2FXKA

Crystal structure of the macro-domain of human core histone variant macroh2a1.1 (form a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
187
structure length
187
Chain Sequence
GFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2A histone family, member Y isoform 1
publication title Splicing regulates NAD metabolite binding to histone macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 60
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2fxkA00
3GPGA 4ABLA 2J9AA 3H8GA 4ESSA 4R6TA 3EWQA 1ZR5A 3KZWA 1ZR3A 4K0CA 5FSVA 4R7MA 2FAVA 3ETIA 1BPNA 4KYBA 1YD9A 4UMLA 3KQXA 2BFRA 2BFQA 4ABKA 3Q6ZA 3GPQA 3EWPA 3T8WA 1LAPA 3IIDA 3H8FA 3KQZA 1BLLE 3PEIA 5AILA 5HOLA 3EJFA 2EWBA 3IJ3A 5FSYA 5CBMA 3SIGA 5D8NA 5FSXA 2EEEA 2L8RA 4JCAA 3JZTA 4GUAA 4GVVA 4GVWA 4JGKA 2DX6A 3SIJA 1HJZA 4K3NA 5HIHA 4ZY0A 3KR5A 5CB5A 4J5RA 3VFQA 3JRUA 4TU0A 5CB3A 4ZX8A 3GPOA 3GQOA 4ZX9A 3SIHA 2XD7A 4ZY1A 4IQYA 4ZYQA 1LCPA 5E3BA 2FG1A 2FXKA 3V45A 4JVVA 4X2TA 1GYTA 4J5QA 2VRIA 3EW5A 3SIIA 1LAMA 2AFCA 3Q71A 3EWRA 1TY8A 2X47A 4JLLA 4ETJA 3EWOA 3IIFA 5FSUA 4ZI6A 1LANA 3KR4A 1BPMA 1TXZA 3EKEA 2LGRA 1NJRA 1VHUA 3EJGA 3V2BA 5CMSA 4D86A 4ZY2A 4ETKA 2ACFA 3GQEA 4J4ZA 4KSIA 5FSZA 4J5SA 5DUSA 4R76A 1SPVA 3H8EA
chains in the Genus database with same CATH superfamily
3GPGA 4ABLA 2J9AA 3H8GA 4ESSA 4R6TA 3EWQA 1ZR5A 3KZWA 1ZR3A 4K0CA 2RNKA 5FSVA 4R7MA 2FAVA 3ETIA 1BPNA 4KYBA 1YD9A 4UMLA 3KQXA 2BFRA 2BFQA 4ABKA 2JZFA 3Q6ZA 3GPQA 3EWPA 3T8WA 1LAPA 3IIDA 3H8FA 3KQZA 1BLLE 3PEIA 5AILA 5HOLA 3EJFA 2EWBA 3IJ3A 5FSYA 5CBMA 3SIGA 5D8NA 5FSXA 2EEEA 2L8RA 4JCAA 3JZTA 4GUAA 4GVVA 2WCTA 4GVWA 4JGKA 2JZEA 2DX6A 3SIJA 1HJZA 4K3NA 5HIHA 4ZY0A 3KR5A 5CB5A 4J5RA 3VFQA 3JRUA 4TU0A 5CB3A 4ZX8A 3GPOA 3GQOA 4ZX9A 3SIHA 2XD7A 4ZY1A 4IQYA 4ZYQA 1LCPA 5E3BA 2FG1A 2FXKA 3V45A 4JVVA 4X2TA 1GYTA 4J5QA 2VRIA 3EW5A 3SIIA 1LAMA 2AFCA 3Q71A 3EWRA 1TY8A 2X47A 4JLLA 4ETJA 3EWOA 3IIFA 2KQVA 5FSUA 4ZI6A 1LANA 3KR4A 1BPMA 1TXZA 3EKEA 2LGRA 1NJRA 1VHUA 3EJGA 3V2BA 5CMSA 4D86A 4ZY2A 4ETKA 2JZDA 2ACFA 2W2GA 3GQEA 4J4ZA 4KSIA 5FSZA 4J5SA 5DUSA 4R76A 1SPVA 3H8EA
chains in the Genus database with same CATH topology
