3KQZA

Structure of a protease 2
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqzA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqzA02
3FF3A 4YU9A 3EWRA 1TKHA 1ZR3A 2L8RA 3NA6A 3BHXA 4JYWA 4UIAA 2ZEGA 3GPGA 1ELMP 3SI0A 5K8OA 3VATA 3IO1A 4DUKA 1VHOA 2ZEOA 4R7MA 1XFOA 4ZX8A 3LWUA 3IIDA 5FSVA 4MCSA 4J5RA 2JBKA 4P44A 1YLOA 4JLLA 3PEIA 2QJ8A 3JRUA 4F9VA 4ZI6A 4R76A 4JGKA 3CT9A 4OP4A 3B3TA 1LFWA 2ZOGA 4JCAA 3B3CA 1DE4C 3FEEA 3RBUA 1TXZA 5D29A 5J1QA 3IWWA 2XEIA 3RZAA 3Q71A 4ZY1A 3KQXA 1LOKA 4MHYA 3PFOA 3PBEA 4H2KA 4KYBA 1Z8LA 3VH9A 4X2TA 3V45A 1TF8A 3NH5A 4G1PA 3JZTA 2PJAA 5HXDA 5FSZA 3WC5A 1F57A 2JBJA 3S9LA 3B3SA 4GVVA 3KQZA 4R8FA 2GLJA 5CMSA 3DGVA 4OIDA 2JEWA 2PJ3A 2ZEDA 2POKA 1NJRA 4FUUA 2NSMA 2EK8A 2O53A 2C1CA 1QQ9A 2G9DA 4DYOA 4MHNA 4NJRA 2CIJA 4WJBA 1CG2A 2HC9A 5DUSA 1BAVA 4WWVA 4OIWA 3GPQA 4PXDA 5K8MA 4TWEA 1F2OA 4ETKA 1CP6A 5LYIA 4P4BA 4EFDA 2PJBA 3V2BA 4Q7AA 3S9MA 4OC2A 4PXBA 2PJ9A 1QMUA 3IIBA 4ZX9A 3HUVA 1YW6A 3B2YA 1KWMA 3SI1A 3EJGA 3EJFA 2GLFA 2AFOA 1BPNA 2AFSA 1HDUA 2XEFA 2J9AA 2F8HA 1TXRA 4GM5A 4MCRA 2CTCA 1CX8A 5LRGA 3EW5A 2O4HA 3H8GA 1AMPA 1IGBA 3EWQA 4NGMA 2Q51A 3SJFA 3D67A 4GVWA 2PRQA 2AFWA 4P45A 3SJEA 3D7FA 1LANA 5HVGA 2F7VA 2IQ6A 4TNUA 2PCUA 2QYVA 1IY7A 4AXVA 4TU0A 4MXUA 5K8PA 2V8DA 4LQGA 3MN8A 4MRIA 3IEHA 5F09A 3PB4X 2WYRA 4W9YA 2PJ2A 4P4IA 3GPOA 2ZENA 3PB7X 1XBUA 3TX8A 1BLLE 4UIBA 4J4ZA 2OOTA 5JM6A 3V7ZA 4YWYA 2PJCA 2AFCA 3H8EA 4IAVA 3EKEA 3WC7A 4MCPA 5FSYA 3H8FA 3KR4A 5D8NA 3QNVA 1VHEA 2XEGA 4FBEA 2VRIA 4IHMA 1VGYA 3IIFA 2PJ0A 3S9NA 4NGTA 3SJGA 1ARLA 1YW4A 1Z2LA 8CPAA 5HOLA 1XRYA 3SIHA 2DX6A 5IB9A 3PBBA 1CPXA 2FXKA 1CP7A 2OR4A 3FJUA 2IMOA 2AFUA 4MMOA 3WC6A 3CPAA 1FT7A 2ZOFA 1YD9A 2WZNA 4JZ0A 5HIHA 3ISZA 4P4DA 5LRJA 4NGRA 3FEDA 3D7HA 4ESSA 1ZLHA 5LYFA 4B6ZA 5HVHA 4UMLA 2X47A 2EEEA 4A39A 2Q4ZA 3N5FA 3NH4A 5THWA 1LAPA 2V77A 4RUHA 2PJ8A 3GB0A 4IQYA 3GUXA 5DS0A 1F2PA 4UEEA 4A37A 4F8ZA 3K2KA 5JGFA 3ISXA 4P6YA 2XD7A 3NFZA 3WT4A 2PIYA 1TY8A 2NYQA 3NH8A 4F9UA 2RB7A 3VFQA 4NJQA 1TKJA 1XJOA 3KR5A 3WABA 4NGPA 3KZWA 4ABKA 5FSXA 3KHXA 1M4LA 1ZG9A 4BD9A 5LYLA 3KL9A 3IJ3A 4R6TA 3FVLA 1ZLIA 1Y0RA 2FG1A 3I1UA 3RAMA 3FMCA 3ETIA 5ELYA 4OC1A 4EMEA 1SPVA 2ZELA 3GQOA 1LCPA 1H8LA 3FECA 2V8GA 4OC3A 4FAIA 1LAMA 3L2NA 3BI1A 3B3VA 3K9TA 4MHPA 4NGNA 2DEAA 3CPXA 3GQEA 3CDXA 4UF4A 2GREA 4X8IA 3SJXA 4O23A 2PIZA 4DJLA 2C6PA 3KASA 1BPMA 4FWUA 1VIXA 2HB6A 2BCOA 1NSAA 1ZG8A 4MHZA 4ONWA 4PQAA 3TC8A 4X3RA 3PB9X 5E3BA 4P4JA 4KSIA 5CPAA 2RFHA 1ZG7A 4A94A 1YSJA 4A38A 3D7GA 2ZEEA 1HEEA 1AYEA 1TKFA 1R3NA 3GLJA 2PJ5A 3SIGA 4Z65A 2ACFA 1TF9A 3T8WA 1PYTB 3SIJA 1Y7EA 3VARA 4OC4A 1YMEA 2ZEFA 4UEFA 1HJZA 2BO9A 1UWYA 4PXCA 4IK2A 2FVGA 2AFXA 4NGQA 1HDQA 1ARMA 1CBXA 3IC1A 3KI9A 1FNOA 3PB8X 1ELLP 5CB3A 2PJ7A 3DLJA 5LRKA 2FAVA 3Q6ZA 1JQGA 3B3WA 4OKOA 4OC5A 7CPAA 5CB5A 4D86A 1R43A 3IFEA 2PJ1A 4OC0A 3FX6A 2AFZA 2EK9A 2PE3A 6CPAA 1Z5RA 2BFRA 5CBMA 1EE3P 2Q43A 2PVWA 4PPZA 1CPSA 3D66A 2VL1A 4NGSA 3B35A 5K8NA 3SI2A 2ZEHA 2IJZA 5HVFA 5LYDA 4OMEA 1VHUA 1DTDA 2PVVA 4PXEA 2LGRA 3LMSA 2PJ4A 2ZEMA 3MRUA 3SIIA 4K3NA 2GU2A 4P4EA 1XMBA 2I3CA 3PRTA 3V38A 4NFRA 3BI0A 2XEJA 2C6CA 4P4FA 3KGQA 1PCAA 2V8HA 3PB6X 3FH4A 2ABZA 3D7DA 2BOAA 1GYTA 3D68A 4CPAA 3PFEA 4J5SA 3EWPA 3D4UA 2CTBA 3B7IA 2EWBA 1Y0YA 2V8VA 4K0CA 3EWOA 5I4MA 4GUAA 4JVVA 4ZYQA 2ANPA 5JH9A 4ETJA 2CF4A 3BXMA 1ZR5A 1OBRA 4MCQA 5AILA 3HLPA 5FSUA 4J5QA 4ZY2A 2BFQA 2C6GA 2QVPA 4ABLA 2AFMA 4P10A 2PJ6A 4UEZA 1RTQA 2ZEPA 3KHZA 4ZY0A 1Q7LA 4EWTA
chains in the Genus database with same CATH superfamily
4UA3A 4XPDC 2Z3KA 3FF3A 4YU9A 3EWRA 2R8VA 2Y0MA 3TFYA 1TKHA 5A27A 1ZR3A 2L8RA 3NA6A 3BHXA 4JYWA 1Q2DA 3EFAA 1X10A 4UIAA 2Q4YA 4JLYA 4KOVA 1Z8XA 2ZEGA 3GPGA 1ELMP 1V0CA 3SI0A 5K8OA 2ZXVA 3IO1A 3VATA 3TOBA 4DUKA 1VHOA 2ZEOA 4R7MA 4QC6A 4F0XA 1XFOA 3FB3A 4ZX8A 4Y49B 3LWUA 4M3SA 2O28A 4NCZA 3DSBA 3IIDA 4C68A 5A28A 4MHDA 5FSVA 4MCSA 4B13A 2YNDA 4KSAA 4J5RA 3T90A 2JBKA 4P44A 2OU2A 4X5KA 4XPLA 4KVOE 1YLOA 2RC4A 4KOSA 4FD5A 4JLLA 3PEIA 1YREA 2QJ8A 2VZZA 2PRBA 4RS2A 4E2AA 3JRUA 5GCNA 4HPSA 2FL4A 2OZGA 4C2ZA 5H84A 4F9VA 4ZI6A 1BOBA 2B3VA 1VHSA 4R76A 2GE3A 4JGKA 3CT9A 2WCTA 4OP4A 3B3TA 4AVBA 1LFWA 2ZOGA 2Q04A 4RN7A 3V8IA 4BBHA 4JCAA 5KTDA 4L89A 2EO8A 3B3CA 