2FXKA

Crystal structure of the macro-domain of human core histone variant macroh2a1.1 (form a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
187
structure length
187
Chain Sequence
GFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Splicing regulates NAD metabolite binding to histone macroH2A.
pubmed doi rcsb
molecule keywords H2A histone family, member Y isoform 1
molecule tags Gene regulation
source organism Homo sapiens
total genus 60
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2fxkA00
2XD7A 5FSUA 3EKEA 4R76A 4GVVA 4ETKA 1TY8A 5D8NA 3EWRA 1LANA 3SIHA 1NJRA 1VHUA 3KR5A 5E3BA 2DX6A 4ESSA 1LAMA 3IJ3A 4IQYA 4JVVA 5CB5A 4J4ZA 4JGKA 2FXKA 1LAPA 4ZYQA 3KR4A 2BFQA 2L8RA 4KSIA 4X2TA 2ACFA 3EJGA 4ZI6A 4ZY0A 3EWQA 1YD9A 3GQOA 4GUAA 4K3NA 4TU0A 2EEEA 3EWOA 3JZTA 5HOLA 3Q71A 2LGRA 2BFRA 5FSVA 5DUSA 5CBMA 1LCPA 2VRIA 3SIGA 5FSXA 5CB3A 3KZWA 2FAVA 2EWBA 1GYTA 3GPGA 4ETJA 2J9AA 4JCAA 4KYBA 1ZR3A 4ZX9A 3H8EA 3V2BA 3KQXA 4R7MA 3Q6ZA 1BLLE 3SIJA 3H8FA 1BPMA 2X47A 4D86A 3JRUA 4ZY1A 3IIFA 4J5RA 1BPNA 3EW5A 4ABLA 5AILA 4ZY2A 4R6TA 5HIHA 1TXZA 3GPOA 3VFQA 4UMLA 3H8GA 3EJFA 5FSYA 1ZR5A 3GPQA 1HJZA 3V45A 3KQZA 3ETIA 4JLLA 4GVWA 5CMSA 5FSZA 4ZX8A 3SIIA 3PEIA 3IIDA 3EWPA 4J5QA 1SPVA 2FG1A 4ABKA 3GQEA 4K0CA 2AFCA 4J5SA 3T8WA
chains in the Genus database with same CATH superfamily
2XD7A 5FSUA 3EKEA 4R76A 4GVVA 4ETKA 1TY8A 5D8NA 3EWRA 1LANA 3SIHA 1NJRA 1VHUA 3KR5A 5E3BA 2DX6A 4ESSA 1LAMA 3IJ3A 4IQYA 4JVVA 2WCTA 5CB5A 4J4ZA 4JGKA 2FXKA 1LAPA 4ZYQA 3KR4A 2BFQA 2L8RA 4KSIA 4X2TA 2ACFA 3EJGA 4ZI6A 4ZY0A 3EWQA 1YD9A 3GQOA 4GUAA 4K3NA 4TU0A 2EEEA 3EWOA 3JZTA 2W2GA 5HOLA 3Q71A 2LGRA 2BFRA 5FSVA 5DUSA 5CBMA 1LCPA 2VRIA 3SIGA 5FSXA 5CB3A 3KZWA 2JZEA 2FAVA 2EWBA 1GYTA 3GPGA 4ETJA 2J9AA 2JZDA 4JCAA 4KYBA 1ZR3A 2RNKA 4ZX9A 3H8EA 3V2BA 3KQXA 4R7MA 3Q6ZA 1BLLE 3SIJA 3H8FA 1BPMA 2X47A 4D86A 3JRUA 4ZY1A 3IIFA 4J5RA 1BPNA 3EW5A 4ABLA 5AILA 4ZY2A 4R6TA 5HIHA 1TXZA 3GPOA 3VFQA 4UMLA 3H8GA 3EJFA 5FSYA 1ZR5A 3GPQA 1HJZA 3V45A 3KQZA 3ETIA 4JLLA 2JZFA 4GVWA 5CMSA 5FSZA 4ZX8A 3SIIA 3PEIA 3IIDA 2KQVA 3EWPA 4J5QA 1SPVA 2FG1A 4ABKA 3GQEA 4K0CA 2AFCA 4J5SA 3T8WA
chains in the Genus database with same CATH topology