3GPGA 4ABLA 2J9AA 3H8GA 4ESSA 4R6TA 3EWQA 1ZR5A 3KZWA 1ZR3A 4K0CA 5FSVA 4R7MA 2FAVA 3ETIA 1BPNA 4KYBA 1YD9A 4UMLA 3KQXA 2BFRA 2BFQA 4ABKA 3Q6ZA 3GPQA 3EWPA 3T8WA 1LAPA 3IIDA 3H8FA 3KQZA 1BLLE 3PEIA 5AILA 5HOLA 3EJFA 2EWBA 3IJ3A 5FSYA 5CBMA 3SIGA 5D8NA 5FSXA 2EEEA 2L8RA 4JCAA 3JZTA 4GUAA 4GVVA 4GVWA 4JGKA 2DX6A 3SIJA 1HJZA 4K3NA 5HIHA 4ZY0A 3KR5A 5CB5A 4J5RA 3VFQA 3JRUA 4TU0A 5CB3A 4ZX8A 3GPOA 3GQOA 4ZX9A 3SIHA 2XD7A 4ZY1A 4IQYA 4ZYQA 1LCPA 5E3BA 2FG1A 2FXKA 3V45A 4JVVA 4X2TA 1GYTA 4J5QA 2VRIA 3EW5A 3SIIA 1LAMA 2AFCA 3Q71A 3EWRA 1TY8A 2X47A 4JLLA 4ETJA 3EWOA 3IIFA 5FSUA 4ZI6A 1LANA 3KR4A 1BPMA 1TXZA 3EKEA 2LGRA 1NJRA 1VHUA 3EJGA 3V2BA 5CMSA 4D86A 4ZY2A 4ETKA 2ACFA 3GQEA 4J4ZA 4KSIA 5FSZA 4J5SA 5DUSA 4R76A 1SPVA 3H8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPG A;  4ABL A;  2J9A A;  3H8G A;  4ESS A;  4R6T A;  3EWQ A;  1ZR5 A;  3KZW A;  1ZR3 A;  4K0C A;  5FSV A;  4R7M A;  2FAV A;  3ETI A;  1BPN A;  4KYB A;  1YD9 A;  4UML A;  3KQX A;  2BFR A;  2BFQ A;  4ABK A;  3Q6Z A;  3GPQ A;  3EWP A;  3T8W A;  1LAP A;  3IID A;  3H8F A;  3KQZ A;  1BLL E;  3PEI A;  5AIL A;  5HOL A;  3EJF A;  2EWB A;  3IJ3 A;  5FSY A;  5CBM A;  3SIG A;  5D8N A;  5FSX A;  2EEE A;  2L8R A;  4JCA A;  3JZT A;  4GUA A;  4GVV A;  4GVW A;  4JGK A;  2DX6 A;  3SIJ A;  1HJZ A;  4K3N A;  5HIH A;  4ZY0 A;  3KR5 A;  5CB5 A;  4J5R A;  3VFQ A;  3JRU A;  4TU0 A;  5CB3 A;  4ZX8 A;  3GPO A;  3GQO A;  4ZX9 A;  3SIH A;  2XD7 A;  4ZY1 A;  4IQY A;  4ZYQ A;  1LCP A;  5E3B A;  2FG1 A;  2FXK A;  3V45 A;  4JVV A;  4X2T A;  1GYT A;  4J5Q A;  2VRI A;  3EW5 A;  3SII A;  1LAM A;  2AFC A;  3Q71 A;  3EWR A;  1TY8 A;  2X47 A;  4JLL A;  4ETJ A;  3EWO A;  3IIF A;  5FSU A;  4ZI6 A;  1LAN A;  3KR4 A;  1BPM A;  1TXZ A;  3EKE A;  2LGR A;  1NJR A;  1VHU A;  3EJG A;  3V2B A;  5CMS A;  4D86 A;  4ZY2 A;  4ETK A;  2ACF A;  3GQE A;  4J4Z A;  4KSI A;  5FSZ A;  4J5S A;  5DUS A;  4R76 A;  1SPV A;  3H8E A; 
#chains in the Genus database with same CATH topology