4B5PA 4AVCA 2G3AA 3NE8A 3GIUA 2ZW4A 1DE4C 3S6HA 3FEEA 5F49A 4ZGYB 3RBUA 4A2ZA 2B4DA 1TXZA 5D29A 2Z3MA 5J1QA 2PDOA 3S6FA 3IWWA 2XEIA 4JXQA 3Q71A 4ZY1A 2WPXA 3RZAA 3KQXA 1LOKA 4MHYA 3PFOA 5CNPA 3PBEA 1IYLA 4KYBA 1Z8LA 4H2KA 3VH9A 1FY7A 4X2TA 3V45A 1S60A 1M1DA 1TF8A 3NH5A 5G1ZA 2P6EA 3QB8A 2ODFA 4G1PA 2JZFA 3JZTA 2PJAA 5HXDA 4QUSA 5FSZA 2BEIA 3WC5A 1MK4A 3K9UA 1F57A 2JBJA 1S7NA 3S9LA 1Z8WA 3B3SA 4BINA 4GVVA 1K4JA 1R57A 2FT0A 3KQZA 4A32A 4R8FA 1MJ9A 2GLJA 5CMSA 4L8AA 4IUSA 1YX0A 3DGVA 2QECA 4A30A 4FD6A 1Z4EA 4OIDA 3SHPA 4UFWA 2JEWA 2PJ3A 2Q0YA 1Z8TA 2ZEDA 2PSWA 2POKA 1NJRA 3UY5A 5G20A 4FUUA 2NSMA 1Q2CA 3PGPA 2EK8A 2O53A 4HNXB 3SXOA 2C1CA 4UCNA 1AUGA 1QQ9A 2FXFA 5JQ4A 2GFQA 2YGWA 1N71A 5EC4A 5E96A 2G9DA 2IL4A 3D2PA 4DYOA 4MHNA 4NJRA 2CIJA 4WJBA 2CNMA 4J3GA 5EMIA 5J8FA 2X7BA 1CG2A 2HC9A 3F0AA 4QB9A 2I79A 5DUSA 1BAVA 1RXTA 4WWVA 4OIWA 3GPQA 2JZDA 1YVKA 4PXDA 4UFVA 4TWEA 5K8MA 2DF5A 2EVNA 4GS4A 1F2OA 4ETKA 4A95A 4MFPA 3TE4A 1CP6A 2AE6A 1LRZA 4UWJA 4KOXA 5LYIA 4H6ZA 4B12A 4P4BA 4EFDA 2PJBA 3F8KA 4MFQA 4MFZA 3W6XA 3V2BA 3B8GA 4XNHB 4Q7AA 3S9MA 3FNCA 4OC2A 4PXBA 2PJ9A 1QMUA 3H5ZA 4ZX9A 3HUVA 3IIBA 5AG6A 4CAVA 2WUUA 1YW6A 1IOFA 3B2YA 1KWMA 1QSRA 2NMTA 3SI1A 4QBJA 3EJGA 3EJFA 2GLFA 4KOYA 4M6IA 2AFOA 3JTKA 1BPNA 1P0HA 1HDUA 2AFSA 2XEFA 4R57A 2J9AA 2EUIA 2F8HA 2VXKA 1XEBA 5AG7A 2OB0A 1TXRA 2R7HA 4GM5A 2HV2A 4MCRA 2CTCA 1CX8A 5F47A 4H89A 3BJ7A 5LRGA 3EW5A 5J8CA 2FCKA 4A33A 3PZJA 4DNCA 2O4HA 4CGLA 3H8GA 2DPTA 1AMPA 1IGBA 3I3GA 3F5BA 3EWQA 4NGMA 2A4NA 2Q51A 3SJFA 3D67A 4GVWA 2PRQA 2AFWA 2B5GB 1S7FA 3LODA 4P45A 3D7FA 4Y49C 1LANA 3SJEA 5HVGA 2F7VA 1U6MA 2IQ6A 3S6GA 4TNUA 1PUAA 3KKWA 1YGHA 2PCUA 1M4DA 2QYVA 1IY7A 2FE7A 4AXVA 4TU0A 4MXUA 1KUYA 1KZFA 3JUWA 3LACA 5K8PA 4CGMA 2Z0ZA 2V8DA 4LQGA 4U9ZA 4OLLA 4B5PB 3MN8A 4MRIA 3IEHA 5F09A 3PB4X 5H86A 2WYRA 4W9YA 2PJ2A 2JZEA 2B4DB 4P4IA 3GPOA 2ZENA 3PB7X 1XBUA 3TO7A 3TX8A 1P4NA 1BLLE 4UIBA 4J4ZA 2OOTA 1NMTA 3RO0A 4F0YA 5JM6A 1KUVA 3V7ZA 3R9FA 1IB1E 4YGOA 1Z9UA 4YWYA 2PJCA 3W6SA 2AFCA 3VWEA 3H8EA 2FIWA 1I21A 2ZPAA 2FS5A 3CXQA 4IAVA 3EKEA 2EBJA 3WC7A 4MCPA 5G21A 5FSYA 5F48A 4B14A 2W2GA 1XOVA 4MY0A 2KQVA 3H8FA 3DR6A 3KR4A 3QAHA 3D3SA 5D8NA 1B6BA 2C27A 3QNVA 1VHEA 2WSAA 2XEGA 4R87A 4R3KA 4FBEA 2VRIA 2OZHA 4CYQA 4IHMA 1VGYA 2Z3PA 3IIFA 1S5KA 2PJ0A 3S9NA 4NGTA 3SJGA 4MY3A 2Z3LA 1ARLA 2REEA 1YW4A 4IF5A 2GANA 1Z2LA 8CPAA 5HOLA 1XRYA 2Q44A 4NSQA 3SIHA 3RNZA 3CZXA 2DX6A 5IB9A 3PBBA 1CPXA 2FXKA 1J4JA 3R9GA 3TO6A 4CGOA 1CP7A 2OR4A 3FJUA 4OAEA 2IMOA 2AFUA 1IYKA 1KUXA 4JXRA 4MMOA 4FD4A 2YNCC 5G22A 3DR8A 3WC6A 3CPAA 3DNSA 1FT7A 1WWZA 1YD9A 2ZOFA 3R9EA 4F6AA 2Q4VA 2WZNA 4JZ0A 5HIHA 5C82A 3ISZA 4P4DA 5LRJA 4NGRA 3FEDA 3D7HA 5DWNA 5I0CA 4ESSA 5IB0A 1ZLHA 1YQEA 5LYFA 2PR8A 4B6ZA 4C2XA 5HVHA 4UMLA 2X47A 4MFKA 2R1IA 2EEEA 2D4PA 4LUAA 3W91A 2VZYA 5ISVA 4A39A 2Q4ZA 3N5FA 4AB7A 3TCVA 4GXHA 3NH4A 3JVNA 2ZW6A 5THWA 1LAPA 1B87A 1QSTA 1XIXA 2J8MA 4JWPA 2V77A 4PV6A 4KLVA 1ON0A 4E0AA 4RUHA 2I00A 4KZTA 2PJ8A 4KVXA 3IU1A 1XMTA 3GB0A 4HKFA 4IQYA 3GUXA 5DS0A 1F2PA 4UEEA 4A37A 4F8ZA 3K2KA 5JGFA 3ISXA 4XPKA 3ZZIA 3IWGA 4P6YA 2XD7A 3NFZA 3P2FA 4XNHC 2PIYA 3WT4A 1TY8A 4CS0B 2NYQA 3NH8A 2B58A 4UCPA 2Z11A 2RB7A 3VFQA 3EC4A 4NJQA 3ZJ0A 1TKJA 4A31A 3GKRA 4B5OA 4CAEA 2QIRA 2YNEA 2Z3OA 1XJOA 3FXTA 3KR5A 3WABA 4NGPA 3KZWA 1YK3A 5FVJA 4ABKA 5FSXA 3KHXA 1M4LA 1ZG9A 1S7KA 4BD9A 7CPAA 5LYLA 1JWQA 2PC1A 3KL9A 3IJ3A 4R6TA 3FVLA 1ZLIA 1Y0RA 2FG1A 4LX9A 3WR7A 3I1UA 3RAMA 3FMCA 3ETIA 5ELYA 4OC1A 4RI1A 4KLWA 4EMEA 2VI7A 1SPVA 1A2ZA 2ZELA 5JPHA 3SXNA 4YFJA 3GQOA 1LCPA 1H8LA 1M4IA 3FRMA 3FECA 2V8GA 3R1KA 4PSXA 4OC3A 4Q38A 4FAIA 4AG7A 1LAMA 4PK3A 3L2NA 3BI1A 4CAXA 2P6FA 3B3VA 2ZW7A 3K9TA 4EVYA 1S3ZA 5AG5A 4B11A 3IGRA 3QAYA 3DDDA 2DEAA 3CPXA 3EXNA 4MHPA 3GQEA 2Q7SA 4MBUA 4NGNA 3CDXA 1I12A 2J8NA 1Q2YA 4UF4A 4UFXA 4U9YA 2GREA 4X8IA 3SJXA 4O23A 2PIZA 3EY5A 5AG4A 4KORA 1QSOA 4DJLA 5F46A 2C6PA 2P6GA 2VQYA 3R96A 5KTAA 3KASA 4NXYA 1BPMA 3C26A 4FWUA 1NE9A 1VIXA 2BSWA 3TOAA 4AVAA 1I1DA 2JEVA 2HB6A 4MJ8A 2BCOA 1NSAA 1ZG8A 3LD2A 4MHZA 4ONWA 4CYNA 1UFHA 3IWEA 5DWMA 1MJBA 4PQAA 4CRYB 5IX3A 4K30A 4Q36A 3TC8A 4X3RA 4LQ6A 4CAFA 1CJWA 3PB9X 5E3BA 4P4JA 4R3LA 4KSIA 5CPAA 2OZUA 4OADA 2RFHA 5IV0A 4YRHA 1Z4RA 2JDCA 