 2PJ6A 2V77A 4NJQA 1NSAA 2L8RA 3SJGA 4OP4A 1XFOA 2BO9A 5FSXA 2AFWA 3EWRA 4P4JA 2ACFA 4ZY0A 1AMPA 3DLJA 8CPAA 4J5RA 3FH4A 3IIBA 4UIAA 1JQGA 3I1UA 1HEEA 4ZX9A 5E3BA 5CB3A 5JM6A 2HB6A 3CPXA 4LQGA 4ZI6A 3EKEA 4OKOA 2RB7A 1Y0YA 2V8DA 3S9MA 2ZEGA 1Z5RA 3FEDA 4O23A 2BCOA 1FT7A 3EWPA 3SI2A 4P4IA 1Z8LA 4MXUA 2BFQA 2J9AA 3D4UA 2C1CA 4YWYA 4P4EA 3SI0A 4OIDA 1ZG9A 1EE3P 3V38A 5F09A 4X8IA 1TY8A 2ZEFA 5LRJA 1PCAA 4PXEA 1CPXA 2PJBA 4A94A 1TXRA 3B3SA 4NGRA 1FNOA 4EWTA 1OBRA 3IC1A 3KI9A 2Q51A 3KHXA 3MRUA 4DJLA 3WC7A 5FSUA 2AFUA 1ZG8A 5J1QA 4DUKA 3NA6A 4X3RA 3B3CA 4P10A 2O53A 4ZX8A 1LOKA 4GUAA 2I3CA 5HVFA 1R3NA 3S9NA 3H8FA 3Q71A 2ZOGA 4PPZA 2PVVA 4PXBA 3D7DA 3B2YA 3FVLA 1ZLIA 2Q43A 5HVGA 4OC5A 3IWWA 2G9DA 1ELLP 3PFEA 2PJ5A 2GLFA 4WWVA 3GQEA 2FXKA 2ZENA 4JCAA 4ABKA 2BOAA 3EWQA 4ONWA 3KR5A 1YLOA 5LYDA 2XEFA 4PXDA 5K8MA 4J5SA 5DUSA 2VL1A 1VIXA 3EW5A 1TF8A 2NSMA 3SIHA 3KASA 2ANPA 3IEHA 4G1PA 3FF3A 3WC5A 5LYFA 3EJGA 1Y7EA 2C6CA 3PBBA 3WT4A 2WYRA 3QNVA 5LYLA 6CPAA 3RBUA 4EMEA 4X2TA 4R6TA 2RFHA 1LCPA 3MN8A 2PE3A 3B35A 3LMSA 4D86A 3KR4A 3SJFA 4A38A 5CMSA 4JGKA 3D7HA 3D67A 2X47A 1YW4A 4J5QA 4EFDA 2JBJA 4F9UA 3VH9A 5HVHA 3D7FA 3V45A 1VHOA 3H8GA 4MRIA 2ZEEA 4WJBA 1NJRA 4MCPA 4RUHA 4JLLA 4UIBA 4UEZA 3PB9X 3VARA 3SIGA 4UF4A 2PJ3A 1F57A 2PIYA 4P6YA 3KZWA 1GYTA 2ZEMA 4KYBA 4F8ZA 4NGNA 4ABLA 4OC0A 4TWEA 1LAPA 3GPGA 4IAVA 3B7IA 4IHMA 5HXDA 4JVVA 4A37A 3FJUA 4NFRA 2O4HA 1BLLE 1CPSA 2PJ1A 2XEGA 1LAMA 2ABZA 1DE4C 3IIFA 2WZNA 2CIJA 3RZAA 3KQZA 1AYEA 5CBMA 2CTCA 4K0CA 2AFSA 1HJZA 5CPAA 3L2NA 1XJOA 4MHYA 3FEEA 3VATA 2CF4A 3FMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC3 A;  2EEE A;  2DEA A;  2ZEH A;  4K3N A;  2ZEP A;  4IQY A;  3DGV A;  4ESS A;  3KGQ A;  1YW6 A;  4P4B A;  1TKJ A;  3TX8 A;  1DTD A;  1YME A;  1QMU A;  1VGY A;  1TXZ A;  2XEJ A;  5AIL A;  2PJ8 A;  4J4Z A;  3FX6 A;  5K8O A;  4UEE A;  1LFW A;  2QJ8 A;  3SJE A;  2GRE A;  2OOT A;  4YU9 A;  4Z65 A;  3NH4 A;  4NGT A;  1Z2L A;  4JZ0 A;  1BPM A;  1ZLH A;  2PJA A;  4MHN A;  4AXV A;  3SII A;  1VHU A;  5JH9 A;  5THW A;  5LYI A;  1F2O A;  2XEI A;  3IO1 A;  2CTB A;  3PEI A;  3V7Z A;  4UML A;  4MHZ A;  1IGB A;  2AFX A;  3GUX A;  4P4D A;  1UWY A;  3EWO A;  1HDQ A;  3IFE A;  5HIH A;  1XRY A;  2ZEO A;  2PCU A;  1CP6 A;  1ELM P;  1Y0R A;  2FVG A;  3D66 A;  5FSY A;  4P45 A;  4W9Y A;  4P4F A;  4ZYQ A;  2AFO A;  3HLP A;  3WAB A;  2PJ4 A;  3GQO A;  2PVW A;  3CT9 A;  2PJ2 A;  4NGS A;  3PB8 X;  3GLJ A;  3PBE A;  1ARL A;  3ETI A;  4B6Z A;  4MCS A;  7CPA A;  3TC8 A;  2PJ9 A;  1KWM A;  2ZED A;  1XBU A;  2JEW A;  1RTQ A;  2V8H A;  1YD9 A;  3IJ3 A;  2PIZ A;  3B3V A;  1YSJ A;  1Q7L A;  2IMO A;  1VHE A;  3PRT A;  2AFZ A;  1R43 A;  4NGM A;  4ETJ A;  2F7V A;  5JGF A;  2C6P A;  3BXM A;  4MMO A;  2QYV