2FAVA

Crystal structure of sars macro domain in complex with adp-ribose at 1.8 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
172
structure length
172
Chain Sequence
EPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab (pp1ab) (ORF1AB)
publication title Structural and functional basis for ADP-ribose and poly(ADP-ribose) binding by viral macro domains.
pubmed doi rcsb
source organism Sars coronavirus
total genus 60
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2favA00
3EWRA 5CB3A 3PEIA 2J9AA 2BFQA 3EW5A 4JGKA 4GUAA 1VHUA 4K0CA 2LGRA 3EJFA 4ABLA 3Q71A 4IQYA 4J5RA 4ZY1A 2L8RA 2BFRA 3IJ3A 4JVVA 2FXKA 3GPOA 1SPVA 2X47A 5CMSA 5AILA 3KR5A 5FSXA 1LAMA 3SIGA 1YD9A 3SIHA 3KQXA 4UMLA 3EWPA 3T8WA 3JZTA 4ZYQA 5DUSA 4ZY0A 3H8FA 4R7MA 5FSZA 3V45A 5FSUA 3GQEA 3IIFA 5E3BA 3GPGA 1NJRA 3VFQA 3ETIA 3V2BA 3EKEA 1BPMA 3H8EA 1TXZA 3GPQA 1ZR5A 1GYTA 3H8GA 4K3NA 2XD7A 3SIJA 1HJZA 5FSYA 4J4ZA 4J5QA 3IIDA 3EJGA 4JLLA 4ESSA 1BLLE 1ZR3A 5CBMA 1LAPA 4J5SA 4ZI6A 5D8NA 3JRUA 2FG1A 1TY8A 4ABKA 2ACFA 3EWOA 5CB5A 4GVVA 2FAVA 2VRIA 4JCAA 4D86A 5FSVA 5HOLA 3Q6ZA 4ZY2A 4ETJA 4X2TA 4ZX8A 4ETKA 2AFCA 4TU0A 4GVWA 4ZX9A 3GQOA 3EWQA 3KZWA 1LANA 4KYBA 3SIIA 2EEEA 3KQZA 1LCPA 2EWBA 1BPNA 4R76A 2DX6A 4KSIA 5HIHA 4R6TA 3KR4A
chains in the Genus database with same CATH superfamily
3EWRA 5CB3A 3PEIA 2J9AA 2BFQA 3EW5A 4JGKA 4GUAA 1VHUA 4K0CA 2LGRA 3EJFA 4ABLA 3Q71A 4IQYA 4J5RA 2JZDA 4ZY1A 2L8RA 2BFRA 3IJ3A 4JVVA 2FXKA 3GPOA 1SPVA 2X47A 5CMSA 5AILA 2JZFA 3KR5A 5FSXA 1LAMA 3SIGA 1YD9A 3SIHA 3KQXA 4UMLA 3EWPA 3T8WA 3JZTA 4ZYQA 5DUSA 4ZY0A 3H8FA 4R7MA 5FSZA 3V45A 5FSUA 3GQEA 3IIFA 5E3BA 3GPGA 1NJRA 3VFQA 3ETIA 3V2BA 3EKEA 1BPMA 3H8EA 1TXZA 3GPQA 1ZR5A 1GYTA 3H8GA 4K3NA 2XD7A 3SIJA 1HJZA 5FSYA 4J4ZA 2JZEA 4J5QA 3IIDA 3EJGA 4JLLA 4ESSA 1BLLE 1ZR3A 5CBMA 2KQVA 1LAPA 4J5SA 4ZI6A 5D8NA 3JRUA 2FG1A 1TY8A 4ABKA 2ACFA 3EWOA 5CB5A 4GVVA 2FAVA 2VRIA 4JCAA 4D86A 5FSVA 5HOLA 3Q6ZA 4ZY2A 4ETJA 4X2TA 4ZX8A 4ETKA 2AFCA 2WCTA 4TU0A 4GVWA 2RNKA 4ZX9A 3GQOA 3EWQA 3KZWA 2W2GA 1LANA 4KYBA 3SIIA 2EEEA 3KQZA 1LCPA 2EWBA 1BPNA 4R76A 2DX6A 4KSIA 5HIHA 4R6TA 3KR4A
chains in the Genus database with same CATH topology