4II9A 4MI4A 1ZG7A 4A94A 1YSJA 1IU8A 3RYOA 4XPDB 4H6UA 4A38A 3D7GA 1TIQA 2ZEEA 1HEEA 1AYEA 1TKFA 3NE7A 1R3NA 4MFJA 2VEZA 3I9SA 2JLMA 3GLJA 2PJ5A 3IU2A 3SIGA 2OH1A 1GHEA 4Z65A 1XF8A 2ACFA 1TF9A 3T8WA 4KS9A 1PYTB 3SIJA 1Y7EA 3H4QA 5HH1A 3VARA 2CXAA 1X12A 2CNSA 4OC4A 2B5GA 1QSMA 2REFA 1YMEA 3OWCA 4PK2A 4UBRA 2ZEFA 4CYOA 4UEFA 1HJZA 2BO9A 1UWYA 3TT2A 4PXCA 4IK2A 2FVGA 2AFXA 2KCWA 4NGQA 1CM0A 1HDQA 2G0BA 1ARMA 1CBXA 4HNYB 3IC1A 3KI9A 1FNOA 1IICA 4M85A 3R95A 2J8RA 2PR1A 2BL1A 3PB8X 4CAWA 2B4BA 1ELLP 1QSNA 5CB3A 2PJ7A 3DLJA 3EO4A 5LRKA 2QMLA 2FAVA 2RNKA 4I49A 4KSFA 3Q6ZA 1JQGA 1S7LA 3B3WA 3GYAA 4KVME 4OKOA 4OC5A 5CB5A 3FIXA 3PP9A 1PU9A 4BMHA 4D86A 3FBUA 3MGDA 3G8WA 1R43A 3IFEA 2PJ1A 4JD6A 4OC0A 4C7IA 3FX6A 2AFZA 2EK9A 2PE3A 6CPAA 1Z5RA 2BFRA 1L0CA 3P2HA 5CBMA 1EE3P 2Q43A 2PVWA 4PPZA 1CPSA 1YVOA 2WPWA 3D66A 2CY2A 4CRZB 2GIVA 2VL1A 4NGSA 2G3TA 3B35A 5K8NA 2K5TA 3SI2A 1Y9KA 2ZEHA 2FSRA 3G3SA 2IJZA 5HVFA 1OZPA 1Y7RA 5LYDA 3GY9A 4KOUA 4OMEA 1VHUA 1DTDA 5BWAB 4HNWB 2PQ8A 2PVVA 2H5MA 3TTHA 2HUZA 3A9LA 2Z10A 4PXEA 5C88A 2LGRA 3LMSA 2PJ4A 2ZEMA 3FYNA 4ZBGA 3CXPA 3MRUA 5EBVA 2ZW5A 2Q7BA 3SIIA 1Y9WA 4K3NA 2GU2A 4ORFA 4P4EA 4KUBA 4M6GA 1VKCA 1XMBA 1YR0A 2ATRA 2HQYA 2I3CA 3PRTA 4NFRA 3BJ8A 3BI0A 2XEJA 4R9MA 3TO9A 3V38A 4B10A 5KTCA 2C6CA 4P4FA 3KGQA 1PCAA 2V8HA 1IOIA 3PB6X 5HMNA 1YLEA 3D8PA 3FH4A 2ABZA 3D7DA 1MJAA 1GYTA 2BOAA 3D68A 4F9UA 4CPAA 4UCMA 3CXSA 1ZO0A 3PFEA 4J5SA 2ARHA 2BUEA 3EWPA 4U5YA 3D4UA 4CGPA 2CTBA 3B7IA 2EWBA 2FIAA 1Y0YA 2V8VA 4K0CA 2B3UA 2DPSA 1IIDA 3EWOA 2D4OA 5I4MA 4KUAA 3E0KA 4GUAA 4KOTA 3BLNA 2YNCA 4NF1A 4JVVA 4KOWA 4ONUA 2DXQA 4ZYQA 2ANPA 4C2YA 4C7HA 4CYPA 5JH9A 1WK4A 4NEXA 4ETJA 1M4GA 2CF4A 1M44A 2JDDA 2CNTA 4M6HA 3BXMA 3N7ZA 1ZR5A 1OBRA 4PSWA 1NSLA 4MCQA 4AG9A 4UWIA 5AILA 3HLPA 2VBQA 4QVTA 4CGNA 5AGEA 4FD7A 4MFLA 1RO5A 4E8OA 5FSUA 4J5QA 1BO4A 3T9YA 4ZY2A 2BFQA 3S6KA 2C6GA 2AJ6A 2Z3NA 1SQHA 2QVPA 4ABLA 2AFMA 4P10A 2PJ6A 4UEZA 1RTQA 4JJXA 2ZEPA 3D2MA 2F5IA 2P0WA 4ZY0A 3KHZA 1Q7LA 3VWDA 4EWTA 2R98A 1XE4A
chains in the Genus database with same CATH topology
3FF3A 4YU9A 3EWRA 1TKHA 1ZR3A 2L8RA 3NA6A 3BHXA 4JYWA 4UIAA 2ZEGA 3GPGA 1ELMP 3SI0A 5K8OA 3VATA 3IO1A 4DUKA 1VHOA 2ZEOA 4R7MA 1XFOA 4ZX8A 3LWUA 3IIDA 5FSVA 4MCSA 4J5RA 2JBKA 4P44A 1YLOA 4JLLA 3PEIA 2QJ8A 3JRUA 4F9VA 4ZI6A 4R76A 4JGKA 3CT9A 4OP4A 3B3TA 1LFWA 2ZOGA 4JCAA 3B3CA 1DE4C 3FEEA 3RBUA 1TXZA 5D29A 5J1QA 3IWWA 2XEIA 3RZAA 3Q71A 4ZY1A 3KQXA 1LOKA 4MHYA 3PFOA 3PBEA 4H2KA 4KYBA 1Z8LA 3VH9A 4X2TA 3V45A 1TF8A 3NH5A 4G1PA 3JZTA 2PJAA 5HXDA 5FSZA 3WC5A 1F57A 2JBJA 3S9LA 3B3SA 4GVVA 3KQZA 4R8FA 2GLJA 5CMSA 3DGVA 4OIDA 2JEWA 2PJ3A 2ZEDA 2POKA 1NJRA 4FUUA 2NSMA 2EK8A 2O53A 2C1CA 1QQ9A 2G9DA 4DYOA 4MHNA 4NJRA 2CIJA 4WJBA 1CG2A 2HC9A 5DUSA 1BAVA 4WWVA 4OIWA 3GPQA 4PXDA 5K8MA 4TWEA 1F2OA 4ETKA 1CP6A 5LYIA 4P4BA 4EFDA 2PJBA 3V2BA 4Q7AA 3S9MA 4OC2A 4PXBA 2PJ9A 1QMUA 3IIBA 4ZX9A 3HUVA 1YW6A 3B2YA 1KWMA 3SI1A 3EJGA 3EJFA 2GLFA 2AFOA 1BPNA 2AFSA 1HDUA 2XEFA 2J9AA 2F8HA 1TXRA 4GM5A 4MCRA 2CTCA 1CX8A 5LRGA 3EW5A 2O4HA 3H8GA 1AMPA 1IGBA 3EWQA 4NGMA 2Q51A 3SJFA 3D67A 4GVWA 2PRQA 2AFWA 4P45A 3SJEA 3D7FA 1LANA 5HVGA 2F7VA 2IQ6A 4TNUA 2PCUA 2QYVA 1IY7A 4AXVA 4TU0A 4MXUA 5K8PA 2V8DA 4LQGA 3MN8A 4MRIA 3IEHA 5F09A 3PB4X 2WYRA 4W9YA 2PJ2A 4P4IA 3GPOA 2ZENA 3PB7X 1XBUA 3TX8A 1BLLE 4UIBA 4J4ZA 2OOTA 5JM6A 3V7ZA 4YWYA 2PJCA 2AFCA 3H8EA 4IAVA 3EKEA 3WC7A 4MCPA 5FSYA 3H8FA 3KR4A 5D8NA 3QNVA 1VHEA 2XEGA 4FBEA 2VRIA 4IHMA 1VGYA 3IIFA 2PJ0A 3S9NA 4NGTA 3SJGA 1ARLA 1YW4A 1Z2LA 8CPAA 5HOLA 1XRYA 3SIHA 2DX6A 5IB9A 3PBBA 1CPXA 2FXKA 1CP7A 2OR4A 3FJUA 2IMOA 2AFUA 4MMOA 3WC6A 3CPAA 1FT7A 2ZOFA 1YD9A 2WZNA 4JZ0A 5HIHA 3ISZA 4P4DA 5LRJA 4NGRA 3FEDA 3D7HA 4ESSA 1ZLHA 5LYFA 4B6ZA 5HVHA 4UMLA 2X47A 2EEEA 4A39A 2Q4ZA 3N5FA 3NH4A 5THWA 1LAPA 2V77A 4RUHA 2PJ8A 3GB0A 4IQYA 3GUXA 5DS0A 1F2PA 4UEEA 4A37A 4F8ZA 3K2KA 5JGFA 3ISXA 4P6YA 2XD7A 3NFZA 3WT4A 2PIYA 1TY8A 2NYQA 3NH8A 4F9UA 2RB7A 3VFQA 4NJQA 1TKJA 1XJOA 3KR5A 3WABA 4NGPA 3KZWA 4ABKA 5FSXA 3KHXA 1M4LA 1ZG9A 4BD9A 5LYLA 3KL9A 3IJ3A 4R6TA 3FVLA 1ZLIA 1Y0RA 2FG1A 3I1UA 3RAMA 3FMCA 3ETIA 5ELYA 4OC1A 4EMEA 1SPVA 2ZELA 3GQOA 1LCPA 1H8LA 3FECA 2V8GA 4OC3A 4FAIA 1LAMA 3L2NA 3BI1A 3B3VA 3K9TA 4MHPA 4NGNA 