4KYBA

Crystal structure of de novo designed serine hydrolase osh55.14_e3, northeast structural genomics consortium target or342
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
b'ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTVGGAWVGGLPAEAVCRVMREEIKKAPDTLEVTGVHGTEKSAEAPRRARLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Protein OR342
publication title Northeast Structural Genomics Consortium Target OR342
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 50
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4kybA00
2BFRA 2VRIA 2BFQA 3EW5A 3VFQA 4ABKA 2J9AA 3GPGA 3EJFA 5CB5A 3ETIA 3GQOA 2FG1A 3V45A 5FSVA 4J5RA 3T8WA 1SPVA 3JRUA 4R76A 4ZI6A 1BPMA 4ETJA 2DX6A 3GPOA 3EWRA 1TY8A 4X2TA 1TXZA 1LAMA 4R6TA 3KQZA 1ZR5A 5CMSA 4JLLA 2XD7A 1LAPA 3KR5A 3KZWA 4ZY2A 4TU0A 1ZR3A 5HOLA 1GYTA 4GVWA 4ABLA 3EWOA 2X47A 3EWPA 3KQXA 2EWBA 3H8FA 5FSZA 1BPNA 5FSUA 4GVVA 1VHUA 4K3NA 4K0CA 4IQYA 5CBMA 5FSXA 4J5SA 4J4ZA 3Q71A 4UMLA 2LGRA 3PEIA 3SIGA 4ESSA 4ZY1A 5FSYA 5D8NA 5E3BA 3H8EA 3H8GA 2L8RA 1HJZA 2ACFA 5AILA 4JCAA 5DUSA 4KSIA 2EEEA 3IIDA 5CB3A 3JZTA 4J5QA 4JGKA 3IJ3A 1BLLE 2FXKA 4R7MA 3EWQA 1LCPA 3GPQA 4ZYQA 4JVVA 3SIHA 3SIIA 5HIHA 3EJGA 4ZY0A 4ZX8A 4D86A 3EKEA 4KYBA 2FAVA 4ETKA 4ZX9A 1LANA 3GQEA 3KR4A 3V2BA 3SIJA 1NJRA 3Q6ZA 4GUAA 2AFCA 1YD9A 3IIFA
chains in the Genus database with same CATH superfamily
2BFRA 2VRIA 2BFQA 3EW5A 3VFQA 4ABKA 2J9AA 3GPGA 3EJFA 5CB5A 2W2GA 3ETIA 3GQOA 2FG1A 3V45A 5FSVA 4J5RA 3T8WA 1SPVA 3JRUA 4R76A 4ZI6A 1BPMA 4ETJA 2DX6A 2KQVA 3GPOA 3EWRA 1TY8A 4X2TA 1TXZA 1LAMA 4R6TA 3KQZA 1ZR5A 5CMSA 4JLLA 2XD7A 1LAPA 3KR5A 2JZEA 3KZWA 4ZY2A 4TU0A 1ZR3A 5HOLA 1GYTA 4GVWA 4ABLA 2WCTA 3EWOA 2X47A 3EWPA 3KQXA 2EWBA 3H8FA 5FSZA 1BPNA 5FSUA 4GVVA 1VHUA 4K3NA 4K0CA 4IQYA 5CBMA 5FSXA 4J5SA 4J4ZA 2JZFA 3Q71A 4UMLA 2LGRA 3PEIA 3SIGA 4ESSA 4ZY1A 2RNKA 5FSYA 5D8NA 5E3BA 3H8EA 3H8GA 2L8RA 1HJZA 2ACFA 5AILA 4JCAA 5DUSA 4KSIA 2EEEA 3IIDA 5CB3A 3JZTA 4J5QA 4JGKA 3IJ3A 1BLLE 2FXKA 4R7MA 3EWQA 1LCPA 3GPQA 4ZYQA 4JVVA 3SIHA 3SIIA 2JZDA 5HIHA 3EJGA 4ZY0A 4ZX8A 4D86A 3EKEA 4KYBA 2FAVA 4ETKA 4ZX9A 1LANA 3GQEA 3KR4A 3V2BA 3SIJA 1NJRA 3Q6ZA 4GUAA 2AFCA 1YD9A 3IIFA
chains in the Genus database with same CATH topology
