4KYBA

Crystal structure of de novo designed serine hydrolase osh55.14_e3, northeast structural genomics consortium target or342
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTVGGAWVGGLPAEAVCRVMREEIKKAPDTLEVTGVHGTEKSAEAPRRARLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR342
rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords Designed Protein OR342
total genus 50
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4kybA00
4IQYA 4J5RA 5CBMA 1LAPA 3PEIA 4ZX9A 4K0CA 3T8WA 4GUAA 5CB3A 5HIHA 1ZR3A 3GQOA 3V2BA 1BLLE 4JVVA 1LAMA 3KQXA 2FAVA 1HJZA 5FSVA 3VFQA 3JZTA 5DUSA 4UMLA 2XD7A 3SIIA 3GQEA 2DX6A 3SIGA 4K3NA 3H8FA 4ESSA 4JCAA 4ZI6A 3IJ3A 3ETIA 4J4ZA 1BPMA 4ZYQA 3KR4A 2VRIA 5AILA 4D86A 3IIDA 5FSUA 5HOLA 2BFQA 1SPVA 4JGKA 2FXKA 2L8RA 4TU0A 5D8NA 4R7MA 3GPQA 5FSZA 4ABKA 3SIHA 4J5SA 3EKEA 3EW5A 3GPOA 3V45A 3KR5A 3KQZA 2BFRA 3Q71A 4ZY2A 4X2TA 3EJFA 5CB5A 3H8EA 4ZY1A 3IIFA 3Q6ZA 4KYBA 1VHUA 2J9AA 2LGRA 3EWRA 2FG1A 3JRUA 1BPNA 3EWQA 2EWBA 2X47A 4KSIA 1TXZA 2EEEA 4GVVA 5FSYA 2ACFA 5CMSA 4ZX8A 5FSXA 3SIJA 4R76A 3EWOA 4R6TA 3EJGA 1LANA 3GPGA 4ABLA 1ZR5A 2AFCA 3KZWA 3H8GA 4ETKA 4ETJA 1NJRA 4ZY0A 4J5QA 1YD9A 4GVWA 1TY8A 5E3BA 4JLLA 1LCPA 1GYTA 3EWPA
chains in the Genus database with same CATH superfamily
4IQYA 4J5RA 5CBMA 1LAPA 3PEIA 4ZX9A 4K0CA 3T8WA 4GUAA 5CB3A 5HIHA 1ZR3A 3GQOA 3V2BA 2W2GA 1BLLE 4JVVA 1LAMA 3KQXA 2FAVA 1HJZA 5FSVA 3VFQA 3JZTA 5DUSA 4UMLA 2XD7A 3SIIA 3GQEA 2DX6A 3SIGA 4K3NA 3H8FA 4ESSA 4JCAA 4ZI6A 3IJ3A 3ETIA 4J4ZA 1BPMA 4ZYQA 3KR4A 2VRIA 5AILA 4D86A 3IIDA 5FSUA 5HOLA 2BFQA 1SPVA 4JGKA 2FXKA 2L8RA 4TU0A 5D8NA 4R7MA 3GPQA 5FSZA 4ABKA 3SIHA 4J5SA 3EKEA 3EW5A 3GPOA 3V45A 3KR5A 3KQZA 2BFRA 3Q71A 4ZY2A 4X2TA 2WCTA 3EJFA 5CB5A 3H8EA 4ZY1A 3IIFA 3Q6ZA 4KYBA 1VHUA 2J9AA 2LGRA 3EWRA 2FG1A 3JRUA 1BPNA 3EWQA 2EWBA 2X47A 4KSIA 1TXZA 2EEEA 4GVVA 5FSYA 2ACFA 2JZDA 5CMSA 4ZX8A 5FSXA 3SIJA 4R76A 3EWOA 2KQVA 2JZFA 4R6TA 3EJGA 1LANA 3GPGA 4ABLA 1ZR5A 2AFCA 3KZWA 2JZEA 3H8GA 2RNKA 4ETKA 4ETJA 1NJRA 4ZY0A 4J5QA 1YD9A 4GVWA 1TY8A 5E3BA 4JLLA 1LCPA 1GYTA 3EWPA
chains in the Genus database with same CATH topology