2DEAA 3CPXA 3GQEA 3CDXA 4UF4A 2GREA 4X8IA 3SJXA 4O23A 2PIZA 4DJLA 2C6PA 3KASA 1BPMA 4FWUA 1VIXA 2HB6A 2BCOA 1NSAA 1ZG8A 4MHZA 4ONWA 4PQAA 3TC8A 4X3RA 3PB9X 5E3BA 4P4JA 4KSIA 5CPAA 2RFHA 1ZG7A 4A94A 1YSJA 4A38A 3D7GA 2ZEEA 1HEEA 1AYEA 1TKFA 1R3NA 3GLJA 2PJ5A 3SIGA 4Z65A 2ACFA 1TF9A 3T8WA 1PYTB 3SIJA 1Y7EA 3VARA 4OC4A 1YMEA 2ZEFA 4UEFA 1HJZA 2BO9A 1UWYA 4PXCA 4IK2A 2FVGA 2AFXA 4NGQA 1HDQA 1ARMA 1CBXA 3IC1A 3KI9A 1FNOA 3PB8X 1ELLP 5CB3A 2PJ7A 3DLJA 5LRKA 2FAVA 3Q6ZA 1JQGA 3B3WA 4OKOA 4OC5A 7CPAA 5CB5A 4D86A 1R43A 3IFEA 2PJ1A 4OC0A 3FX6A 2AFZA 2EK9A 2PE3A 6CPAA 1Z5RA 2BFRA 5CBMA 1EE3P 2Q43A 2PVWA 4PPZA 1CPSA 3D66A 2VL1A 4NGSA 3B35A 5K8NA 3SI2A 2ZEHA 2IJZA 5HVFA 5LYDA 4OMEA 1VHUA 1DTDA 2PVVA 4PXEA 2LGRA 3LMSA 2PJ4A 2ZEMA 3MRUA 3SIIA 4K3NA 2GU2A 4P4EA 1XMBA 2I3CA 3PRTA 3V38A 4NFRA 3BI0A 2XEJA 2C6CA 4P4FA 3KGQA 1PCAA 2V8HA 3PB6X 3FH4A 2ABZA 3D7DA 2BOAA 1GYTA 3D68A 4CPAA 3PFEA 4J5SA 3EWPA 3D4UA 2CTBA 3B7IA 2EWBA 1Y0YA 2V8VA 4K0CA 3EWOA 5I4MA 4GUAA 4JVVA 4ZYQA 2ANPA 5JH9A 4ETJA 2CF4A 3BXMA 1ZR5A 1OBRA 4MCQA 5AILA 3HLPA 5FSUA 4J5QA 4ZY2A 2BFQA 2C6GA 2QVPA 4ABLA 2AFMA 4P10A 2PJ6A 4UEZA 1RTQA 2ZEPA 3KHZA 4ZY0A 1Q7LA 4EWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF3 A;  4YU9 A;  3EWR A;  1TKH A;  1ZR3 A;  2L8R A;  3NA6 A;  3BHX A;  4JYW A;  4UIA A;  2ZEG A;  3GPG A;  1ELM P;  3SI0 A;  5K8O A;  3VAT A;  3IO1 A;  4DUK A;  1VHO A;  2ZEO A;  4R7M A;  1XFO A;  4ZX8 A;  3LWU A;  3IID A;  5FSV A;  4MCS A;  4J5R A;  2JBK A;  4P44 A;  1YLO A;  4JLL A;  3PEI A;  2QJ8 A;  3JRU A;  4F9V A;  4ZI6 A;  4R76 A;  4JGK A;  3CT9 A;  4OP4 A;  3B3T A;  1LFW A;  2ZOG A;  4JCA A;  3B3C A;  1DE4 C;  3FEE A;  3RBU A;  1TXZ A;  5D29 A;  5J1Q A;  3IWW A;  2XEI A;  3RZA A;  3Q71 A;  4ZY1 A;  3KQX A;  1LOK A;  4MHY A;  3PFO A;  3PBE A;  4H2K A;  4KYB A;  1Z8L A;  3VH9 A;  4X2T A;  3V45 A;  1TF8 A;  3NH5 A;  4G1P A;  3JZT A;  2PJA A;  5HXD A;  5FSZ A;  3WC5 A;  1F57 A;  2JBJ A;  3S9L A;  3B3S A;  4GVV A;  3KQZ A;  4R8F A;  2GLJ A;  5CMS A;  3DGV A;  4OID A;  2JEW A;  2PJ3 A;  2ZED A;  2POK A;  1NJR A;  4FUU A;  2NSM A;  2EK8 A;  2O53 A;  2C1C A;  1QQ9 A;  2G9D A;  4DYO A;  4MHN A;  4NJR A;  2CIJ A;  4WJB A;  1CG2 A;  2HC9 A;  5DUS A;  1BAV A;  4WWV A;  4OIW A;  3GPQ A;  4PXD A;  5K8M A;  4TWE A;  1F2O A;  4ETK A;  1CP6 A;  5LYI A;  4P4B A;  4EFD A;  2PJB A;  3V2B A;  4Q7A A;  3S9M A;  4OC2 A;  4PXB A;  2PJ9 A;  1QMU A;  3IIB A;  4ZX9 A;  3HUV A;  1YW6 A;  3B2Y A;  1KWM A;  3SI1 A;  3EJG A;  3EJF A;  2GLF A;  2AFO A;  1BPN A;  2AFS A;  1HDU A;  2XEF A;  2J9A A;  2F8H A;  1TXR A;  4GM5 A;  4MCR A;  2CTC A;  1CX8 A;  5LRG A;  3EW5 A;  2O4H A;  3H8G A;  1AMP A;  1IGB A;  3EWQ A;  4NGM A;  2Q51 A;  3SJF A;  3D67 A;  4GVW A;  2PRQ A;  2AFW A;  4P45 A;  3SJE A;  3D7F A;  1LAN A;  5HVG A;  2F7V A;  2IQ6 A;  4TNU A;  2PCU A;  2QYV A;  1IY7 A;  4AXV A;  4TU0 A;  4MXU A;  5K8P A;  2V8D A;  4LQG A;  3MN8 A;  4MRI A;  3IEH A;  5F09 A;  3PB4 X;  2WYR A;  4W9Y A;  2PJ2 A;  4P4I A;  3GPO A;  2ZEN A;  3PB7 X;  1XBU A;  3TX8 A;  1BLL E;  4UIB A;  4J4Z A;  2OOT A;  5JM6 A;  3V7Z A;  4YWY A;  2PJC A;  2AFC A;  3H8E A;  4IAV A;  3EKE A;  3WC7 A;  4MCP A;  5FSY A;  3H8F A;  3KR4 A;  5D8N A;  3QNV A;  1VHE A;  2XEG A;  4FBE A;  2VRI A;  4IHM A;  1VGY A;  3IIF A;  2PJ0 A;  3S9N A;  4NGT A;  3SJG A;  1ARL A;  1YW4 A;  1Z2L A;  8CPA A;  5HOL A;  1XRY A;  3SIH A;  2DX6 A;  5IB9 A;  3PBB A;  1CPX A;  2FXK A;  1CP7 A;  2OR4 A;  3FJU A;  2IMO A;  2AFU A;  4MMO A;  3WC6 A;  3CPA A;  1FT7 A;  2ZOF A;  1YD9 A;  2WZN A;  4JZ0 A;  5HIH A;  3ISZ A;  4P4D A;  5LRJ A;  4NGR A;  3FED A;  3D7H A;  4ESS A;  1ZLH A;  5LYF A;  4B6Z A;  5HVH A;  4UML A;  2X47 A;  2EEE A;  4A39 A;  2Q4Z A;  3N5F A;  3NH4 A;  5THW A;  1LAP A;  2V77 A;  4RUH A;  2PJ8 A;  3GB0 A;  4IQY A;  3GUX A;  5DS0 A;  1F2P A;  4UEE A;  4A37 A;  4F8Z A;  3K2K A;  5JGF A;  3ISX A;  4P6Y A;  2XD7 A;  3NFZ A;  3WT4 A;  2PIY A;  1TY8 A;  2NYQ A;  3NH8 A;  4F9U A;  2RB7 A;  3VFQ A;  4NJQ A;  1TKJ A;  1XJO A;  3KR5 A;  3WAB A;  4NGP A;  3KZW A;  4ABK A;  5FSX A;  3KHX A;  1M4L A;  1ZG9 A;  4BD9 A;  5LYL A;  3KL9 A;  3IJ3 A;  4R6T A;  3FVL A;  1ZLI A;  1Y0R A;  2FG1 