2FAVA

Crystal structure of sars macro domain in complex with adp-ribose at 1.8 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
172
structure length
172
Chain Sequence
EPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional basis for ADP-ribose and poly(ADP-ribose) binding by viral macro domains.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab (pp1ab) (ORF1AB)
total genus 60
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2favA00
3ETIA 1LAPA 3H8EA 5HIHA 5D8NA 4IQYA 3SIJA 1TXZA 2DX6A 4R76A 1BLLE 2VRIA 3V45A 4ZI6A 2FAVA 2ACFA 4ETKA 3KQZA 4ESSA 3PEIA 4ZY0A 3EWOA 2FXKA 4UMLA 3EW5A 3EWQA 4GUAA 5FSVA 3VFQA 2J9AA 5FSZA 1HJZA 3GQEA 1TY8A 4K0CA 4ABLA 3T8WA 4R7MA 3JZTA 4J5SA 5FSUA 4JLLA 5FSYA 2EEEA 4J5QA 3KR4A 5DUSA 3EWPA 3GPQA 3H8FA 1LCPA 3SIHA 4JVVA 2AFCA 3IIFA 4ZY1A 4ZX9A 4TU0A 3Q71A 1LAMA 1SPVA 4ETJA 4J4ZA 5CBMA 2EWBA 2L8RA 1VHUA 3V2BA 5CMSA 1LANA 2LGRA 5FSXA 5E3BA 4D86A 4ZY2A 2XD7A 5CB3A 4ZX8A 2BFQA 3EKEA 4X2TA 4JCAA 3EJFA 3JRUA 1YD9A 3KR5A 1NJRA 3IJ3A 4J5RA 3EWRA 2BFRA 3GQOA 3Q6ZA 5AILA 4ZYQA 1ZR5A 2FG1A 1BPNA 3H8GA 4KSIA 3KZWA 3EJGA 1ZR3A 4R6TA 4GVWA 1GYTA 4JGKA 5CB5A 4KYBA 1BPMA 5HOLA 3KQXA 4ABKA 4GVVA 3SIIA 3IIDA 4K3NA 2X47A 3SIGA 3GPGA 3GPOA
chains in the Genus database with same CATH superfamily
3ETIA 1LAPA 3H8EA 2RNKA 5HIHA 5D8NA 4IQYA 3SIJA 1TXZA 2DX6A 4R76A 1BLLE 2VRIA 3V45A 4ZI6A 2FAVA 2ACFA 4ETKA 3KQZA 4ESSA 3PEIA 4ZY0A 3EWOA 2FXKA 4UMLA 3EW5A 3EWQA 4GUAA 5FSVA 3VFQA 2J9AA 5FSZA 1HJZA 3GQEA 1TY8A 4K0CA 4ABLA 3T8WA 2KQVA 4R7MA 2W2GA 3JZTA 4J5SA 5FSUA 4JLLA 5FSYA 2EEEA 4J5QA 3KR4A 5DUSA 3EWPA 3GPQA 3H8FA 1LCPA 3SIHA 4JVVA 2AFCA 3IIFA 2JZFA 4ZY1A 4ZX9A 4TU0A 3Q71A 1LAMA 1SPVA 4ETJA 4J4ZA 5CBMA 2EWBA 2WCTA 2L8RA 1VHUA 3V2BA 5CMSA 1LANA 2LGRA 5FSXA 5E3BA 4D86A 4ZY2A 2XD7A 5CB3A 4ZX8A 2BFQA 3EKEA 4X2TA 4JCAA 3EJFA 3JRUA 1YD9A 3KR5A 1NJRA 3IJ3A 4J5RA 3EWRA 2BFRA 3GQOA 3Q6ZA 5AILA 4ZYQA 1ZR5A 2FG1A 1BPNA 3H8GA 4KSIA 3KZWA 3EJGA 1ZR3A 4R6TA 4GVWA 1GYTA 4JGKA 5CB5A 4KYBA 1BPMA 5HOLA 3KQXA 4ABKA 2JZEA 2JZDA 4GVVA 3SIIA 3IIDA 4K3NA 2X47A 3SIGA 3GPGA 3GPOA
chains in the Genus database with same CATH topology