2BFRA 2VRIA 2BFQA 3EW5A 3VFQA 4ABKA 2J9AA 3GPGA 3EJFA 5CB5A 3ETIA 3GQOA 2FG1A 3V45A 5FSVA 4J5RA 3T8WA 1SPVA 3JRUA 4R76A 4ZI6A 1BPMA 4ETJA 2DX6A 3GPOA 3EWRA 1TY8A 4X2TA 1TXZA 1LAMA 4R6TA 3KQZA 1ZR5A 5CMSA 4JLLA 2XD7A 1LAPA 3KR5A 3KZWA 4ZY2A 4TU0A 1ZR3A 5HOLA 1GYTA 4GVWA 4ABLA 3EWOA 2X47A 3EWPA 3KQXA 2EWBA 3H8FA 5FSZA 1BPNA 5FSUA 4GVVA 1VHUA 4K3NA 4K0CA 4IQYA 5CBMA 5FSXA 4J5SA 4J4ZA 3Q71A 4UMLA 2LGRA 3PEIA 3SIGA 4ESSA 4ZY1A 5FSYA 5D8NA 5E3BA 3H8EA 3H8GA 2L8RA 1HJZA 2ACFA 5AILA 4JCAA 5DUSA 4KSIA 2EEEA 3IIDA 5CB3A 3JZTA 4J5QA 4JGKA 3IJ3A 1BLLE 2FXKA 4R7MA 3EWQA 1LCPA 3GPQA 4ZYQA 4JVVA 3SIHA 3SIIA 5HIHA 3EJGA 4ZY0A 4ZX8A 4D86A 3EKEA 4KYBA 2FAVA 4ETKA 4ZX9A 1LANA 3GQEA 3KR4A 3V2BA 3SIJA 1NJRA 3Q6ZA 4GUAA 2AFCA 1YD9A 3IIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BFR A;  2VRI A;  2BFQ A;  3EW5 A;  3VFQ A;  4ABK A;  2J9A A;  3GPG A;  3EJF A;  5CB5 A;  3ETI A;  3GQO A;  2FG1 A;  3V45 A;  5FSV A;  4J5R A;  3T8W A;  1SPV A;  3JRU A;  4R76 A;  4ZI6 A;  1BPM A;  4ETJ A;  2DX6 A;  3GPO A;  3EWR A;  1TY8 A;  4X2T A;  1TXZ A;  1LAM A;  4R6T A;  3KQZ A;  1ZR5 A;  5CMS A;  4JLL A;  2XD7 A;  1LAP A;  3KR5 A;  3KZW A;  4ZY2 A;  4TU0 A;  1ZR3 A;  5HOL A;  1GYT A;  4GVW A;  4ABL A;  3EWO A;  2X47 A;  3EWP A;  3KQX A;  2EWB A;  3H8F A;  5FSZ A;  1BPN A;  5FSU A;  4GVV A;  1VHU A;  4K3N A;  4K0C A;  4IQY A;  5CBM A;  5FSX A;  4J5S A;  4J4Z A;  3Q71 A;  4UML A;  2LGR A;  3PEI A;  3SIG A;  4ESS A;  4ZY1 A;  5FSY A;  5D8N A;  5E3B A;  3H8E A;  3H8G A;  2L8R A;  1HJZ A;  2ACF A;  5AIL A;  4JCA A;  5DUS A;  4KSI A;  2EEE A;  3IID A;  5CB3 A;  3JZT A;  4J5Q A;  4JGK A;  3IJ3 A;  1BLL E;  2FXK A;  4R7M A;  3EWQ A;  1LCP A;  3GPQ A;  4ZYQ A;  4JVV A;  3SIH A;  3SII A;  5HIH A;  3EJG A;  4ZY0 A;  4ZX8 A;  4D86 A;  3EKE A;  4KYB A;  2FAV A;  4ETK A;  4ZX9 A;  1LAN A;  3GQE A;  3KR4 A;  3V2B A;  3SIJ A;  1NJR A;  3Q6Z A;  4GUA A;  2AFC A;  1YD9 A;  3IIF A; 
#chains in the Genus database with same CATH topology