A;  3I1U A;  3RAM A;  3FMC A;  3ETI A;  5ELY A;  4OC1 A;  4EME A;  1SPV A;  2ZEL A;  3GQO A;  1LCP A;  1H8L A;  3FEC A;  2V8G A;  4OC3 A;  4FAI A;  1LAM A;  3L2N A;  3BI1 A;  3B3V A;  3K9T A;  4MHP A;  4NGN A;  2DEA A;  3CPX A;  3GQE A;  3CDX A;  4UF4 A;  2GRE A;  4X8I A;  3SJX A;  4O23 A;  2PIZ A;  4DJL A;  2C6P A;  3KAS A;  1BPM A;  4FWU A;  1VIX A;  2HB6 A;  2BCO A;  1NSA A;  1ZG8 A;  4MHZ A;  4ONW A;  4PQA A;  3TC8 A;  4X3R A;  3PB9 X;  5E3B A;  4P4J A;  4KSI A;  5CPA A;  2RFH A;  1ZG7 A;  4A94 A;  1YSJ A;  4A38 A;  3D7G A;  2ZEE A;  1HEE A;  1AYE A;  1TKF A;  1R3N A;  3GLJ A;  2PJ5 A;  3SIG A;  4Z65 A;  2ACF A;  1TF9 A;  3T8W A;  1PYT B;  3SIJ A;  1Y7E A;  3VAR A;  4OC4 A;  1YME A;  2ZEF A;  4UEF A;  1HJZ A;  2BO9 A;  1UWY A;  4PXC A;  4IK2 A;  2FVG A;  2AFX A;  4NGQ A;  1HDQ A;  1ARM A;  1CBX A;  3IC1 A;  3KI9 A;  1FNO A;  3PB8 X;  1ELL P;  5CB3 A;  2PJ7 A;  3DLJ A;  5LRK A;  2FAV A;  3Q6Z A;  1JQG A;  3B3W A;  4OKO A;  4OC5 A;  7CPA A;  5CB5 A;  4D86 A;  1R43 A;  3IFE A;  2PJ1 A;  4OC0 A;  3FX6 A;  2AFZ A;  2EK9 A;  2PE3 A;  6CPA A;  1Z5R A;  2BFR A;  5CBM A;  1EE3 P;  2Q43 A;  2PVW A;  4PPZ A;  1CPS A;  3D66 A;  2VL1 A;  4NGS A;  3B35 A;  5K8N A;  3SI2 A;  2ZEH A;  2IJZ A;  5HVF A;  5LYD A;  4OME A;  1VHU A;  1DTD A;  2PVV A;  4PXE A;  2LGR A;  3LMS A;  2PJ4 A;  2ZEM A;  3MRU A;  3SII A;  4K3N A;  2GU2 A;  4P4E A;  1XMB A;  2I3C A;  3PRT A;  3V38 A;  4NFR A;  3BI0 A;  2XEJ A;  2C6C A;  4P4F A;  3KGQ A;  1PCA A;  2V8H A;  3PB6 X;  3FH4 A;  2ABZ A;  3D7D A;  2BOA A;  1GYT A;  3D68 A;  4CPA A;  3PFE A;  4J5S A;  3EWP A;  3D4U A;  2CTB A;  3B7I A;  2EWB A;  1Y0Y A;  2V8V A;  4K0C A;  3EWO A;  5I4M A;  4GUA A;  4JVV A;  4ZYQ A;  2ANP A;  5JH9 A;  4ETJ A;  2CF4 A;  3BXM A;  1ZR5 A;  1OBR A;  4MCQ A;  5AIL A;  3HLP A;  5FSU A;  4J5Q A;  4ZY2 A;  2BFQ A;  2C6G A;  2QVP A;  4ABL A;  2AFM A;  4P10 A;  2PJ6 A;  4UEZ A;  1RTQ A;  2ZEP A;  3KHZ A;  4ZY0 A;  1Q7L A;  4EWT A; 
#chains in the Genus database with same CATH topology
 4UA3 A;  4XPD C;  2Z3K A;  3FF3 A;  4YU9 A;  3EWR A;  2R8V A;  2Y0M A;  3TFY A;  1TKH A;  5A27 A;  1ZR3 A;  2L8R A;  3NA6 A;  3BHX A;  4JYW A;  1Q2D A;  3EFA A;  1X10 A;  4UIA A;  2Q4Y A;  4JLY A;  4KOV A;  1Z8X A;  2ZEG A;  3GPG A;  1ELM P;  1V0C A;  3SI0 A;  5K8O A;  2ZXV A;  3IO1 A;  3VAT A;  3TOB A;  4DUK A;  1VHO A;  2ZEO A;  4R7M A;  4QC6 A;  4F0X A;  1XFO A;  3FB3 A;  4ZX8 A;  4Y49 B;  3LWU A;  4M3S A;  2O28 A;  4NCZ A;  3DSB A;  3IID A;  4C68 A;  5A28 A;  4MHD A;  5FSV A;  4MCS A;  4B13 A;  2YND A;  4KSA A;  4J5R A;  3T90 A;  2JBK A;  4P44 A;  2OU2 A;  4X5K A;  4XPL A;  4KVO E;  1YLO A;  2RC4 A;  4KOS A;  4FD5 A;  4JLL A;  3PEI A;  1YRE A;  2QJ8 A;  2VZZ A;  2PRB A;  4RS2 A;  4E2A A;  3JRU A;  5GCN A;  4HPS A;  2FL4 A;  2OZG A;  4C2Z A;  5H84 A;  4F9V A;  4ZI6 A;  1BOB A;  2B3V A;  1VHS A;  4R76 A;  2GE3 A;  4JGK A;  3CT9 A;  2WCT A;  4OP4 A;  3B3T A;  4AVB A;  1LFW A;  2ZOG A;  2Q04 A;  4RN7 A;  3V8I A;  4BBH A;  4JCA A;  5KTD A;  4L89 A;  2EO8 A;  3B3C A;  4B5P A;  4AVC A;  2G3A A;  3NE8 A;  3GIU A;  2ZW4 A;  1DE4 C;  3S6H A;  3FEE A;  5F49 A;  4ZGY B;  3RBU A;  4A2Z A;  2B4D A;  1TXZ A;  5D29 A;  2Z3M A;  5J1Q A;  2PDO A;  3S6F A;  3IWW A;  2XEI A;  4JXQ A;  3Q71 A;  4ZY1 A;  2WPX A;  3RZA A;  3KQX A;  1LOK A;  4MHY A;  3PFO A;  5CNP A;  3PBE A;  1IYL A;  4KYB A;  1Z8L A;  4H2K A;  3VH9 A;  1FY7 A;  4X2T A;  3V45 A;  1S60 A;  1M1D A;  1TF8 A;  3NH5 A;  5G1Z A;  2P6E A;  3QB8 A;  2ODF A;  4G1P A;  2JZF A;  3JZT A;  2PJA A;  5HXD A;  4QUS A;  5FSZ A;  2BEI A;  3WC5 A;  1MK4 A;  3K9U A;  1F57 A;  2JBJ A;  1S7N A;  3S9L A;  1Z8W A;  3B3S A;  4BIN A;  4GVV A;  1K4J A;  1R57 A;  2FT0 A;  3KQZ A;  4A32 A;  4R8F A;  1MJ9 A;  2GLJ A;  5CMS A;  4L8A A;  4IUS A;  1YX0 A;  3DGV A;  2QEC A;  4A30 A;  4FD6 A;  1Z4E A;  4OID A;  3SHP A;  4UFW A;  2JEW A;  2PJ3 A;  2Q0Y A;  1Z8T A;  2ZED A;  2PSW A;  2POK A;  1NJR A;  3UY5 A;  5G20 A;  4FUU A;  2NSM A;  1Q2C A;  3PGP A;  2EK8 A;  2O53 A;  4HNX B;  3SXO A;  2C1C A;  4UCN A;  1AUG A;  1QQ9 A;  2FXF A;  5JQ4 A;  2GFQ A;  2YGW A;  1N71 A;  5EC4 A;  5E96 A;  2G9D A;  2IL4 A;  3D2P A;  4DYO A;  