A;  2AFC A;  3EJF A;  3FEC A;  3HUV A;  4TNU A;  1PYT B;  3SI1 A;  5LRK A;  3GPQ A;  3JRU A;  1TKF A;  4OME A;  2PRQ A;  1BAV A;  4F9V A;  1SPV A;  3T8W A;  3NFZ A;  5LRG A;  4NGQ A;  2PJ7 A;  5ELY A;  1BPN A;  5FSZ A;  1CG2 A;  3BI1 A;  3KHZ A;  4Q7A A;  5I4M A;  2PJC A;  4FAI A;  5D8N A;  5DS0 A;  4R8F A;  2EK8 A;  1CX8 A;  4TU0 A;  3NH8 A;  2LGR A;  3BHX A;  4DYO A;  4MCQ A;  2POK A;  3RAM A;  1LAN A;  3SJX A;  2Q4Z A;  1ZG7 A;  2IJZ A;  4OC1 A;  5IB9 A;  3PB4 X;  3K2K A;  3KQX A;  3D7G A;  2EWB A;  4FUU A;  2IQ6 A;  3B3W A;  5K8N A;  1ZR3 A;  1IY7 A;  4UEF A;  3GB0 A;  4MHP A;  1H8L A;  4KSI A;  3PB7 X;  4H2K A;  4IK2 A;  3IID A;  2EK9 A;  2ZEL A;  4PXC A;  3Q6Z A;  1F2P A;  4ZY1 A;  2DX6 A;  3B3T A;  3KL9 A;  4CPA A;  3PFO A;  3CDX A;  1ZR5 A;  1XMB A;  5K8P A;  4NGP A;  3K9T A;  5CB5 A;  1CBX A;  3JZT A;  4R7M A;  3CPA A;  1ARM A;  2QVP A;  2GU2 A;  4R76 A;  1M4L A;  3BI0 A;  3WC6 A;  5FSV A;  3S9L A;  2FAV A;  3NH5 A;  3ISX A;  3PB6 X;  4GM5 A;  4NJR A;  4ZY2 A;  2OR4 A;  4ETK A;  2C6G A;  2HC9 A;  3V2B A;  4MCR A;  4OIW A;  4GVV A;  2FG1 A;  2V8G A;  3ISZ A;  5D29 A;  4A39 A;  1HDU A;  3VFQ A;  2NYQ A;  4OC4 A;  4FBE A;  2JBK A;  1QQ9 A;  4GVW A;  5HOL A;  4BD9 A;  3GPO A;  2PJ0 A;  2F8H A;  3N5F A;  3D68 A;  4FWU A;  2GLJ A;  1CP7 A;  3H8E A;  4P44 A;  4JYW A;  2AFM A;  2BFR A;  4PQA A;  1TKH A;  3LWU A;  2XD7 A;  2VRI A;  3SIJ A;  2V8V A;  2ZOF A;  4OC2 A;  1TF9 A;  2PJ6 A;  2V77 A;  4NJQ A;  1NSA A;  2L8R A;  3SJG A;  4OP4 A;  1XFO A;  2BO9 A;  5FSX A;  2AFW A;  3EWR A;  4P4J A;  2ACF A;  4ZY0 A;  1AMP A;  3DLJ A;  8CPA A;  4J5R A;  3FH4 A;  3IIB A;  4UIA A;  1JQG A;  3I1U A;  1HEE A;  4ZX9 A;  5E3B A;  5CB3 A;  5JM6 A;  2HB6 A;  3CPX A;  4LQG A;  4ZI6 A;  3EKE A;  4OKO A;  2RB7 A;  1Y0Y A;  2V8D A;  3S9M A;  2ZEG A;  1Z5R A;  3FED A;  4O23 A;  2BCO A;  1FT7 A;  3EWP A;  3SI2 A;  4P4I A;  1Z8L A;  4MXU A;  2BFQ A;  2J9A A;  3D4U A;  2C1C A;  4YWY A;  4P4E A;  3SI0 A;  4OID A;  1ZG9 A;  1EE3 P;  3V38 A;  5F09 A;  4X8I A;  1TY8 A;  2ZEF A;  5LRJ A;  1PCA A;  4PXE A;  1CPX A;  2PJB A;  4A94 A;  1TXR A;  3B3S A;  4NGR A;  1FNO A;  4EWT A;  1OBR A;  3IC1 A;  3KI9 A;  2Q51 A;  3KHX A;  3MRU A;  4DJL A;  3WC7 A;  5FSU A;  2AFU A;  1ZG8 A;  5J1Q A;  4DUK A;  3NA6 A;  4X3R A;  3B3C A;  4P10 A;  2O53 A;  4ZX8 A;  1LOK A;  4GUA A;  2I3C A;  5HVF A;  1R3N A;  3S9N A;  3H8F A;  3Q71 A;  2ZOG A;  4PPZ A;  2PVV A;  4PXB A;  3D7D A;  3B2Y A;  3FVL A;  1ZLI A;  2Q43 A;  5HVG A;  4OC5 A;  3IWW A;  2G9D A;  1ELL P;  3PFE A;  2PJ5 A;  2GLF A;  4WWV A;  3GQE A;  2FXK A;  2ZEN A;  4JCA A;  4ABK A;  2BOA A;  3EWQ A;  4ONW A;  3KR5 A;  1YLO A;  5LYD A;  2XEF A;  4PXD A;  5K8M A;  4J5S A;  5DUS A;  2VL1 A;  1VIX