4IQYA 4J5RA 5CBMA 1LAPA 3PEIA 4ZX9A 4K0CA 3T8WA 4GUAA 5CB3A 5HIHA 1ZR3A 3GQOA 3V2BA 1BLLE 4JVVA 1LAMA 3KQXA 2FAVA 1HJZA 5FSVA 3VFQA 3JZTA 5DUSA 4UMLA 2XD7A 3SIIA 3GQEA 2DX6A 3SIGA 4K3NA 3H8FA 4ESSA 4JCAA 4ZI6A 3IJ3A 3ETIA 4J4ZA 1BPMA 4ZYQA 3KR4A 2VRIA 5AILA 4D86A 3IIDA 5FSUA 5HOLA 2BFQA 1SPVA 4JGKA 2FXKA 2L8RA 4TU0A 5D8NA 4R7MA 3GPQA 5FSZA 4ABKA 3SIHA 4J5SA 3EKEA 3EW5A 3GPOA 3V45A 3KR5A 3KQZA 2BFRA 3Q71A 4ZY2A 4X2TA 3EJFA 5CB5A 3H8EA 4ZY1A 3IIFA 3Q6ZA 4KYBA 1VHUA 2J9AA 2LGRA 3EWRA 2FG1A 3JRUA 1BPNA 3EWQA 2EWBA 2X47A 4KSIA 1TXZA 2EEEA 4GVVA 5FSYA 2ACFA 5CMSA 4ZX8A 5FSXA 3SIJA 4R76A 3EWOA 4R6TA 3EJGA 1LANA 3GPGA 4ABLA 1ZR5A 2AFCA 3KZWA 3H8GA 4ETKA 4ETJA 1NJRA 4ZY0A 4J5QA 1YD9A 4GVWA 1TY8A 5E3BA 4JLLA 1LCPA 1GYTA 3EWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQY A;  4J5R A;  5CBM A;  1LAP A;  3PEI A;  4ZX9 A;  4K0C A;  3T8W A;  4GUA A;  5CB3 A;  5HIH A;  1ZR3 A;  3GQO A;  3V2B A;  1BLL E;  4JVV A;  1LAM A;  3KQX A;  2FAV A;  1HJZ A;  5FSV A;  3VFQ A;  3JZT A;  5DUS A;  4UML A;  2XD7 A;  3SII A;  3GQE A;  2DX6 A;  3SIG A;  4K3N A;  3H8F A;  4ESS A;  4JCA A;  4ZI6 A;  3IJ3 A;  3ETI A;  4J4Z A;  1BPM A;  4ZYQ A;  3KR4 A;  2VRI A;  5AIL A;  4D86 A;  3IID A;  5FSU A;  5HOL A;  2BFQ A;  1SPV A;  4JGK A;  2FXK A;  2L8R A;  4TU0 A;  5D8N A;  4R7M A;  3GPQ A;  5FSZ A;  4ABK A;  3SIH A;  4J5S A;  3EKE A;  3EW5 A;  3GPO A;  3V45 A;  3KR5 A;  3KQZ A;  2BFR A;  3Q71 A;  4ZY2 A;  4X2T A;  3EJF A;  5CB5 A;  3H8E A;  4ZY1 A;  3IIF A;  3Q6Z A;  4KYB A;  1VHU A;  2J9A A;  2LGR A;  3EWR A;  2FG1 A;  3JRU A;  1BPN A;  3EWQ A;  2EWB A;  2X47 A;  4KSI A;  1TXZ A;  2EEE A;  4GVV A;  5FSY A;  2ACF A;  5CMS A;  4ZX8 A;  5FSX A;  3SIJ A;  4R76 A;  3EWO A;  4R6T A;  3EJG A;  1LAN A;  3GPG A;  4ABL A;  1ZR5 A;  2AFC A;  3KZW A;  3H8G A;  4ETK A;  4ETJ A;  1NJR A;  4ZY0 A;  4J5Q A;  1YD9 A;  4GVW A;  1TY8 A;  5E3B A;  4JLL A;  1LCP A;  1GYT A;  3EWP A; 
#chains in the Genus database with same CATH topology