4MHN A;  4NJR A;  2CIJ A;  4WJB A;  2CNM A;  4J3G A;  5EMI A;  5J8F A;  2X7B A;  1CG2 A;  2HC9 A;  3F0A A;  4QB9 A;  2I79 A;  5DUS A;  1BAV A;  1RXT A;  4WWV A;  4OIW A;  3GPQ A;  2JZD A;  1YVK A;  4PXD A;  4UFV A;  4TWE A;  5K8M A;  2DF5 A;  2EVN A;  4GS4 A;  1F2O A;  4ETK A;  4A95 A;  4MFP A;  3TE4 A;  1CP6 A;  2AE6 A;  1LRZ A;  4UWJ A;  4KOX A;  5LYI A;  4H6Z A;  4B12 A;  4P4B A;  4EFD A;  2PJB A;  3F8K A;  4MFQ A;  4MFZ A;  3W6X A;  3V2B A;  3B8G A;  4XNH B;  4Q7A A;  3S9M A;  3FNC A;  4OC2 A;  4PXB A;  2PJ9 A;  1QMU A;  3H5Z A;  4ZX9 A;  3HUV A;  3IIB A;  5AG6 A;  4CAV A;  2WUU A;  1YW6 A;  1IOF A;  3B2Y A;  1KWM A;  1QSR A;  2NMT A;  3SI1 A;  4QBJ A;  3EJG A;  3EJF A;  2GLF A;  4KOY A;  4M6I A;  2AFO A;  3JTK A;  1BPN A;  1P0H A;  1HDU A;  2AFS A;  2XEF A;  4R57 A;  2J9A A;  2EUI A;  2F8H A;  2VXK A;  1XEB A;  5AG7 A;  2OB0 A;  1TXR A;  2R7H A;  4GM5 A;  2HV2 A;  4MCR A;  2CTC A;  1CX8 A;  5F47 A;  4H89 A;  3BJ7 A;  5LRG A;  3EW5 A;  5J8C A;  2FCK A;  4A33 A;  3PZJ A;  4DNC A;  2O4H A;  4CGL A;  3H8G A;  2DPT A;  1AMP A;  1IGB A;  3I3G A;  3F5B A;  3EWQ A;  4NGM A;  2A4N A;  2Q51 A;  3SJF A;  3D67 A;  4GVW A;  2PRQ A;  2AFW A;  2B5G B;  1S7F A;  3LOD A;  4P45 A;  3D7F A;  4Y49 C;  1LAN A;  3SJE A;  5HVG A;  2F7V A;  1U6M A;  2IQ6 A;  3S6G A;  4TNU A;  1PUA A;  3KKW A;  1YGH A;  2PCU A;  1M4D A;  2QYV A;  1IY7 A;  2FE7 A;  4AXV A;  4TU0 A;  4MXU A;  1KUY A;  1KZF A;  3JUW A;  3LAC A;  5K8P A;  4CGM A;  2Z0Z A;  2V8D A;  4LQG A;  4U9Z A;  4OLL A;  4B5P B;  3MN8 A;  4MRI A;  3IEH A;  5F09 A;  3PB4 X;  5H86 A;  2WYR A;  4W9Y A;  2PJ2 A;  2JZE A;  2B4D B;  4P4I A;  3GPO A;  2ZEN A;  3PB7 X;  1XBU A;  3TO7 A;  3TX8 A;  1P4N A;  1BLL E;  4UIB A;  4J4Z A;  2OOT A;  1NMT A;  3RO0 A;  4F0Y A;  5JM6 A;  1KUV A;  3V7Z A;  3R9F A;  1IB1 E;  4YGO A;  1Z9U A;  4YWY A;  2PJC A;  3W6S A;  2AFC A;  3VWE A;  3H8E A;  2FIW A;  1I21 A;  2ZPA A;  2FS5 A;  3CXQ A;  4IAV A;  3EKE A;  2EBJ A;  3WC7 A;  4MCP A;  5G21 A;  5FSY A;  5F48 A;  4B14 A;  2W2G A;  1XOV A;  4MY0 A;  2KQV A;  3H8F A;  3DR6 A;  3KR4 A;  3QAH A;  3D3S A;  5D8N A;  1B6B A;  2C27 A;  3QNV A;  1VHE A;  2WSA A;  2XEG A;  4R87 A;  4R3K A;  4FBE A;  2VRI A;  2OZH A;  4CYQ A;  4IHM A;  1VGY A;  2Z3P A;  3IIF A;  1S5K A;  2PJ0 A;  3S9N A;  4NGT A;  3SJG A;  4MY3 A;  2Z3L A;  1ARL A;  2REE A;  1YW4 A;  4IF5 A;  2GAN A;  1Z2L A;  8CPA A;  5HOL A;  1XRY A;  2Q44 A;  4NSQ A;  3SIH A;  3RNZ A;  3CZX A;  2DX6 A;  5IB9 A;  3PBB A;  1CPX A;  2FXK A;  1J4J A;  3R9G A;  3TO6 A;  4CGO A;  1CP7 A;  2OR4 A;  3FJU A;  4OAE A;  2IMO A;  2AFU A;  1IYK A;  1KUX A;  4JXR A;  4MMO A;  4FD4 A;  2YNC C;  5G22 A;  3DR8 A;  3WC6 A;  3CPA A;  3DNS A;  1FT7 A;  1WWZ A;  1YD9 A;  2ZOF A;  3R9E A;  4F6A A;  2Q4V A;  2WZN A;  4JZ0 A;  5HIH A;  5C82 A;  3ISZ A;  4P4D A;  5LRJ A;  4NGR A;  3FED A;  3D7H A;  5DWN A;  5I0C A;  4ESS A;  5IB0 A;  1ZLH A;  1YQE A;  5LYF A;  2PR8 A;  4B6Z A;  4C2X A;  5HVH A;  4UML A;  2X47 A;  4MFK A;  2R1I A;  2EEE A;  2D4P A;  4LUA A;  3W91 A;  2VZY A;  5ISV A;  4A39 A;  2Q4Z A;  3N5F A;  4AB7 A;  3TCV A;  4GXH A;  3NH4 A;  3JVN A;  2ZW6 A;  5THW A;  1LAP A;  1B87 A;  1QST A;  1XIX A;  2J8M A;  4JWP A;  2V77 A;  4PV6 A;  4KLV A;  1ON0 A;  4E0A A;  4RUH A;  2I00 A;  4KZT A;  2PJ8 A;  4KVX A;  3IU1 A;  1XMT A;  3GB0 A;  4HKF A;  4IQY A;  3GUX A;  5DS0 A;  1F2P A;  4UEE A;  4A37 A;  4F8Z A;  3K2K A;  5JGF A;  3ISX A;  4XPK A;  3ZZI A;  3IWG A;  4P6Y A;  2XD7 A;  3NFZ A;  3P2F A;  4XNH C;  2PIY A;  3WT4 A;  1TY8 A;  4CS0 B;  2NYQ A;  3NH8 A;  2B58 A;  4UCP A;  2Z11 A;  2RB7 A;  3VFQ A;  3EC4 A;  4NJQ A;  3ZJ0 A;  1TKJ A;  4A31 A;  3GKR A;  4B5O A;  4CAE A;  2QIR A;  2YNE A;  2Z3O A;  1XJO A;  3FXT A;  3KR5 A;  3WAB A;  4NGP A;  3KZW A;  1YK3 A;  5FVJ A;  4ABK A;  5FSX A;  3KHX A;  1M4L A;  1ZG9 A;  1S7K A;  4BD9 A;  7CPA A;  5LYL A;  1JWQ A;  2PC1 A;  3KL9 A;  3IJ3 A;  4R6T A;  3FVL A;  1ZLI A;  1Y0R A;  2FG1 A;  4LX9 A;  3WR7 A;  3I1U A;  3RAM A;  3FMC A;  3ETI A;  5ELY A;  4OC1 A;  4RI1 A;  4KLW A;  4EME A;  2VI7 A;  1SPV A;  1A2Z A;  2ZEL A;  5JPH A;  3SXN A;  4YFJ A;  3GQO A;  1LCP A;  1H8L A;  1M4I A;  3FRM A;  