A;  3EW5 A;  1TF8 A;  2NSM A;  3SIH A;  3KAS A;  2ANP A;  3IEH A;  4G1P A;  3FF3 A;  3WC5 A;  5LYF A;  3EJG A;  1Y7E A;  2C6C A;  3PBB A;  3WT4 A;  2WYR A;  3QNV A;  5LYL A;  6CPA A;  3RBU A;  4EME A;  4X2T A;  4R6T A;  2RFH A;  1LCP A;  3MN8 A;  2PE3 A;  3B35 A;  3LMS A;  4D86 A;  3KR4 A;  3SJF A;  4A38 A;  5CMS A;  4JGK A;  3D7H A;  3D67 A;  2X47 A;  1YW4 A;  4J5Q A;  4EFD A;  2JBJ A;  4F9U A;  3VH9 A;  5HVH A;  3D7F A;  3V45 A;  1VHO A;  3H8G A;  4MRI A;  2ZEE A;  4WJB A;  1NJR A;  4MCP A;  4RUH A;  4JLL A;  4UIB A;  4UEZ A;  3PB9 X;  3VAR A;  3SIG A;  4UF4 A;  2PJ3 A;  1F57 A;  2PIY A;  4P6Y A;  3KZW A;  1GYT A;  2ZEM A;  4KYB A;  4F8Z A;  4NGN A;  4ABL A;  4OC0 A;  4TWE A;  1LAP A;  3GPG A;  4IAV A;  3B7I A;  4IHM A;  5HXD A;  4JVV A;  4A37 A;  3FJU A;  4NFR A;  2O4H A;  1BLL E;  1CPS A;  2PJ1 A;  2XEG A;  1LAM A;  2ABZ A;  1DE4 C;  3IIF A;  2WZN A;  2CIJ A;  3RZA A;  3KQZ A;  1AYE A;  5CBM A;  2CTC A;  4K0C A;  2AFS A;  1HJZ A;  5CPA A;  3L2N A;  1XJO A;  4MHY A;  3FEE A;  3VAT A;  2CF4 A;  3FMC A; 
#chains in the Genus database with same CATH topology
 1I12 A;  1YLE A;  3TO7 A;  4KVX A;  3R9F A;  4OC3 A;  2EEE A;  2DEA A;  3TT2 A;  1IIC A;  2ZEH A;  3DDD A;  3S6F A;  4K3N A;  1Y9W A;  2ZEP A;  4IQY A;  3DGV A;  4ESS A;  3KGQ A;  1YW6 A;  4P4B A;  1TKJ A;  4C7I A;  4CRY B;  3TX8 A;  1DTD A;  1YME A;  1QMU A;  3IWG A;  1VGY A;  1TXZ A;  2XEJ A;  2ZW5 A;  4KLV A;  5AIL A;  2PJ8 A;  1NE9 A;  3B8G A;  4J4Z A;  2FS5 A;  3FX6 A;  4J3G A;  5C82 A;  5K8O A;  2DPS A;  3LD2 A;  3MGD A;  4U9Z A;  1I1D A;  4UEE A;  4Y49 B;  1LFW A;  2QJ8 A;  1IB1 E;  4CS0 B;  4L89 A;  3SJE A;  2BL1 A;  1YX0 A;  1B87 A;  2GRE A;  3D2M A;  3DR6 A;  4KSF A;  4JWP A;  2OOT A;  4AVB A;  4YU9 A;  4CYO A;  4MFP A;  3UY5 A;  1QST A;  4A2Z A;  4Z65 A;  5F46 A;  3NH4 A;  4NGT A;  4UCP A;  1Z2L A;  4JZ0 A;  5F48 A;  1BPM A;  1ZLH A;  2PJA A;  3JTK A;  4MHN A;  5C88 A;  4AXV A;  3SII A;  1VHU A;  5JH9 A;  1ON0 A;  5THW A;  5LYI A;  1MJA A;  4DNC A;  2BEI A;  4UWJ A;  2REF A;  2FCK A;  4PSW A;  4H6U A;  3DNS A;  2YGW A;  3IGR A;  1F2O A;  2I79 A;  2XEI A;  1J4J A;  3IO1 A;  1XE4 A;  4NXY A;  4B13 A;  2CTB A;  2P6G A;  3V8I A;  4KSA A;  5BWA B;  3PEI A;  3F0A A;  1S7F A;  3V7Z A;  4UML A;  4MHZ A;  4OLL A;  1PU9 A;  2Z3K A;  5G21 A;  1IGB A;  2AFX A;  3EXN A;  3GUX A;  4P4D A;  3PZJ A;  4UBR A;  3S6H A;  1UWY A;  2P6E A;  4QVT A;  2JEV A;  2HV2 A;  3EWO A;  2GIV A;  2VQY A;  4UA3 A;  3G8W A;  1HDQ A;  3F5B A;  2GFQ A;  3IFE A;  4OAD A;  5HIH A;  3JUW A;  4M6G A;  4UFW A;  4KOW A;  4R3L A;  1V0C A;  1XRY A;  3FB3 A;  2ZEO A;  1QSR A;  2PCU A;  1CP6 A;  1ELM P;  1Y0R A;  2F5I A;  2FVG A;  5FSY A;  3D66 A;  4P45 A;  4W9Y A;  4P4F A;  