3ETIA 1LAPA 3H8EA 5HIHA 5D8NA 4IQYA 3SIJA 1TXZA 2DX6A 4R76A 1BLLE 2VRIA 3V45A 4ZI6A 2FAVA 2ACFA 4ETKA 3KQZA 4ESSA 3PEIA 4ZY0A 3EWOA 2FXKA 4UMLA 3EW5A 3EWQA 4GUAA 5FSVA 3VFQA 2J9AA 5FSZA 1HJZA 3GQEA 1TY8A 4K0CA 4ABLA 3T8WA 4R7MA 3JZTA 4J5SA 5FSUA 4JLLA 5FSYA 2EEEA 4J5QA 3KR4A 5DUSA 3EWPA 3GPQA 3H8FA 1LCPA 3SIHA 4JVVA 2AFCA 3IIFA 4ZY1A 4ZX9A 4TU0A 3Q71A 1LAMA 1SPVA 4ETJA 4J4ZA 5CBMA 2EWBA 2L8RA 1VHUA 3V2BA 5CMSA 1LANA 2LGRA 5FSXA 5E3BA 4D86A 4ZY2A 2XD7A 5CB3A 4ZX8A 2BFQA 3EKEA 4X2TA 4JCAA 3EJFA 3JRUA 1YD9A 3KR5A 1NJRA 3IJ3A 4J5RA 3EWRA 2BFRA 3GQOA 3Q6ZA 5AILA 4ZYQA 1ZR5A 2FG1A 1BPNA 3H8GA 4KSIA 3KZWA 3EJGA 1ZR3A 4R6TA 4GVWA 1GYTA 4JGKA 5CB5A 4KYBA 1BPMA 5HOLA 3KQXA 4ABKA 4GVVA 3SIIA 3IIDA 4K3NA 2X47A 3SIGA 3GPGA 3GPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETI A;  1LAP A;  3H8E A;  5HIH A;  5D8N A;  4IQY A;  3SIJ A;  1TXZ A;  2DX6 A;  4R76 A;  1BLL E;  2VRI A;  3V45 A;  4ZI6 A;  2FAV A;  2ACF A;  4ETK A;  3KQZ A;  4ESS A;  3PEI A;  4ZY0 A;  3EWO A;  2FXK A;  4UML A;  3EW5 A;  3EWQ A;  4GUA A;  5FSV A;  3VFQ A;  2J9A A;  5FSZ A;  1HJZ A;  3GQE A;  1TY8 A;  4K0C A;  4ABL A;  3T8W A;  4R7M A;  3JZT A;  4J5S A;  5FSU A;  4JLL A;  5FSY A;  2EEE A;  4J5Q A;  3KR4 A;  5DUS A;  3EWP A;  3GPQ A;  3H8F A;  1LCP A;  3SIH A;  4JVV A;  2AFC A;  3IIF A;  4ZY1 A;  4ZX9 A;  4TU0 A;  3Q71 A;  1LAM A;  1SPV A;  4ETJ A;  4J4Z A;  5CBM A;  2EWB A;  2L8R A;  1VHU A;  3V2B A;  5CMS A;  1LAN A;  2LGR A;  5FSX A;  5E3B A;  4D86 A;  4ZY2 A;  2XD7 A;  5CB3 A;  4ZX8 A;  2BFQ A;  3EKE A;  4X2T A;  4JCA A;  3EJF A;  3JRU A;  1YD9 A;  3KR5 A;  1NJR A;  3IJ3 A;  4J5R A;  3EWR A;  2BFR A;  3GQO A;  3Q6Z A;  5AIL A;  4ZYQ A;  1ZR5 A;  2FG1 A;  1BPN A;  3H8G A;  4KSI A;  3KZW A;  3EJG A;  1ZR3 A;  4R6T A;  4GVW A;  1GYT A;  4JGK A;  5CB5 A;  4KYB A;  1BPM A;  5HOL A;  3KQX A;  4ABK A;  4GVV A;  3SII A;  3IID A;  4K3N A;  2X47 A;  3SIG A;  3GPG A;  3GPO A; 
#chains in the Genus database with same CATH topology