3EWRA 5CB3A 3PEIA 2J9AA 2BFQA 3EW5A 4JGKA 4GUAA 1VHUA 4K0CA 2LGRA 3EJFA 4ABLA 3Q71A 4IQYA 4J5RA 4ZY1A 2L8RA 2BFRA 3IJ3A 4JVVA 2FXKA 3GPOA 1SPVA 2X47A 5CMSA 5AILA 3KR5A 5FSXA 1LAMA 3SIGA 1YD9A 3SIHA 3KQXA 4UMLA 3EWPA 3T8WA 3JZTA 4ZYQA 5DUSA 4ZY0A 3H8FA 4R7MA 5FSZA 3V45A 5FSUA 3GQEA 3IIFA 5E3BA 3GPGA 1NJRA 3VFQA 3ETIA 3V2BA 3EKEA 1BPMA 3H8EA 1TXZA 3GPQA 1ZR5A 1GYTA 3H8GA 4K3NA 2XD7A 3SIJA 1HJZA 5FSYA 4J4ZA 4J5QA 3IIDA 3EJGA 4JLLA 4ESSA 1BLLE 1ZR3A 5CBMA 1LAPA 4J5SA 4ZI6A 5D8NA 3JRUA 2FG1A 1TY8A 4ABKA 2ACFA 3EWOA 5CB5A 4GVVA 2FAVA 2VRIA 4JCAA 4D86A 5FSVA 5HOLA 3Q6ZA 4ZY2A 4ETJA 4X2TA 4ZX8A 4ETKA 2AFCA 4TU0A 4GVWA 4ZX9A 3GQOA 3EWQA 3KZWA 1LANA 4KYBA 3SIIA 2EEEA 3KQZA 1LCPA 2EWBA 1BPNA 4R76A 2DX6A 4KSIA 5HIHA 4R6TA 3KR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWR A;  5CB3 A;  3PEI A;  2J9A A;  2BFQ A;  3EW5 A;  4JGK A;  4GUA A;  1VHU A;  4K0C A;  2LGR A;  3EJF A;  4ABL A;  3Q71 A;  4IQY A;  4J5R A;  4ZY1 A;  2L8R A;  2BFR A;  3IJ3 A;  4JVV A;  2FXK A;  3GPO A;  1SPV A;  2X47 A;  5CMS A;  5AIL A;  3KR5 A;  5FSX A;  1LAM A;  3SIG A;  1YD9 A;  3SIH A;  3KQX A;  4UML A;  3EWP A;  3T8W A;  3JZT A;  4ZYQ A;  5DUS A;  4ZY0 A;  3H8F A;  4R7M A;  5FSZ A;  3V45 A;  5FSU A;  3GQE A;  3IIF A;  5E3B A;  3GPG A;  1NJR A;  3VFQ A;  3ETI A;  3V2B A;  3EKE A;  1BPM A;  3H8E A;  1TXZ A;  3GPQ A;  1ZR5 A;  1GYT A;  3H8G A;  4K3N A;  2XD7 A;  3SIJ A;  1HJZ A;  5FSY A;  4J4Z A;  4J5Q A;  3IID A;  3EJG A;  4JLL A;  4ESS A;  1BLL E;  1ZR3 A;  5CBM A;  1LAP A;  4J5S A;  4ZI6 A;  5D8N A;  3JRU A;  2FG1 A;  1TY8 A;  4ABK A;  2ACF A;  3EWO A;  5CB5 A;  4GVV A;  2FAV A;  2VRI A;  4JCA A;  4D86 A;  5FSV A;  5HOL A;  3Q6Z A;  4ZY2 A;  4ETJ A;  4X2T A;  4ZX8 A;  4ETK A;  2AFC A;  4TU0 A;  4GVW A;  4ZX9 A;  3GQO A;  3EWQ A;  3KZW A;  1LAN A;  4KYB A;  3SII A;  2EEE A;  3KQZ A;  1LCP A;  2EWB A;  1BPN A;  4R76 A;  2DX6 A;  4KSI A;  5HIH A;  4R6T A;  3KR4 A; 
#chains in the Genus database with same CATH topology