2XD7A 5FSUA 3EKEA 4R76A 4GVVA 4ETKA 1TY8A 5D8NA 3EWRA 1LANA 3SIHA 1NJRA 1VHUA 3KR5A 5E3BA 2DX6A 4ESSA 1LAMA 3IJ3A 4IQYA 4JVVA 5CB5A 4J4ZA 4JGKA 2FXKA 1LAPA 4ZYQA 3KR4A 2BFQA 2L8RA 4KSIA 4X2TA 2ACFA 3EJGA 4ZI6A 4ZY0A 3EWQA 1YD9A 3GQOA 4GUAA 4K3NA 4TU0A 2EEEA 3EWOA 3JZTA 5HOLA 3Q71A 2LGRA 2BFRA 5FSVA 5DUSA 5CBMA 1LCPA 2VRIA 3SIGA 5FSXA 5CB3A 3KZWA 2FAVA 2EWBA 1GYTA 3GPGA 4ETJA 2J9AA 4JCAA 4KYBA 1ZR3A 4ZX9A 3H8EA 3V2BA 3KQXA 4R7MA 3Q6ZA 1BLLE 3SIJA 3H8FA 1BPMA 2X47A 4D86A 3JRUA 4ZY1A 3IIFA 4J5RA 1BPNA 3EW5A 4ABLA 5AILA 4ZY2A 4R6TA 5HIHA 1TXZA 3GPOA 3VFQA 4UMLA 3H8GA 3EJFA 5FSYA 1ZR5A 3GPQA 1HJZA 3V45A 3KQZA 3ETIA 4JLLA 4GVWA 5CMSA 5FSZA 4ZX8A 3SIIA 3PEIA 3IIDA 3EWPA 4J5QA 1SPVA 2FG1A 4ABKA 3GQEA 4K0CA 2AFCA 4J5SA 3T8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD7 A;  5FSU A;  3EKE A;  4R76 A;  4GVV A;  4ETK A;  1TY8 A;  5D8N A;  3EWR A;  1LAN A;  3SIH A;  1NJR A;  1VHU A;  3KR5 A;  5E3B A;  2DX6 A;  4ESS A;  1LAM A;  3IJ3 A;  4IQY A;  4JVV A;  5CB5 A;  4J4Z A;  4JGK A;  2FXK A;  1LAP A;  4ZYQ A;  3KR4 A;  2BFQ A;  2L8R A;  4KSI A;  4X2T A;  2ACF A;  3EJG A;  4ZI6 A;  4ZY0 A;  3EWQ A;  1YD9 A;  3GQO A;  4GUA A;  4K3N A;  4TU0 A;  2EEE A;  3EWO A;  3JZT A;  5HOL A;  3Q71 A;  2LGR A;  2BFR A;  5FSV A;  5DUS A;  5CBM A;  1LCP A;  2VRI A;  3SIG A;  5FSX A;  5CB3 A;  3KZW A;  2FAV A;  2EWB A;  1GYT A;  3GPG A;  4ETJ A;  2J9A A;  4JCA A;  4KYB A;  1ZR3 A;  4ZX9 A;  3H8E A;  3V2B A;  3KQX A;  4R7M A;  3Q6Z A;  1BLL E;  3SIJ A;  3H8F A;  1BPM A;  2X47 A;  4D86 A;  3JRU A;  4ZY1 A;  3IIF A;  4J5R A;  1BPN A;  3EW5 A;  4ABL A;  5AIL A;  4ZY2 A;  4R6T A;  5HIH A;  1TXZ A;  3GPO A;  3VFQ A;  4UML A;  3H8G A;  3EJF A;  5FSY A;  1ZR5 A;  3GPQ A;  1HJZ A;  3V45 A;  3KQZ A;  3ETI A;  4JLL A;  4GVW A;  5CMS A;  5FSZ A;  4ZX8 A;  3SII A;  3PEI A;  3IID A;  3EWP A;  4J5Q A;  1SPV A;  2FG1 A;  4ABK A;  3GQE A;  4K0C A;  2AFC A;  4J5S A;  3T8W A; 
#chains in the Genus database with same CATH topology