3FEC A;  2V8G A;  3R1K A;  4PSX A;  4OC3 A;  4Q38 A;  4FAI A;  4AG7 A;  1LAM A;  4PK3 A;  3L2N A;  3BI1 A;  4CAX A;  2P6F A;  3B3V A;  2ZW7 A;  3K9T A;  4EVY A;  1S3Z A;  5AG5 A;  4B11 A;  3IGR A;  3QAY A;  3DDD A;  2DEA A;  3CPX A;  3EXN A;  4MHP A;  3GQE A;  2Q7S A;  4MBU A;  4NGN A;  3CDX A;  1I12 A;  2J8N A;  1Q2Y A;  4UF4 A;  4UFX A;  4U9Y A;  2GRE A;  4X8I A;  3SJX A;  4O23 A;  2PIZ A;  3EY5 A;  5AG4 A;  4KOR A;  1QSO A;  4DJL A;  5F46 A;  2C6P A;  2P6G A;  2VQY A;  3R96 A;  5KTA A;  3KAS A;  4NXY A;  1BPM A;  3C26 A;  4FWU A;  1NE9 A;  1VIX A;  2BSW A;  3TOA A;  4AVA A;  1I1D A;  2JEV A;  2HB6 A;  4MJ8 A;  2BCO A;  1NSA A;  1ZG8 A;  3LD2 A;  4MHZ A;  4ONW A;  4CYN A;  1UFH A;  3IWE A;  5DWM A;  1MJB A;  4PQA A;  4CRY B;  5IX3 A;  4K30 A;  4Q36 A;  3TC8 A;  4X3R A;  4LQ6 A;  4CAF A;  1CJW A;  3PB9 X;  5E3B A;  4P4J A;  4R3L A;  4KSI A;  5CPA A;  2OZU A;  4OAD A;  2RFH A;  5IV0 A;  4YRH A;  1Z4R A;  2JDC A;  4II9 A;  4MI4 A;  1ZG7 A;  4A94 A;  1YSJ A;  1IU8 A;  3RYO A;  4XPD B;  4H6U A;  4A38 A;  3D7G A;  1TIQ A;  2ZEE A;  1HEE A;  1AYE A;  1TKF A;  3NE7 A;  1R3N A;  4MFJ A;  2VEZ A;  3I9S A;  2JLM A;  3GLJ A;  2PJ5 A;  3IU2 A;  3SIG A;  2OH1 A;  1GHE A;  4Z65 A;  1XF8 A;  2ACF A;  1TF9 A;  3T8W A;  4KS9 A;  1PYT B;  3SIJ A;  1Y7E A;  3H4Q A;  5HH1 A;  3VAR A;  2CXA A;  1X12 A;  2CNS A;  4OC4 A;  2B5G A;  1QSM A;  2REF A;  1YME A;  3OWC A;  4PK2 A;  4UBR A;  2ZEF A;  4CYO A;  4UEF A;  1HJZ A;  2BO9 A;  1UWY A;  3TT2 A;  4PXC A;  4IK2 A;  2FVG A;  2AFX A;  2KCW A;  4NGQ A;  1CM0 A;  1HDQ A;  2G0B A;  1ARM A;  1CBX A;  4HNY B;  3IC1 A;  3KI9 A;  1FNO A;  1IIC A;  4M85 A;  3R95 A;  2J8R A;  2PR1 A;  2BL1 A;  3PB8 X;  4CAW A;  2B4B A;  1ELL P;  1QSN A;  5CB3 A;  2PJ7 A;  3DLJ A;  3EO4 A;  5LRK A;  2QML A;  2FAV A;  2RNK A;  4I49 A;  4KSF A;  3Q6Z A;  1JQG A;  1S7L A;  3B3W A;  3GYA A;  4KVM E;  4OKO A;  4OC5 A;  5CB5 A;  3FIX A;  3PP9 A;  1PU9 A;  4BMH A;  4D86 A;  3FBU A;  3MGD A;  3G8W A;  1R43 A;  3IFE A;  2PJ1 A;  4JD6 A;  4OC0 A;  4C7I A;  3FX6 A;  2AFZ A;  2EK9 A;  2PE3 A;  6CPA A;  1Z5R A;  2BFR A;  1L0C A;  3P2H A;  5CBM A;  1EE3 P;  2Q43 A;  2PVW A;  4PPZ A;  1CPS A;  1YVO A;  2WPW A;  3D66 A;  2CY2 A;  4CRZ B;  2GIV A;  2VL1 A;  4NGS A;  2G3T A;  3B35 A;  5K8N A;  2K5T A;  3SI2 A;  1Y9K A;  2ZEH A;  2FSR A;  3G3S A;  2IJZ A;  5HVF A;  1OZP A;  1Y7R A;  5LYD A;  3GY9 A;  4KOU A;  4OME A;  1VHU A;  1DTD A;  5BWA B;  4HNW B;  2PQ8 A;  2PVV A;  2H5M A;  3TTH A;  2HUZ A;  3A9L A;  2Z10 A;  4PXE A;  5C88 A;  2LGR A;  3LMS A;  2PJ4 A;  2ZEM A;  3FYN A;  4ZBG A;  3CXP A;  3MRU A;  5EBV A;  2ZW5 A;  2Q7B A;  3SII A;  1Y9W A;  4K3N A;  2GU2 A;  4ORF A;  4P4E A;  4KUB A;  4M6G A;  1VKC A;  1XMB A;  1YR0 A;  2ATR A;  2HQY A;  2I3C A;  3PRT A;  4NFR A;  3BJ8 A;  3BI0 A;  2XEJ A;  4R9M A;  3TO9 A;  3V38 A;  4B10 A;  5KTC A;  2C6C A;  4P4F A;  3KGQ A;  1PCA A;  2V8H A;  1IOI A;  3PB6 X;  5HMN A;  1YLE A;  3D8P A;  3FH4 A;  2ABZ A;  3D7D A;  1MJA A;  1GYT A;  2BOA A;  3D68 A;  4F9U A;  4CPA A;  4UCM A;  3CXS A;  1ZO0 A;  3PFE A;  4J5S A;  2ARH A;  2BUE A;  3EWP A;  4U5Y A;  3D4U A;  4CGP A;  2CTB A;  3B7I A;  2EWB A;  2FIA A;  1Y0Y A;  2V8V A;  4K0C A;  2B3U A;  2DPS A;  1IID A;  3EWO A;  2D4O A;  5I4M A;  4KUA A;  3E0K A;  4GUA A;  4KOT A;  3BLN A;  2YNC A;  4NF1 A;  4JVV A;  4KOW A;  4ONU A;  2DXQ A;  4ZYQ A;  2ANP A;  4C2Y A;  4C7H A;  4CYP A;  5JH9 A;  1WK4 A;  4NEX A;  4ETJ A;  1M4G A;  2CF4 A;  1M44 A;  2JDD A;  2CNT A;  4M6H A;  3BXM A;  3N7Z A;  1ZR5 A;  1OBR A;  4PSW A;  1NSL A;  4MCQ A;  4AG9 A;  4UWI A;  5AIL A;  3HLP A;  2VBQ A;  4QVT A;  4CGN A;  5AGE A;  4FD7 A;  4MFL A;  1RO5 A;  4E8O A;  5FSU A;  4J5Q A;  1BO4 A;  3T9Y A;  4ZY2 A;  2BFQ A;  3S6K A;  2C6G A;  2AJ6 A;  2Z3N A;  1SQH A;  2QVP A;  4ABL A;  2AFM A;  4P10 A;  2PJ6 A;  4UEZ A;  1RTQ A;  4JJX A;  2ZEP A;  3D2M A;  2F5I A;  2P0W A;  4ZY0 A;  3KHZ A;  1Q7L A;  3VWD A;  4EWT A;  2R98 A;  1XE4 A; 
#chains in the Genus database with same CATH homology
