2FAVA

Crystal structure of sars macro domain in complex with adp-ribose at 1.8 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
172
structure length
172
Chain Sequence
EPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab (pp1ab) (ORF1AB)
publication title Structural and functional basis for ADP-ribose and poly(ADP-ribose) binding by viral macro domains.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 60
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2favA00
4ZX8A 3VFQA 2FAVA 4ETKA 4J5QA 1ZR3A 3JRUA 3KQXA 3IIDA 5FSZA 5CMSA 4KSIA 4ZY0A 5CB3A 2EWBA 3EW5A 3EWPA 4ZYQA 1BPMA 2XD7A 1YD9A 4KYBA 1NJRA 2ACFA 4ZX9A 1VHUA 5HIHA 3GQOA 3JZTA 3KR4A 3H8EA 5HOLA 4JVVA 4J5SA 2AFCA 3SIJA 2L8RA 3Q6ZA 4R76A 3SIIA 3EJGA 3EWOA 5D8NA 2FG1A 4ZY1A 1LCPA 4J4ZA 3PEIA 4JGKA 3V2BA 4ABLA 3ETIA 2BFRA 3H8FA 1LAMA 5CBMA 4ZY2A 3IJ3A 3V45A 4ESSA 1SPVA 4JCAA 1ZR5A 4GVWA 3SIHA 5DUSA 5AILA 3EWQA 4J5RA 1LAPA 2BFQA 3GPGA 4R6TA 1BPNA 5CB5A 4ZI6A 4K3NA 2J9AA 1TY8A 2DX6A 3SIGA 4ETJA 3EWRA 2EEEA 3T8WA 4UMLA 3Q71A 1GYTA 4R7MA 2LGRA 3GPQA 3KQZA 2VRIA 4TU0A 4D86A 5FSXA 3KR5A 1BLLE 1TXZA 5FSYA 2FXKA 1HJZA 3IIFA 4GUAA 4JLLA 2X47A 3GPOA 3KZWA 5E3BA 3EKEA 5FSVA 3GQEA 5FSUA 4IQYA 4ABKA 1LANA 4K0CA 4GVVA 4X2TA 3H8GA 3EJFA
chains in the Genus database with same CATH superfamily
4ZX8A 3VFQA 2FAVA 4ETKA 4J5QA 1ZR3A 3JRUA 3KQXA 3IIDA 5FSZA 5CMSA 4KSIA 4ZY0A 5CB3A 2EWBA 3EW5A 3EWPA 4ZYQA 1BPMA 2XD7A 1YD9A 4KYBA 1NJRA 2ACFA 4ZX9A 1VHUA 5HIHA 3GQOA 3JZTA 3KR4A 3H8EA 5HOLA 4JVVA 4J5SA 2AFCA 3SIJA 2L8RA 3Q6ZA 4R76A 3SIIA 2JZDA 3EJGA 3EWOA 5D8NA 2FG1A 2KQVA 4ZY1A 1LCPA 4J4ZA 3PEIA 4JGKA 3V2BA 4ABLA 3ETIA 2BFRA 3H8FA 1LAMA 5CBMA 4ZY2A 3IJ3A 3V45A 4ESSA 1SPVA 4JCAA 2WCTA 1ZR5A 2JZEA 2W2GA 4GVWA 3SIHA 2RNKA 5DUSA 5AILA 3EWQA 4J5RA 1LAPA 2BFQA 3GPGA 4R6TA 1BPNA 5CB5A 4ZI6A 4K3NA 2J9AA 1TY8A 2DX6A 3SIGA 4ETJA 3EWRA 2EEEA 3T8WA 4UMLA 3Q71A 1GYTA 4R7MA 2LGRA 3GPQA 3KQZA 2VRIA 4TU0A 4D86A 5FSXA 3KR5A 1BLLE 1TXZA 5FSYA 2FXKA 1HJZA 3IIFA 4GUAA 4JLLA 2X47A 3GPOA 3KZWA 5E3BA 3EKEA 5FSVA 3GQEA 2JZFA 5FSUA 4IQYA 4ABKA 1LANA 4K0CA 4GVVA 4X2TA 3H8GA 3EJFA
chains in the Genus database with same CATH topology