 2BFR A;  2VRI A;  2BFQ A;  3EW5 A;  3VFQ A;  4ABK A;  2J9A A;  3GPG A;  3EJF A;  5CB5 A;  2W2G A;  3ETI A;  3GQO A;  2FG1 A;  3V45 A;  5FSV A;  4J5R A;  3T8W A;  1SPV A;  3JRU A;  4R76 A;  4ZI6 A;  1BPM A;  4ETJ A;  2DX6 A;  2KQV A;  3GPO A;  3EWR A;  1TY8 A;  4X2T A;  1TXZ A;  1LAM A;  4R6T A;  3KQZ A;  1ZR5 A;  5CMS A;  4JLL A;  2XD7 A;  1LAP A;  3KR5 A;  2JZE A;  3KZW A;  4ZY2 A;  4TU0 A;  1ZR3 A;  5HOL A;  1GYT A;  4GVW A;  4ABL A;  2WCT A;  3EWO A;  2X47 A;  3EWP A;  3KQX A;  2EWB A;  3H8F A;  5FSZ A;  1BPN A;  5FSU A;  4GVV A;  1VHU A;  4K3N A;  4K0C A;  4IQY A;  5CBM A;  5FSX A;  4J5S A;  4J4Z A;  2JZF A;  3Q71 A;  4UML A;  2LGR A;  3PEI A;  3SIG A;  4ESS A;  4ZY1 A;  2RNK A;  5FSY A;  5D8N A;  5E3B A;  3H8E A;  3H8G A;  2L8R A;  1HJZ A;  2ACF A;  5AIL A;  4JCA A;  5DUS A;  4KSI A;  2EEE A;  3IID A;  5CB3 A;  3JZT A;  4J5Q A;  4JGK A;  3IJ3 A;  1BLL E;  2FXK A;  4R7M A;  3EWQ A;  1LCP A;  3GPQ A;  4ZYQ A;  4JVV A;  3SIH A;  3SII A;  2JZD A;  5HIH A;  3EJG A;  4ZY0 A;  4ZX8 A;  4D86 A;  3EKE A;  4KYB A;  2FAV A;  4ETK A;  4ZX9 A;  1LAN A;  3GQE A;  3KR4 A;  3V2B A;  3SIJ A;  1NJR A;  3Q6Z A;  4GUA A;  2AFC A;  1YD9 A;  3IIF A; 
#chains in the Genus database with same CATH homology
 2BFR A;  2VRI A;  2BFQ A;  3EW5 A;  3VFQ A;  4ABK A;  2J9A A;  3GPG A;  3EJF A;  5CB5 A;  3ETI A;  3GQO A;  2FG1 A;  3V45 A;  5FSV A;  4J5R A;  3T8W A;  1SPV A;  3JRU A;  4R76 A;  4ZI6 A;  1BPM A;  4ETJ A;  2DX6 A;  3GPO A;  3EWR A;  1TY8 A;  4X2T A;  1TXZ A;  1LAM A;  4R6T A;  3KQZ A;  1ZR5 A;  5CMS A;  4JLL A;  2XD7 A;  1LAP A;  3KR5 A;  3KZW A;  4ZY2 A;  4TU0 A;  1ZR3 A;  5HOL A;  1GYT A;  4GVW A;  4ABL A;  3EWO A;  2X47 A;  3EWP A;  3KQX A;  2EWB A;  3H8F A;  5FSZ A;  1BPN A;  5FSU A;  4GVV A;  1VHU A;  4K3N A;  4K0C A;  4IQY A;  5CBM A;  5FSX A;  4J5S A;  4J4Z A;  3Q71 A;  4UML A;  2LGR A;  3PEI A;  3SIG A;  4ESS A;  4ZY1 A;  5FSY A;  5D8N A;  5E3B A;  3H8E A;  3H8G A;  2L8R A;  1HJZ A;  2ACF A;  5AIL A;  4JCA A;  5DUS A;  4KSI A;  2EEE A;  3IID A;  5CB3 A;  3JZT A;  4J5Q A;  4JGK A;  3IJ3 A;  1BLL E;  2FXK A;  4R7M A;  3EWQ A;  1LCP A;  3GPQ A;  4ZYQ A;  4JVV A;  3SIH A;  3SII A;  5HIH A;  3EJG A;  4ZY0 A;  4ZX8 A;  4D86 A;  3EKE A;  4KYB A;  2FAV A;  4ETK A;  4ZX9 A;  1LAN A;  3GQE A;  3KR4 A;  3V2B A;  3SIJ A;  1NJR A;  3Q6Z A;  4GUA A;  2AFC A;  1YD9 A;  3IIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...