4C2Z A;  4ZYQ A;  4KOS A;  2AFO A;  3HLP A;  1OZP A;  2PJ4 A;  3WAB A;  5FVJ A;  3GQO A;  2CNM A;  2PVW A;  4UFV A;  3CT9 A;  2PJ2 A;  4NGS A;  3PB8 X;  3GLJ A;  4UWI A;  4UCN A;  3GYA A;  4GXH A;  3PBE A;  1ARL A;  3ETI A;  2CNS A;  4H6Z A;  2C27 A;  4MCS A;  4B6Z A;  5A27 A;  5AG4 A;  4CAX A;  7CPA A;  1IYK A;  2EBJ A;  3TC8 A;  5H84 A;  2R1I A;  2PJ9 A;  2Q4Y A;  4ORF A;  4R87 A;  1KWM A;  3TOB A;  3R95 A;  2ZED A;  1XBU A;  2JEW A;  1RTQ A;  2V8H A;  2PR8 A;  1YD9 A;  1YK3 A;  2DPT A;  4U9Y A;  2J8N A;  3IJ3 A;  3SXO A;  2PIZ A;  3B3V A;  1YSJ A;  3BJ7 A;  1Q7L A;  2IMO A;  4KZT A;  1VHE A;  3PRT A;  2AFZ A;  1YGH A;  4F9V A;  5HMN A;  3P2F A;  1FY7 A;  3GKR A;  3IU2 A;  1R43 A;  4NGM A;  3RNZ A;  4ETJ A;  2FXF A;  5KTA A;  4JD6 A;  2F7V A;  1CJW A;  5JGF A;  2C6P A;  3BXM A;  4MMO A;  2A4N A;  2QYV A;  2YNC A;  4XNH C;  2ZW6 A;  2AFC A;  3EJF A;  3FEC A;  3HUV A;  4TNU A;  1PYT B;  3SI1 A;  3FXT A;  2EVN A;  5LRK A;  3GPQ A;  3JRU A;  2PRB A;  1TKF A;  4OME A;  2PRQ A;  1BAV A;  4U5Y A;  1SPV A;  3T8W A;  3NFZ A;  4XPD C;  4NGQ A;  5LRG A;  3CXQ A;  1S60 A;  2PJ7 A;  5ELY A;  1BPN A;  5FSZ A;  1CG2 A;  3BI1 A;  3KHZ A;  4LUA A;  4Q7A A;  1XF8 A;  3H5Z A;  1NSL A;  2JLM A;  2PJC A;  4A32 A;  4AG7 A;  4B5P B;  4FAI A;  5D8N A;  4KUB A;  5AG7 A;  5I4M A;  4MFJ A;  5DS0 A;  4R8F A;  1RO5 A;  1CX8 A;  2EK8 A;  4MFQ A;  5I0C A;  4CYQ A;  4TU0 A;  3NH8 A;  2LGR A;  2B4D B;  3EO4 A;  3BHX A;  4DYO A;  3DSB A;  2B5G A;  4CAE A;  2PC1 A;  3G3S A;  4MCQ A;  2POK A;  1VKC A;  1XIX A;  5CNP A;  2YNE A;  3RAM A;  2OB0 A;  4A30 A;  4A33 A;  1LAN A;  4CAF A;  3SJX A;  2Q4Z A;  1ZG7 A;  2IJZ A;  4OC1 A;  5IB9 A;  3CXS A;  3PB4 X;  3P2H A;  4FD7 A;  3PGP A;  3K2K A;  4FD5 A;  4CGO A;  3FNC A;  2AE6 A;  4NSQ A;  3FIX A;  4YFJ A;  3KQX A;  1YVO A;  4LQ6 A;  4A95 A;  3D7G A;  2EWB A;  4FUU A;  4BMH A;  2IQ6 A;  2WCT A;  3B3W A;  5K8N A;  1ZR3 A;  4KOX A;  4OAE A;  1IY7 A;  1XOV A;  3D3S A;  1Z4R A;  4UEF A;  1KUV A;  1KZF A;  3GB0 A;  3GY9 A;  1MJB A;  4MHP A;  1I21 A;  1M44 A;  1H8L A;  4CGP A;  4KSI A;  3PB7 X;  2D4P A;  4NCZ A;  2BSW A;  4H2K A;  4IK2 A;  3IID A;  1IOI A;  5IV0 A;  1WWZ A;  2EK9 A;  2ZEL A;  4PXC A;  3Q6Z A;  2OH1 A;  1M4D A;  1F2P A;  4ZY1 A;  4XNH B;  2DX6 A;  1U6M A;  4AVC A;  2QEC A;  3B3T A;  3KL9 A;  4CPA A;  3PFO A;  3CDX A;  1ZR5 A;  4XPD B;  1XMB A;  5K8P A;  4NGP A;  3K9T A;  3S6K A;  5CB5 A;  1CBX A;  2ODF A;  1Q2C A;  3JZT A;  4R7M A;  1QSN A;  1ARM A;  3CPA A;  3N7Z A;  4A31 A;  4KS9 A;  1Y9K A;  2QVP A;  2GU2 A;  1Z8T A;  2O28 A;  3W6S A;  4R76 A;  3TOA A;  4C68 A;  5J8C A;  2Z3M A;  4KUA A;  1M4L A;  2Z3L A;  3BI0 A;  2JDC A;  4IUS A;  3WC6 A;  3CZX A;  5FSV A;  3S9L A;  1KUY A;  