 3EWR A;  5CB3 A;  3PEI A;  2J9A A;  2BFQ A;  3EW5 A;  4JGK A;  4GUA A;  1VHU A;  4K0C A;  2LGR A;  3EJF A;  4ABL A;  3Q71 A;  4IQY A;  4J5R A;  2JZD A;  4ZY1 A;  2L8R A;  2BFR A;  3IJ3 A;  4JVV A;  2FXK A;  3GPO A;  1SPV A;  2X47 A;  5CMS A;  5AIL A;  2JZF A;  3KR5 A;  5FSX A;  1LAM A;  3SIG A;  1YD9 A;  3SIH A;  3KQX A;  4UML A;  3EWP A;  3T8W A;  3JZT A;  4ZYQ A;  5DUS A;  4ZY0 A;  3H8F A;  4R7M A;  5FSZ A;  3V45 A;  5FSU A;  3GQE A;  3IIF A;  5E3B A;  3GPG A;  1NJR A;  3VFQ A;  3ETI A;  3V2B A;  3EKE A;  1BPM A;  3H8E A;  1TXZ A;  3GPQ A;  1ZR5 A;  1GYT A;  3H8G A;  4K3N A;  2XD7 A;  3SIJ A;  1HJZ A;  5FSY A;  4J4Z A;  2JZE A;  4J5Q A;  3IID A;  3EJG A;  4JLL A;  4ESS A;  1BLL E;  1ZR3 A;  5CBM A;  2KQV A;  1LAP A;  4J5S A;  4ZI6 A;  5D8N A;  3JRU A;  2FG1 A;  1TY8 A;  4ABK A;  2ACF A;  3EWO A;  5CB5 A;  4GVV A;  2FAV A;  2VRI A;  4JCA A;  4D86 A;  5FSV A;  5HOL A;  3Q6Z A;  4ZY2 A;  4ETJ A;  4X2T A;  4ZX8 A;  4ETK A;  2AFC A;  2WCT A;  4TU0 A;  4GVW A;  2RNK A;  4ZX9 A;  3GQO A;  3EWQ A;  3KZW A;  2W2G A;  1LAN A;  4KYB A;  3SII A;  2EEE A;  3KQZ A;  1LCP A;  2EWB A;  1BPN A;  4R76 A;  2DX6 A;  4KSI A;  5HIH A;  4R6T A;  3KR4 A; 
#chains in the Genus database with same CATH homology
 3EWR A;  5CB3 A;  3PEI A;  2J9A A;  2BFQ A;  3EW5 A;  4JGK A;  4GUA A;  1VHU A;  4K0C A;  2LGR A;  3EJF A;  4ABL A;  3Q71 A;  4IQY A;  4J5R A;  4ZY1 A;  2L8R A;  2BFR A;  3IJ3 A;  4JVV A;  2FXK A;  3GPO A;  1SPV A;  2X47 A;  5CMS A;  5AIL A;  3KR5 A;  5FSX A;  1LAM A;  3SIG A;  1YD9 A;  3SIH A;  3KQX A;  4UML A;  3EWP A;  3T8W A;  3JZT A;  4ZYQ A;  5DUS A;  4ZY0 A;  3H8F A;  4R7M A;  5FSZ A;  3V45 A;  5FSU A;  3GQE A;  3IIF A;  5E3B A;  3GPG A;  1NJR A;  3VFQ A;  3ETI A;  3V2B A;  3EKE A;  1BPM A;  3H8E A;  1TXZ A;  3GPQ A;  1ZR5 A;  1GYT A;  3H8G A;  4K3N A;  2XD7 A;  3SIJ A;  1HJZ A;  5FSY A;  4J4Z A;  4J5Q A;  3IID A;  3EJG A;  4JLL A;  4ESS A;  1BLL E;  1ZR3 A;  5CBM A;  1LAP A;  4J5S A;  4ZI6 A;  5D8N A;  3JRU A;  2FG1 A;  1TY8 A;  4ABK A;  2ACF A;  3EWO A;  5CB5 A;  4GVV A;  2FAV A;  2VRI A;  4JCA A;  4D86 A;  5FSV A;  5HOL A;  3Q6Z A;  4ZY2 A;  4ETJ A;  4X2T A;  4ZX8 A;  4ETK A;  2AFC A;  4TU0 A;  4GVW A;  4ZX9 A;  3GQO A;  3EWQ A;  3KZW A;  1LAN A;  4KYB A;  3SII A;  2EEE A;  3KQZ A;  1LCP A;  2EWB A;  1BPN A;  4R76 A;  2DX6 A;  4KSI A;  5HIH A;  4R6T A;  3KR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...