 3GPG A;  4ABL A;  2J9A A;  3H8G A;  4ESS A;  4R6T A;  3EWQ A;  1ZR5 A;  3KZW A;  1ZR3 A;  4K0C A;  2RNK A;  5FSV A;  4R7M A;  2FAV A;  3ETI A;  1BPN A;  4KYB A;  1YD9 A;  4UML A;  3KQX A;  2BFR A;  2BFQ A;  4ABK A;  2JZF A;  3Q6Z A;  3GPQ A;  3EWP A;  3T8W A;  1LAP A;  3IID A;  3H8F A;  3KQZ A;  1BLL E;  3PEI A;  5AIL A;  5HOL A;  3EJF A;  2EWB A;  3IJ3 A;  5FSY A;  5CBM A;  3SIG A;  5D8N A;  5FSX A;  2EEE A;  2L8R A;  4JCA A;  3JZT A;  4GUA A;  4GVV A;  2WCT A;  4GVW A;  4JGK A;  2JZE A;  2DX6 A;  3SIJ A;  1HJZ A;  4K3N A;  5HIH A;  4ZY0 A;  3KR5 A;  5CB5 A;  4J5R A;  3VFQ A;  3JRU A;  4TU0 A;  5CB3 A;  4ZX8 A;  3GPO A;  3GQO A;  4ZX9 A;  3SIH A;  2XD7 A;  4ZY1 A;  4IQY A;  4ZYQ A;  1LCP A;  5E3B A;  2FG1 A;  2FXK A;  3V45 A;  4JVV A;  4X2T A;  1GYT A;  4J5Q A;  2VRI A;  3EW5 A;  3SII A;  1LAM A;  2AFC A;  3Q71 A;  3EWR A;  1TY8 A;  2X47 A;  4JLL A;  4ETJ A;  3EWO A;  3IIF A;  2KQV A;  5FSU A;  4ZI6 A;  1LAN A;  3KR4 A;  1BPM A;  1TXZ A;  3EKE A;  2LGR A;  1NJR A;  1VHU A;  3EJG A;  3V2B A;  5CMS A;  4D86 A;  4ZY2 A;  4ETK A;  2JZD A;  2ACF A;  2W2G A;  3GQE A;  4J4Z A;  4KSI A;  5FSZ A;  4J5S A;  5DUS A;  4R76 A;  1SPV A;  3H8E A; 
#chains in the Genus database with same CATH homology
 3GPG A;  4ABL A;  2J9A A;  3H8G A;  4ESS A;  4R6T A;  3EWQ A;  1ZR5 A;  3KZW A;  1ZR3 A;  4K0C A;  5FSV A;  4R7M A;  2FAV A;  3ETI A;  1BPN A;  4KYB A;  1YD9 A;  4UML A;  3KQX A;  2BFR A;  2BFQ A;  4ABK A;  3Q6Z A;  3GPQ A;  3EWP A;  3T8W A;  1LAP A;  3IID A;  3H8F A;  3KQZ A;  1BLL E;  3PEI A;  5AIL A;  5HOL A;  3EJF A;  2EWB A;  3IJ3 A;  5FSY A;  5CBM A;  3SIG A;  5D8N A;  5FSX A;  2EEE A;  2L8R A;  4JCA A;  3JZT A;  4GUA A;  4GVV A;  4GVW A;  4JGK A;  2DX6 A;  3SIJ A;  1HJZ A;  4K3N A;  5HIH A;  4ZY0 A;  3KR5 A;  5CB5 A;  4J5R A;  3VFQ A;  3JRU A;  4TU0 A;  5CB3 A;  4ZX8 A;  3GPO A;  3GQO A;  4ZX9 A;  3SIH A;  2XD7 A;  4ZY1 A;  4IQY A;  4ZYQ A;  1LCP A;  5E3B A;  2FG1 A;  2FXK A;  3V45 A;  4JVV A;  4X2T A;  1GYT A;  4J5Q A;  2VRI A;  3EW5 A;  3SII A;  1LAM A;  2AFC A;  3Q71 A;  3EWR A;  1TY8 A;  2X47 A;  4JLL A;  4ETJ A;  3EWO A;  3IIF A;  5FSU A;  4ZI6 A;  1LAN A;  3KR4 A;  1BPM A;  1TXZ A;  3EKE A;  2LGR A;  1NJR A;  1VHU A;  3EJG A;  3V2B A;  5CMS A;  4D86 A;  4ZY2 A;  4ETK A;  2ACF A;  3GQE A;  4J4Z A;  4KSI A;  5FSZ A;  4J5S A;  5DUS A;  4R76 A;  1SPV A;  3H8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...