 3ETI A;  1LAP A;  3H8E A;  2RNK A;  5HIH A;  5D8N A;  4IQY A;  3SIJ A;  1TXZ A;  2DX6 A;  4R76 A;  1BLL E;  2VRI A;  3V45 A;  4ZI6 A;  2FAV A;  2ACF A;  4ETK A;  3KQZ A;  4ESS A;  3PEI A;  4ZY0 A;  3EWO A;  2FXK A;  4UML A;  3EW5 A;  3EWQ A;  4GUA A;  5FSV A;  3VFQ A;  2J9A A;  5FSZ A;  1HJZ A;  3GQE A;  1TY8 A;  4K0C A;  4ABL A;  3T8W A;  2KQV A;  4R7M A;  2W2G A;  3JZT A;  4J5S A;  5FSU A;  4JLL A;  5FSY A;  2EEE A;  4J5Q A;  3KR4 A;  5DUS A;  3EWP A;  3GPQ A;  3H8F A;  1LCP A;  3SIH A;  4JVV A;  2AFC A;  3IIF A;  2JZF A;  4ZY1 A;  4ZX9 A;  4TU0 A;  3Q71 A;  1LAM A;  1SPV A;  4ETJ A;  4J4Z A;  5CBM A;  2EWB A;  2WCT A;  2L8R A;  1VHU A;  3V2B A;  5CMS A;  1LAN A;  2LGR A;  5FSX A;  5E3B A;  4D86 A;  4ZY2 A;  2XD7 A;  5CB3 A;  4ZX8 A;  2BFQ A;  3EKE A;  4X2T A;  4JCA A;  3EJF A;  3JRU A;  1YD9 A;  3KR5 A;  1NJR A;  3IJ3 A;  4J5R A;  3EWR A;  2BFR A;  3GQO A;  3Q6Z A;  5AIL A;  4ZYQ A;  1ZR5 A;  2FG1 A;  1BPN A;  3H8G A;  4KSI A;  3KZW A;  3EJG A;  1ZR3 A;  4R6T A;  4GVW A;  1GYT A;  4JGK A;  5CB5 A;  4KYB A;  1BPM A;  5HOL A;  3KQX A;  4ABK A;  2JZE A;  2JZD A;  4GVV A;  3SII A;  3IID A;  4K3N A;  2X47 A;  3SIG A;  3GPG A;  3GPO A; 
#chains in the Genus database with same CATH homology
 3ETI A;  1LAP A;  3H8E A;  5HIH A;  5D8N A;  4IQY A;  3SIJ A;  1TXZ A;  2DX6 A;  4R76 A;  1BLL E;  2VRI A;  3V45 A;  4ZI6 A;  2FAV A;  2ACF A;  4ETK A;  3KQZ A;  4ESS A;  3PEI A;  4ZY0 A;  3EWO A;  2FXK A;  4UML A;  3EW5 A;  3EWQ A;  4GUA A;  5FSV A;  3VFQ A;  2J9A A;  5FSZ A;  1HJZ A;  3GQE A;  1TY8 A;  4K0C A;  4ABL A;  3T8W A;  4R7M A;  3JZT A;  4J5S A;  5FSU A;  4JLL A;  5FSY A;  2EEE A;  4J5Q A;  3KR4 A;  5DUS A;  3EWP A;  3GPQ A;  3H8F A;  1LCP A;  3SIH A;  4JVV A;  2AFC A;  3IIF A;  4ZY1 A;  4ZX9 A;  4TU0 A;  3Q71 A;  1LAM A;  1SPV A;  4ETJ A;  4J4Z A;  5CBM A;  2EWB A;  2L8R A;  1VHU A;  3V2B A;  5CMS A;  1LAN A;  2LGR A;  5FSX A;  5E3B A;  4D86 A;  4ZY2 A;  2XD7 A;  5CB3 A;  4ZX8 A;  2BFQ A;  3EKE A;  4X2T A;  4JCA A;  3EJF A;  3JRU A;  1YD9 A;  3KR5 A;  1NJR A;  3IJ3 A;  4J5R A;  3EWR A;  2BFR A;  3GQO A;  3Q6Z A;  5AIL A;  4ZYQ A;  1ZR5 A;  2FG1 A;  1BPN A;  3H8G A;  4KSI A;  3KZW A;  3EJG A;  1ZR3 A;  4R6T A;  4GVW A;  1GYT A;  4JGK A;  5CB5 A;  4KYB A;  1BPM A;  5HOL A;  3KQX A;  4ABK A;  4GVV A;  3SII A;  3IID A;  4K3N A;  2X47 A;  3SIG A;  3GPG A;  3GPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...