4L8A A;  3RO0 A;  2FAV A;  3NH5 A;  2VZZ A;  3ISX A;  4QC6 A;  5H86 A;  2Z10 A;  3PB6 X;  3SHP A;  2Q4V A;  3KKW A;  3QAH A;  4GM5 A;  4NJR A;  4ZY2 A;  4UCM A;  4E2A A;  2OR4 A;  4ETK A;  4HNY B;  3CXP A;  4AB7 A;  2C6G A;  4X5K A;  3IU1 A;  2HC9 A;  3V2B A;  4MCR A;  4OIW A;  4GVV A;  2FG1 A;  2V8G A;  3ISZ A;  5D29 A;  2IL4 A;  4A39 A;  1S7N A;  2JZE A;  3VFQ A;  1HDU A;  2NYQ A;  4OC4 A;  4FBE A;  4C7H A;  4AG9 A;  2JBK A;  1QQ9 A;  4EVY A;  4GVW A;  1Z8W A;  5HOL A;  4KOY A;  3GPO A;  2PJ0 A;  3D8P A;  4BD9 A;  2F8H A;  2R7H A;  2BUE A;  4M3S A;  3N5F A;  3NE8 A;  4CGM A;  2YND A;  4QBJ A;  3D68 A;  2FIA A;  4FWU A;  5KTC A;  2GLJ A;  1CP7 A;  3H8E A;  4RS2 A;  2FIW A;  4YRH A;  4P44 A;  2J8M A;  4ONU A;  1Y7R A;  2I00 A;  4XPK A;  4JYW A;  5AG6 A;  2AFM A;  1X12 A;  4B10 A;  2BFR A;  2EUI A;  4ZBG A;  4PQA A;  1YRE A;  2CY2 A;  2K5T A;  1TKH A;  3ZJ0 A;  4M6H A;  3R9G A;  4F0Y A;  3LWU A;  2XD7 A;  2YNC C;  2RNK A;  2VRI A;  4B14 A;  3SIJ A;  2V8V A;  2WPW A;  2VI7 A;  2ZOF A;  4YGO A;  4F0X A;  4OC2 A;  5EBV A;  3DR8 A;  3WR7 A;  1TF9 A;  4NEX A;  2JZF A;  2PJ6 A;  2Q7S A;  2V77 A;  4KOU A;  1GHE A;  1NSA A;  4NJQ A;  2L8R A;  3EY5 A;  1P4N A;  1XFO A;  4OP4 A;  3SJG A;  1K4J A;  2BO9 A;  4PK2 A;  5FSX A;  5GCN A;  2ZPA A;  2AFW A;  3TCV A;  1QSO A;  2P6F A;  3EWR A;  4KVO E;  4P4J A;  2ACF A;  4ZY0 A;  1AMP A;  3DLJ A;  5G1Z A;  4J5R A;  3FH4 A;  3IIB A;  2B3V A;  4FD4 A;  1JQG A;  4UIA A;  4I49 A;  4M6I A;  2VXK A;  1HEE A;  3D2P A;  3I1U A;  4ZX9 A;  5E3B A;  2CXA A;  5CB3 A;  4RI1 A;  5ISV A;  2WUU A;  2HB6 A;  5JM6 A;  3CPX A;  4LQG A;  4ZI6 A;  3EKE A;  3I3G A;  4JJX A;  4OKO A;  2RB7 A;  1Y0Y A;  2V8D A;  5DWM A;  3IWE A;  4MHD A;  3S9M A;  2W2G A;  2ZEG A;  3T9Y A;  1Z5R A;  4R3K A;  3R9E A;  1M4G A;  3FED A;  2FE7 A;  5J8F A;  4QUS A;  4KVM E;  2KQV A;  1SQH A;  4HKF A;  1BO4 A;  2DF5 A;  4KOT A;  2WPX A;  2BCO A;  2KCW A;  3QAY A;  4O23 A;  4CYP A;  1FT7 A;  2FSR A;  2JZD A;  2VEZ A;  2Q04 A;  3EWP A;  1NMT A;  4B5P A;  5IX3 A;  4LX9 A;  4JXQ A;  3SI2 A;  4P4I A;  1Z8L A;  4MXU A;  1QSM A;  3T90 A;  2BFQ A;  2J9A A;  3D4U A;  5F47 A;  2G0B A;  2C1C A;  2B4D A;  4YWY A;  4P4E A;  3SI0 A;  4OID A;  5IB0 A;  1ZG9 A;  1EE3 P;  3TO6 A;  4II9 A;  3V38 A;  5F09 A;  3RYO A;  1IID A;  4X8I A;  3BLN A;  1M1D A;  1TY8 A;  3JVN A;  2J8R A;  4AVA A;  4H89 A;  2ZEF A;  3W91 A;  2FT0 A;  1YVK A;  5LRJ A;  1PCA A;  2QIR A;  4E8O A;  4PK3 A;  4M85 A;  1LRZ A;  4PXE A;  3R96 A;  1CPX A;  2AJ6 A;  4FD6 A;  2FL4 A;  2PJB A;  2ZXV A;  1S7K A;  4A94 A;  1TXR A;  3B3S A;  4KOV A;  4NGR A;  2Z3O A;  2ZW4 A;  3H4Q A;  1FNO A;  2Z0Z A;  4IF5 A;  4EWT A;  5KTD A;  1OBR A;  1XEB A;  3IC1 A;  3KI9 A;  2Q51 A;  