4ZX8A 3VFQA 2FAVA 4ETKA 4J5QA 1ZR3A 3JRUA 3KQXA 3IIDA 5FSZA 5CMSA 4KSIA 4ZY0A 5CB3A 2EWBA 3EW5A 3EWPA 4ZYQA 1BPMA 2XD7A 1YD9A 4KYBA 1NJRA 2ACFA 4ZX9A 1VHUA 5HIHA 3GQOA 3JZTA 3KR4A 3H8EA 5HOLA 4JVVA 4J5SA 2AFCA 3SIJA 2L8RA 3Q6ZA 4R76A 3SIIA 3EJGA 3EWOA 5D8NA 2FG1A 4ZY1A 1LCPA 4J4ZA 3PEIA 4JGKA 3V2BA 4ABLA 3ETIA 2BFRA 3H8FA 1LAMA 5CBMA 4ZY2A 3IJ3A 3V45A 4ESSA 1SPVA 4JCAA 1ZR5A 4GVWA 3SIHA 5DUSA 5AILA 3EWQA 4J5RA 1LAPA 2BFQA 3GPGA 4R6TA 1BPNA 5CB5A 4ZI6A 4K3NA 2J9AA 1TY8A 2DX6A 3SIGA 4ETJA 3EWRA 2EEEA 3T8WA 4UMLA 3Q71A 1GYTA 4R7MA 2LGRA 3GPQA 3KQZA 2VRIA 4TU0A 4D86A 5FSXA 3KR5A 1BLLE 1TXZA 5FSYA 2FXKA 1HJZA 3IIFA 4GUAA 4JLLA 2X47A 3GPOA 3KZWA 5E3BA 3EKEA 5FSVA 3GQEA 5FSUA 4IQYA 4ABKA 1LANA 4K0CA 4GVVA 4X2TA 3H8GA 3EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZX8 A;  3VFQ A;  2FAV A;  4ETK A;  4J5Q A;  1ZR3 A;  3JRU A;  3KQX A;  3IID A;  5FSZ A;  5CMS A;  4KSI A;  4ZY0 A;  5CB3 A;  2EWB A;  3EW5 A;  3EWP A;  4ZYQ A;  1BPM A;  2XD7 A;  1YD9 A;  4KYB A;  1NJR A;  2ACF A;  4ZX9 A;  1VHU A;  5HIH A;  3GQO A;  3JZT A;  3KR4 A;  3H8E A;  5HOL A;  4JVV A;  4J5S A;  2AFC A;  3SIJ A;  2L8R A;  3Q6Z A;  4R76 A;  3SII A;  3EJG A;  3EWO A;  5D8N A;  2FG1 A;  4ZY1 A;  1LCP A;  4J4Z A;  3PEI A;  4JGK A;  3V2B A;  4ABL A;  3ETI A;  2BFR A;  3H8F A;  1LAM A;  5CBM A;  4ZY2 A;  3IJ3 A;  3V45 A;  4ESS A;  1SPV A;  4JCA A;  1ZR5 A;  4GVW A;  3SIH A;  5DUS A;  5AIL A;  3EWQ A;  4J5R A;  1LAP A;  2BFQ A;  3GPG A;  4R6T A;  1BPN A;  5CB5 A;  4ZI6 A;  4K3N A;  2J9A A;  1TY8 A;  2DX6 A;  3SIG A;  4ETJ A;  3EWR A;  2EEE A;  3T8W A;  4UML A;  3Q71 A;  1GYT A;  4R7M A;  2LGR A;  3GPQ A;  3KQZ A;  2VRI A;  4TU0 A;  4D86 A;  5FSX A;  3KR5 A;  1BLL E;  1TXZ A;  5FSY A;  2FXK A;  1HJZ A;  3IIF A;  4GUA A;  4JLL A;  2X47 A;  3GPO A;  3KZW A;  5E3B A;  3EKE A;  5FSV A;  3GQE A;  5FSU A;  4IQY A;  4ABK A;  1LAN A;  4K0C A;  4GVV A;  4X2T A;  3H8G A;  3EJF A; 
#chains in the Genus database with same CATH topology