 2XD7 A;  5FSU A;  3EKE A;  4R76 A;  4GVV A;  4ETK A;  1TY8 A;  5D8N A;  3EWR A;  1LAN A;  3SIH A;  1NJR A;  1VHU A;  3KR5 A;  5E3B A;  2DX6 A;  4ESS A;  1LAM A;  3IJ3 A;  4IQY A;  4JVV A;  2WCT A;  5CB5 A;  4J4Z A;  4JGK A;  2FXK A;  1LAP A;  4ZYQ A;  3KR4 A;  2BFQ A;  2L8R A;  4KSI A;  4X2T A;  2ACF A;  3EJG A;  4ZI6 A;  4ZY0 A;  3EWQ A;  1YD9 A;  3GQO A;  4GUA A;  4K3N A;  4TU0 A;  2EEE A;  3EWO A;  3JZT A;  2W2G A;  5HOL A;  3Q71 A;  2LGR A;  2BFR A;  5FSV A;  5DUS A;  5CBM A;  1LCP A;  2VRI A;  3SIG A;  5FSX A;  5CB3 A;  3KZW A;  2JZE A;  2FAV A;  2EWB A;  1GYT A;  3GPG A;  4ETJ A;  2J9A A;  2JZD A;  4JCA A;  4KYB A;  1ZR3 A;  2RNK A;  4ZX9 A;  3H8E A;  3V2B A;  3KQX A;  4R7M A;  3Q6Z A;  1BLL E;  3SIJ A;  3H8F A;  1BPM A;  2X47 A;  4D86 A;  3JRU A;  4ZY1 A;  3IIF A;  4J5R A;  1BPN A;  3EW5 A;  4ABL A;  5AIL A;  4ZY2 A;  4R6T A;  5HIH A;  1TXZ A;  3GPO A;  3VFQ A;  4UML A;  3H8G A;  3EJF A;  5FSY A;  1ZR5 A;  3GPQ A;  1HJZ A;  3V45 A;  3KQZ A;  3ETI A;  4JLL A;  2JZF A;  4GVW A;  5CMS A;  5FSZ A;  4ZX8 A;  3SII A;  3PEI A;  3IID A;  2KQV A;  3EWP A;  4J5Q A;  1SPV A;  2FG1 A;  4ABK A;  3GQE A;  4K0C A;  2AFC A;  4J5S A;  3T8W A; 
#chains in the Genus database with same CATH homology
 2XD7 A;  5FSU A;  3EKE A;  4R76 A;  4GVV A;  4ETK A;  1TY8 A;  5D8N A;  3EWR A;  1LAN A;  3SIH A;  1NJR A;  1VHU A;  3KR5 A;  5E3B A;  2DX6 A;  4ESS A;  1LAM A;  3IJ3 A;  4IQY A;  4JVV A;  5CB5 A;  4J4Z A;  4JGK A;  2FXK A;  1LAP A;  4ZYQ A;  3KR4 A;  2BFQ A;  2L8R A;  4KSI A;  4X2T A;  2ACF A;  3EJG A;  4ZI6 A;  4ZY0 A;  3EWQ A;  1YD9 A;  3GQO A;  4GUA A;  4K3N A;  4TU0 A;  2EEE A;  3EWO A;  3JZT A;  5HOL A;  3Q71 A;  2LGR A;  2BFR A;  5FSV A;  5DUS A;  5CBM A;  1LCP A;  2VRI A;  3SIG A;  5FSX A;  5CB3 A;  3KZW A;  2FAV A;  2EWB A;  1GYT A;  3GPG A;  4ETJ A;  2J9A A;  4JCA A;  4KYB A;  1ZR3 A;  4ZX9 A;  3H8E A;  3V2B A;  3KQX A;  4R7M A;  3Q6Z A;  1BLL E;  3SIJ A;  3H8F A;  1BPM A;  2X47 A;  4D86 A;  3JRU A;  4ZY1 A;  3IIF A;  4J5R A;  1BPN A;  3EW5 A;  4ABL A;  5AIL A;  4ZY2 A;  4R6T A;  5HIH A;  1TXZ A;  3GPO A;  3VFQ A;  4UML A;  3H8G A;  3EJF A;  5FSY A;  1ZR5 A;  3GPQ A;  1HJZ A;  3V45 A;  3KQZ A;  3ETI A;  4JLL A;  4GVW A;  5CMS A;  5FSZ A;  4ZX8 A;  3SII A;  3PEI A;  3IID A;  3EWP A;  4J5Q A;  1SPV A;  2FG1 A;  4ABK A;  3GQE A;  4K0C A;  2AFC A;  4J5S A;  3T8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...