3KHX A;  3MRU A;  4DJL A;  4MJ8 A;  5JQ4 A;  3WC7 A;  4BIN A;  1IOF A;  4BBH A;  5FSU A;  2AFU A;  4PV6 A;  1ZG8 A;  5J1Q A;  1MJ9 A;  2X7B A;  4CRZ B;  4DUK A;  4XPL A;  3NA6 A;  4X3R A;  3A9L A;  3E0K A;  4CAW A;  3SXN A;  3B3C A;  4P10 A;  4MI4 A;  2Q7B A;  5A28 A;  1L0C A;  2O53 A;  4ZX8 A;  1LOK A;  4GUA A;  2I3C A;  5DWN A;  5HVF A;  1IYL A;  3F8K A;  4RN7 A;  3VWE A;  2B4B A;  1R3N A;  4B11 A;  4B5O A;  3S9N A;  3H8F A;  3Q71 A;  3FRM A;  3TTH A;  2ZOG A;  4PPZ A;  5HH1 A;  4QB9 A;  2PVV A;  2Z3N A;  4PXB A;  1B6B A;  2ATR A;  3NE7 A;  3D7D A;  3B2Y A;  3FVL A;  2VZY A;  2HQY A;  1ZLI A;  2Q43 A;  3LAC A;  1BOB A;  4F6A A;  5HVG A;  1TIQ A;  4OC5 A;  4MFL A;  1Q2Y A;  2G9D A;  1ELL P;  1M4I A;  2PJ5 A;  3IWW A;  3PFE A;  3FBU A;  2GLF A;  2Q0Y A;  3I9S A;  2JDD A;  5AG5 A;  3C26 A;  2R8V A;  3TFY A;  2PDO A;  4WWV A;  3GQE A;  1XMT A;  2FXK A;  1JWQ A;  1YR0 A;  2ZEN A;  2WSA A;  4JCA A;  4ABK A;  2BOA A;  4JLY A;  4NF1 A;  1WK4 A;  3EWQ A;  4ONW A;  4CGL A;  3LOD A;  1S7L A;  4JXR A;  3KR5 A;  1YLO A;  1YQE A;  1MK4 A;  5G20 A;  1RXT A;  2HUZ A;  5LYD A;  2XEF A;  4PXD A;  2B58 A;  3K9U A;  5K8M A;  4J5S A;  5DUS A;  2PSW A;  1VIX A;  3EW5 A;  1TF8 A;  1S3Z A;  1VHS A;  3SIH A;  2NSM A;  2ANP A;  3KAS A;  4K30 A;  1IU8 A;  3IEH A;  4G1P A;  3S6G A;  1R57 A;  3FF3 A;  2CNT A;  3WC5 A;  5LYF A;  3EJG A;  1Y7E A;  2C6C A;  2VBQ A;  3PBB A;  3ZZI A;  3WT4 A;  2OZU A;  2WYR A;  3QNV A;  3TO9 A;  4E0A A;  3FYN A;  6CPA A;  3RBU A;  4MFZ A;  5LYL A;  4EME A;  4X2T A;  4R6T A;  1X10 A;  2RFH A;  1LCP A;  3BJ8 A;  3MN8 A;  4HNX B;  2PE3 A;  2Q44 A;  3B35 A;  2ARH A;  2OZG A;  3LMS A;  4Q38 A;  4D86 A;  2PQ8 A;  3KR4 A;  3SJF A;  3OWC A;  4A38 A;  5CMS A;  4JGK A;  3D7H A;  3D67 A;  2X47 A;  1YW4 A;  4HNW B;  4C2X A;  4J5Q A;  4EFD A;  2JBJ A;  4F9U A;  3VH9 A;  5HVH A;  3D7F A;  3V45 A;  1VHO A;  3H8G A;  2OZH A;  4MRI A;  2ZEE A;  3PP9 A;  2RC4 A;  1Z9U A;  4WJB A;  4ZGY B;  1NJR A;  3W6X A;  4C2Y A;  4CYN A;  8CPA A;  3TE4 A;  2GAN A;  4MCP A;  2ZW7 A;  4RUH A;  4JLL A;  4UIB A;  4KOR A;  4UEZ A;  5EC4 A;  2EO8 A;  3PB9 X;  1Z4E A;  2B3U A;  2D4O A;  4MY3 A;  4MY0 A;  3VAR A;  2Y0M A;  3SIG A;  4UF4 A;  2PJ3 A;  5E96 A;  1F57 A;  2PIY A;  2R98 A;  4P6Y A;  3KZW A;  5EMI A;  1GYT A;  5F49 A;  1A2Z A;  2ZEM A;  4KYB A;  4F8Z A;  4CGN A;  1S5K A;  4NGN A;  4R9M A;  4ABL A;  4MBU A;  4OC0 A;  4TWE A;  4PSX A;  5G22 A;  1LAP A;  3GPG A;  3GIU A;  4B12 A;  4IAV A;  3B7I A;  1PUA A;  2DXQ A;  1P0H A;  3R1K A;  4IHM A;  2P0W A;  4KLW A;  4JVV A;  5HXD A;  4A37 A;  1UFH A;  3FJU A;  4NFR A;  2O4H A;  4Y49 C;  5AGE A;  2G3A A;  1BLL E;  1CPS A;  2PJ1 A;  1Q2D A;  1CM0 A;  4UFX A;  2XEG A;  1LAM A;  2ABZ A;  