 4IQY A;  4J5R A;  5CBM A;  1LAP A;  3PEI A;  4ZX9 A;  4K0C A;  3T8W A;  4GUA A;  5CB3 A;  5HIH A;  1ZR3 A;  3GQO A;  3V2B A;  2W2G A;  1BLL E;  4JVV A;  1LAM A;  3KQX A;  2FAV A;  1HJZ A;  5FSV A;  3VFQ A;  3JZT A;  5DUS A;  4UML A;  2XD7 A;  3SII A;  3GQE A;  2DX6 A;  3SIG A;  4K3N A;  3H8F A;  4ESS A;  4JCA A;  4ZI6 A;  3IJ3 A;  3ETI A;  4J4Z A;  1BPM A;  4ZYQ A;  3KR4 A;  2VRI A;  5AIL A;  4D86 A;  3IID A;  5FSU A;  5HOL A;  2BFQ A;  1SPV A;  4JGK A;  2FXK A;  2L8R A;  4TU0 A;  5D8N A;  4R7M A;  3GPQ A;  5FSZ A;  4ABK A;  3SIH A;  4J5S A;  3EKE A;  3EW5 A;  3GPO A;  3V45 A;  3KR5 A;  3KQZ A;  2BFR A;  3Q71 A;  4ZY2 A;  4X2T A;  2WCT A;  3EJF A;  5CB5 A;  3H8E A;  4ZY1 A;  3IIF A;  3Q6Z A;  4KYB A;  1VHU A;  2J9A A;  2LGR A;  3EWR A;  2FG1 A;  3JRU A;  1BPN A;  3EWQ A;  2EWB A;  2X47 A;  4KSI A;  1TXZ A;  2EEE A;  4GVV A;  5FSY A;  2ACF A;  2JZD A;  5CMS A;  4ZX8 A;  5FSX A;  3SIJ A;  4R76 A;  3EWO A;  2KQV A;  2JZF A;  4R6T A;  3EJG A;  1LAN A;  3GPG A;  4ABL A;  1ZR5 A;  2AFC A;  3KZW A;  2JZE A;  3H8G A;  2RNK A;  4ETK A;  4ETJ A;  1NJR A;  4ZY0 A;  4J5Q A;  1YD9 A;  4GVW A;  1TY8 A;  5E3B A;  4JLL A;  1LCP A;  1GYT A;  3EWP A; 
#chains in the Genus database with same CATH homology
 4IQY A;  4J5R A;  5CBM A;  1LAP A;  3PEI A;  4ZX9 A;  4K0C A;  3T8W A;  4GUA A;  5CB3 A;  5HIH A;  1ZR3 A;  3GQO A;  3V2B A;  1BLL E;  4JVV A;  1LAM A;  3KQX A;  2FAV A;  1HJZ A;  5FSV A;  3VFQ A;  3JZT A;  5DUS A;  4UML A;  2XD7 A;  3SII A;  3GQE A;  2DX6 A;  3SIG A;  4K3N A;  3H8F A;  4ESS A;  4JCA A;  4ZI6 A;  3IJ3 A;  3ETI A;  4J4Z A;  1BPM A;  4ZYQ A;  3KR4 A;  2VRI A;  5AIL A;  4D86 A;  3IID A;  5FSU A;  5HOL A;  2BFQ A;  1SPV A;  4JGK A;  2FXK A;  2L8R A;  4TU0 A;  5D8N A;  4R7M A;  3GPQ A;  5FSZ A;  4ABK A;  3SIH A;  4J5S A;  3EKE A;  3EW5 A;  3GPO A;  3V45 A;  3KR5 A;  3KQZ A;  2BFR A;  3Q71 A;  4ZY2 A;  4X2T A;  3EJF A;  5CB5 A;  3H8E A;  4ZY1 A;  3IIF A;  3Q6Z A;  4KYB A;  1VHU A;  2J9A A;  2LGR A;  3EWR A;  2FG1 A;  3JRU A;  1BPN A;  3EWQ A;  2EWB A;  2X47 A;  4KSI A;  1TXZ A;  2EEE A;  4GVV A;  5FSY A;  2ACF A;  5CMS A;  4ZX8 A;  5FSX A;  3SIJ A;  4R76 A;  3EWO A;  4R6T A;  3EJG A;  1LAN A;  3GPG A;  4ABL A;  1ZR5 A;  2AFC A;  3KZW A;  3H8G A;  4ETK A;  4ETJ A;  1NJR A;  4ZY0 A;  4J5Q A;  1YD9 A;  4GVW A;  1TY8 A;  5E3B A;  4JLL A;  1LCP A;  1GYT A;  3EWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...