 4ZX8 A;  3VFQ A;  2FAV A;  4ETK A;  4J5Q A;  1ZR3 A;  3JRU A;  3KQX A;  3IID A;  5FSZ A;  5CMS A;  4KSI A;  4ZY0 A;  5CB3 A;  2EWB A;  3EW5 A;  3EWP A;  4ZYQ A;  1BPM A;  2XD7 A;  1YD9 A;  4KYB A;  1NJR A;  2ACF A;  4ZX9 A;  1VHU A;  5HIH A;  3GQO A;  3JZT A;  3KR4 A;  3H8E A;  5HOL A;  4JVV A;  4J5S A;  2AFC A;  3SIJ A;  2L8R A;  3Q6Z A;  4R76 A;  3SII A;  2JZD A;  3EJG A;  3EWO A;  5D8N A;  2FG1 A;  2KQV A;  4ZY1 A;  1LCP A;  4J4Z A;  3PEI A;  4JGK A;  3V2B A;  4ABL A;  3ETI A;  2BFR A;  3H8F A;  1LAM A;  5CBM A;  4ZY2 A;  3IJ3 A;  3V45 A;  4ESS A;  1SPV A;  4JCA A;  2WCT A;  1ZR5 A;  2JZE A;  2W2G A;  4GVW A;  3SIH A;  2RNK A;  5DUS A;  5AIL A;  3EWQ A;  4J5R A;  1LAP A;  2BFQ A;  3GPG A;  4R6T A;  1BPN A;  5CB5 A;  4ZI6 A;  4K3N A;  2J9A A;  1TY8 A;  2DX6 A;  3SIG A;  4ETJ A;  3EWR A;  2EEE A;  3T8W A;  4UML A;  3Q71 A;  1GYT A;  4R7M A;  2LGR A;  3GPQ A;  3KQZ A;  2VRI A;  4TU0 A;  4D86 A;  5FSX A;  3KR5 A;  1BLL E;  1TXZ A;  5FSY A;  2FXK A;  1HJZ A;  3IIF A;  4GUA A;  4JLL A;  2X47 A;  3GPO A;  3KZW A;  5E3B A;  3EKE A;  5FSV A;  3GQE A;  2JZF A;  5FSU A;  4IQY A;  4ABK A;  1LAN A;  4K0C A;  4GVV A;  4X2T A;  3H8G A;  3EJF A; 
#chains in the Genus database with same CATH homology
 4ZX8 A;  3VFQ A;  2FAV A;  4ETK A;  4J5Q A;  1ZR3 A;  3JRU A;  3KQX A;  3IID A;  5FSZ A;  5CMS A;  4KSI A;  4ZY0 A;  5CB3 A;  2EWB A;  3EW5 A;  3EWP A;  4ZYQ A;  1BPM A;  2XD7 A;  1YD9 A;  4KYB A;  1NJR A;  2ACF A;  4ZX9 A;  1VHU A;  5HIH A;  3GQO A;  3JZT A;  3KR4 A;  3H8E A;  5HOL A;  4JVV A;  4J5S A;  2AFC A;  3SIJ A;  2L8R A;  3Q6Z A;  4R76 A;  3SII A;  3EJG A;  3EWO A;  5D8N A;  2FG1 A;  4ZY1 A;  1LCP A;  4J4Z A;  3PEI A;  4JGK A;  3V2B A;  4ABL A;  3ETI A;  2BFR A;  3H8F A;  1LAM A;  5CBM A;  4ZY2 A;  3IJ3 A;  3V45 A;  4ESS A;  1SPV A;  4JCA A;  1ZR5 A;  4GVW A;  3SIH A;  5DUS A;  5AIL A;  3EWQ A;  4J5R A;  1LAP A;  2BFQ A;  3GPG A;  4R6T A;  1BPN A;  5CB5 A;  4ZI6 A;  4K3N A;  2J9A A;  1TY8 A;  2DX6 A;  3SIG A;  4ETJ A;  3EWR A;  2EEE A;  3T8W A;  4UML A;  3Q71 A;  1GYT A;  4R7M A;  2LGR A;  3GPQ A;  3KQZ A;  2VRI A;  4TU0 A;  4D86 A;  5FSX A;  3KR5 A;  1BLL E;  1TXZ A;  5FSY A;  2FXK A;  1HJZ A;  3IIF A;  4GUA A;  4JLL A;  2X47 A;  3GPO A;  3KZW A;  5E3B A;  3EKE A;  5FSV A;  3GQE A;  5FSU A;  4IQY A;  4ABK A;  1LAN A;  4K0C A;  4GVV A;  4X2T A;  3H8G A;  3EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...