4GS4 A;  2QML A;  1DE4 C;  2REE A;  3IIF A;  2WZN A;  2CIJ A;  3RZA A;  3KQZ A;  1AYE A;  3EFA A;  4HPS A;  1Z8X A;  4Q36 A;  1AUG A;  2NMT A;  1ZO0 A;  2H5M A;  5CBM A;  1N71 A;  2CTC A;  2Z11 A;  4K0C A;  2B5G B;  2AFS A;  2VL1 A;  1KUX A;  3QB8 A;  4MFK A;  1HJZ A;  5CPA A;  3L2N A;  5JPH A;  3EC4 A;  2Z3P A;  2GE3 A;  4R57 A;  4CAV A;  1XJO A;  2PR1 A;  4MHY A;  2OU2 A;  3FEE A;  3VAT A;  2G3T A;  2CF4 A;  3VWD A;  3FMC A; 
#chains in the Genus database with same CATH homology
 4OC3 A;  2EEE A;  2DEA A;  2ZEH A;  4K3N A;  2ZEP A;  4IQY A;  3DGV A;  4ESS A;  3KGQ A;  1YW6 A;  4P4B A;  1TKJ A;  3TX8 A;  1DTD A;  1YME A;  1QMU A;  1VGY A;  1TXZ A;  2XEJ A;  5AIL A;  2PJ8 A;  4J4Z A;  3FX6 A;  5K8O A;  4UEE A;  1LFW A;  2QJ8 A;  3SJE A;  2GRE A;  2OOT A;  4YU9 A;  4Z65 A;  3NH4 A;  4NGT A;  1Z2L A;  4JZ0 A;  1BPM A;  1ZLH A;  2PJA A;  4MHN A;  4AXV A;  3SII A;  1VHU A;  5JH9 A;  5THW A;  5LYI A;  1F2O A;  2XEI A;  3IO1 A;  2CTB A;  3PEI A;  3V7Z A;  4UML A;  4MHZ A;  1IGB A;  2AFX A;  3GUX A;  4P4D A;  1UWY A;  3EWO A;  1HDQ A;  3IFE A;  5HIH A;  1XRY A;  2ZEO A;  2PCU A;  1CP6 A;  1ELM P;  1Y0R A;  2FVG A;  3D66 A;  5FSY A;  4P45 A;  4W9Y A;  4P4F A;  4ZYQ A;  2AFO A;  3HLP A;  3WAB A;  2PJ4 A;  3GQO A;  2PVW A;  3CT9 A;  2PJ2 A;  4NGS A;  3PB8 X;  3GLJ A;  3PBE A;  1ARL A;  3ETI A;  4B6Z A;  4MCS A;  7CPA A;  3TC8 A;  2PJ9 A;  1KWM A;  2ZED A;  1XBU A;  2JEW A;  1RTQ A;  2V8H A;  1YD9 A;  3IJ3 A;  2PIZ A;  3B3V A;  1YSJ A;  1Q7L A;  2IMO A;  1VHE A;  3PRT A;  2AFZ A;  1R43 A;  4NGM A;  4ETJ A;  2F7V A;  5JGF A;  2C6P A;  3BXM A;  4MMO A;  2QYV A;  2AFC A;  3EJF A;  3FEC A;  3HUV A;  4TNU A;  1PYT B;  3SI1 A;  5LRK A;  3GPQ A;  3JRU A;  1TKF A;  4OME A;  2PRQ A;  1BAV A;  4F9V A;  1SPV A;  3T8W A;  3NFZ A;  5LRG A;  4NGQ A;  2PJ7 A;  5ELY A;  1BPN A;  5FSZ A;  1CG2 A;  3BI1 A;  3KHZ A;  4Q7A A;  5I4M A;  2PJC A;  4FAI A;  5D8N A;  5DS0 A;  4R8F A;  2EK8 A;  1CX8 A;  4TU0 A;  3NH8 A;  2LGR A;  3BHX A;  4DYO A;  4MCQ A;  2POK A;  3RAM A;  1LAN A;  3SJX A;  2Q4Z A;  1ZG7 A;  2IJZ A;  4OC1 A;  5IB9 A;  3PB4 X;  3K2K A;  3KQX A;  3D7G A;  2EWB A;  4FUU A;  2IQ6 A;  3B3W A;  5K8N A;  1ZR3 A;  1IY7 A;  4UEF A;  3GB0 A;  4MHP A;  1H8L A;  4KSI A;  3PB7 X;  4H2K A;  4IK2 A;  3IID A;  2EK9 A;  2ZEL A;  4PXC A;  3Q6Z A;  1F2P A;  4ZY1 A;  2DX6 A;  3B3T A;  3KL9 A;  4CPA A;  3PFO A;  3CDX A;  1ZR5 A;  1XMB A;  5K8P A;  4NGP A;  3K9T A;  5CB5 A;  1CBX A;  3JZT A;  4R7M A;  3CPA A;  1ARM A;  2QVP A;  2GU2 A;  4R76 A;  1M4L A;  3BI0 A;  3WC6 A;  5FSV A;  3S9L A;  2FAV A;  3NH5 A;  3ISX A;  3PB6 X;  4GM5 A;  4NJR A;  4ZY2 A;  2OR4 A;  4ETK A;  2C6G A;  2HC9 A;  3V2B A;  4MCR A;  4OIW A;  4GVV A;  2FG1 A;  2V8G A;  3ISZ A;  5D29 A;  4A39 A;  1HDU A;  3VFQ A;  2NYQ A;  4OC4 A;  4FBE A;  2JBK A;  1QQ9 A;  4GVW A;  5HOL A;  4BD9 A;  3GPO A;  2PJ0 A;  2F8H A;  3N5F A;  3D68 A;  4FWU A;  2GLJ A;  1CP7 A;  3H8E A;  4P44 A;  4JYW A;  2AFM A;  2BFR A;  4PQA A;  1TKH A;  3LWU A;  2XD7 A;  2VRI A;  3SIJ A;  2V8V A;  2ZOF A;  4OC2 A;  1TF9 A;  2PJ6 A;  2V77 A;  4NJQ A;  1NSA A;  2L8R A;  3SJG A;  4OP4 A;  1XFO A;  2BO9 A;  5FSX A;  2AFW A;  3EWR A;  4P4J A;  2ACF A;  4ZY0 A;  1AMP A;  3DLJ A;  8CPA A;  4J5R A;  3FH4 A;  3IIB A;  4UIA A;  1JQG A;  3I1U A;  1HEE A;  4ZX9 A;  5E3B A;  5CB3 A;  5JM6 A;  2HB6 A;  3CPX A;  4LQG A;  4ZI6 A;  3EKE A;  4OKO A;  2RB7 A;  1Y0Y A;  2V8D A;  3S9M A;  2ZEG A;  1Z5R A;  3FED A;  4O23 A;  2BCO A;  1FT7 A;  3EWP A;  3SI2 A;  4P4I A;  1Z8L A;  4MXU A;  2BFQ A;  2J9A A;  3D4U A;  2C1C A;  4YWY A;  4P4E A;  3SI0 A;  4OID A;  1ZG9 A;  1EE3 P;  3V38 A;  5F09 A;  4X8I A;  1TY8 A;  2ZEF A;  5LRJ A;  1PCA A;  4PXE A;  1CPX A;  2PJB A;  4A94 A;  1TXR A;  3B3S A;  4NGR A;  1FNO A;  4EWT A;  1OBR A;  3IC1 A;  3KI9 A;  2Q51 A;  3KHX A;  3MRU A;  4DJL A;  3WC7 A;  5FSU A;  2AFU A;  1ZG8 A;  5J1Q A;  4DUK A;  3NA6 A;  4X3R A;  3B3C A;  4P10 A;  2O53 A;  4ZX8 A;  1LOK A;  4GUA A;  2I3C A;  5HVF A;  1R3N A;  3S9N A;  3H8F A;  3Q71 A;  2ZOG A;  4PPZ A;  2PVV A;  4PXB A;  3D7D A;  3B2Y A;  3FVL A;  1ZLI A;  2Q43 A;  5HVG A;  4OC5 A;  3IWW A;  2G9D A;  1ELL P;  3PFE A;  2PJ5 A;  2GLF A;  4WWV A;  3GQE A;  2FXK A;  2ZEN A;  4JCA A;  4ABK A;  2BOA A;  3EWQ A;  4ONW A;  3KR5 A;  1YLO A;  5LYD A;  2XEF A;  4PXD A;  5K8M A;  4J5S A;  5DUS A;  2VL1 A;  1VIX A;  3EW5 A;  1TF8 A;  2NSM A;  3SIH A;  3KAS A;  2ANP A;  3IEH A;  4G1P A;  3FF3 A;  3WC5 A;  5LYF A;  3EJG A;  1Y7E A;  2C6C A;  3PBB A;  3WT4 A;  2WYR A;  3QNV A;  5LYL A;  6CPA A;  3RBU A;  4EME A;  4X2T A;  4R6T A;  2RFH A;  1LCP A;  3MN8 A;  2PE3 A;  3B35 A;  3LMS A;  4D86 A;  3KR4 A;  3SJF A;  4A38 A;  5CMS A;  4JGK A;  3D7H A;  3D67 A;  2X47 A;  1YW4 A;  4J5Q A;  4EFD A;  2JBJ A;  4F9U A;  3VH9 A;  5HVH A;  3D7F A;  3V45 A;  1VHO A;  3H8G A;  4MRI A;  2ZEE A;  4WJB A;  1NJR A;  4MCP A;  4RUH A;  4JLL A;  4UIB A;  4UEZ A;  3PB9 X;  3VAR A;  3SIG A;  4UF4 A;  2PJ3 A;  1F57 A;  2PIY A;  4P6Y A;  3KZW A;  1GYT A;  2ZEM A;  4KYB A;  4F8Z A;  4NGN A;  4ABL A;  4OC0 A;  4TWE A;  1LAP A;  3GPG A;  4IAV A;  3B7I A;  4IHM A;  5HXD A;  4JVV A;  4A37 A;  3FJU A;  4NFR A;  2O4H A;  1BLL E;  1CPS A;  2PJ1 A;  2XEG A;  1LAM A;  2ABZ A;  1DE4 C;  3IIF A;  2WZN A;  2CIJ A;  3RZA A;  3KQZ A;  1AYE A;  5CBM A;  2CTC A;  4K0C A;  2AFS A;  1HJZ A;  5CPA A;  3L2N A;  1XJO A;  4MHY A;  3FEE A;  3VAT A;  2CF4 A;  3FMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...