 3FF3 A;  4YU9 A;  3EWR A;  1TKH A;  1ZR3 A;  2L8R A;  3NA6 A;  3BHX A;  4JYW A;  4UIA A;  2ZEG A;  3GPG A;  1ELM P;  3SI0 A;  5K8O A;  3VAT A;  3IO1 A;  4DUK A;  1VHO A;  2ZEO A;  4R7M A;  1XFO A;  4ZX8 A;  3LWU A;  3IID A;  5FSV A;  4MCS A;  4J5R A;  2JBK A;  4P44 A;  1YLO A;  4JLL A;  3PEI A;  2QJ8 A;  3JRU A;  4F9V A;  4ZI6 A;  4R76 A;  4JGK A;  3CT9 A;  4OP4 A;  3B3T A;  1LFW A;  2ZOG A;  4JCA A;  3B3C A;  1DE4 C;  3FEE A;  3RBU A;  1TXZ A;  5D29 A;  5J1Q A;  3IWW A;  2XEI A;  3RZA A;  3Q71 A;  4ZY1 A;  3KQX A;  1LOK A;  4MHY A;  3PFO A;  3PBE A;  4H2K A;  4KYB A;  1Z8L A;  3VH9 A;  4X2T A;  3V45 A;  1TF8 A;  3NH5 A;  4G1P A;  3JZT A;  2PJA A;  5HXD A;  5FSZ A;  3WC5 A;  1F57 A;  2JBJ A;  3S9L A;  3B3S A;  4GVV A;  3KQZ A;  4R8F A;  2GLJ A;  5CMS A;  3DGV A;  4OID A;  2JEW A;  2PJ3 A;  2ZED A;  2POK A;  1NJR A;  4FUU A;  2NSM A;  2EK8 A;  2O53 A;  2C1C A;  1QQ9 A;  2G9D A;  4DYO A;  4MHN A;  4NJR A;  2CIJ A;  4WJB A;  1CG2 A;  2HC9 A;  5DUS A;  1BAV A;  4WWV A;  4OIW A;  3GPQ A;  4PXD A;  5K8M A;  4TWE A;  1F2O A;  4ETK A;  1CP6 A;  5LYI A;  4P4B A;  4EFD A;  2PJB A;  3V2B A;  4Q7A A;  3S9M A;  4OC2 A;  4PXB A;  2PJ9 A;  1QMU A;  3IIB A;  4ZX9 A;  3HUV A;  1YW6 A;  3B2Y A;  1KWM A;  3SI1 A;  3EJG A;  3EJF A;  2GLF A;  2AFO A;  1BPN A;  2AFS A;  1HDU A;  2XEF A;  2J9A A;  2F8H A;  1TXR A;  4GM5 A;  4MCR A;  2CTC A;  1CX8 A;  5LRG A;  3EW5 A;  2O4H A;  3H8G A;  1AMP A;  1IGB A;  3EWQ A;  4NGM A;  2Q51 A;  3SJF A;  3D67 A;  4GVW A;  2PRQ A;  2AFW A;  4P45 A;  3SJE A;  3D7F A;  1LAN A;  5HVG A;  2F7V A;  2IQ6 A;  4TNU A;  2PCU A;  2QYV A;  1IY7 A;  4AXV A;  4TU0 A;  4MXU A;  5K8P A;  2V8D A;  4LQG A;  3MN8 A;  4MRI A;  3IEH A;  5F09 A;  3PB4 X;  2WYR A;  4W9Y A;  2PJ2 A;  4P4I A;  3GPO A;  2ZEN A;  3PB7 X;  1XBU A;  3TX8 A;  1BLL E;  4UIB A;  4J4Z A;  2OOT A;  5JM6 A;  3V7Z A;  4YWY A;  2PJC A;  2AFC A;  3H8E A;  4IAV A;  3EKE A;  3WC7 A;  4MCP A;  5FSY A;  3H8F A;  3KR4 A;  5D8N A;  3QNV A;  1VHE A;  2XEG A;  4FBE A;  2VRI A;  4IHM A;  1VGY A;  3IIF A;  2PJ0 A;  3S9N A;  4NGT A;  3SJG A;  1ARL A;  1YW4 A;  1Z2L A;  8CPA A;  5HOL A;  1XRY A;  3SIH A;  2DX6 A;  5IB9 A;  3PBB A;  1CPX A;  2FXK A;  1CP7 A;  2OR4 A;  3FJU A;  2IMO A;  2AFU A;  4MMO A;  3WC6 A;  3CPA A;  1FT7 A;  2ZOF A;  1YD9 A;  2WZN A;  4JZ0 A;  5HIH A;  3ISZ A;  4P4D A;  5LRJ A;  4NGR A;  3FED A;  3D7H A;  4ESS A;  1ZLH A;  5LYF A;  4B6Z A;  5HVH A;  4UML A;  2X47 A;  2EEE A;  4A39 A;  2Q4Z A;  3N5F A;  3NH4 A;  5THW A;  1LAP A;  2V77 A;  4RUH A;  2PJ8 A;  3GB0 A;  4IQY A;  3GUX A;  5DS0 A;  1F2P A;  4UEE A;  4A37 A;  4F8Z A;  3K2K A;  5JGF A;  3ISX A;  4P6Y A;  2XD7 A;  3NFZ A;  3WT4 A;  2PIY A;  1TY8 A;  2NYQ A;  3NH8 A;  4F9U A;  2RB7 A;  3VFQ A;  4NJQ A;  1TKJ A;  1XJO A;  3KR5 A;  3WAB A;  4NGP A;  3KZW A;  4ABK A;  5FSX A;  3KHX A;  1M4L A;  1ZG9 A;  4BD9 A;  5LYL A;  3KL9 A;  3IJ3 A;  4R6T A;  3FVL A;  1ZLI A;  1Y0R A;  2FG1 A;  3I1U A;  3RAM A;  3FMC A;  3ETI A;  5ELY A;  4OC1 A;  4EME A;  1SPV A;  2ZEL A;  3GQO A;  1LCP A;  1H8L A;  3FEC A;  2V8G A;  4OC3 A;  4FAI A;  1LAM A;  3L2N A;  3BI1 A;  3B3V A;  3K9T A;  4MHP A;  4NGN A;  2DEA A;  3CPX A;  3GQE A;  3CDX A;  4UF4 A;  2GRE A;  4X8I A;  3SJX A;  4O23 A;  2PIZ A;  4DJL A;  2C6P A;  3KAS A;  1BPM A;  4FWU A;  1VIX A;  2HB6 A;  2BCO A;  1NSA A;  1ZG8 A;  4MHZ A;  4ONW A;  4PQA A;  3TC8 A;  4X3R A;  3PB9 X;  5E3B A;  4P4J A;  4KSI A;  5CPA A;  2RFH A;  1ZG7 A;  4A94 A;  1YSJ A;  4A38 A;  3D7G A;  2ZEE A;  1HEE A;  1AYE A;  1TKF A;  1R3N A;  3GLJ A;  2PJ5 A;  3SIG A;  4Z65 A;  2ACF A;  1TF9 A;  3T8W A;  1PYT B;  3SIJ A;  1Y7E A;  3VAR A;  4OC4 A;  1YME A;  2ZEF A;  4UEF A;  1HJZ A;  2BO9 A;  1UWY A;  4PXC A;  4IK2 A;  2FVG A;  2AFX A;  4NGQ A;  1HDQ A;  1ARM A;  1CBX A;  3IC1 A;  3KI9 A;  1FNO A;  3PB8 X;  1ELL P;  5CB3 A;  2PJ7 A;  3DLJ A;  5LRK A;  2FAV A;  3Q6Z A;  1JQG A;  3B3W A;  4OKO A;  4OC5 A;  7CPA A;  5CB5 A;  4D86 A;  1R43 A;  3IFE A;  2PJ1 A;  4OC0 A;  3FX6 A;  2AFZ A;  2EK9 A;  2PE3 A;  6CPA A;  1Z5R A;  2BFR A;  5CBM A;  1EE3 P;  2Q43 A;  2PVW A;  4PPZ A;  1CPS A;  3D66 A;  2VL1 A;  4NGS A;  3B35 A;  5K8N A;  3SI2 A;  2ZEH A;  2IJZ A;  5HVF A;  5LYD A;  4OME A;  1VHU A;  1DTD A;  2PVV A;  4PXE A;  2LGR A;  3LMS A;  2PJ4 A;  2ZEM A;  3MRU A;  3SII A;  4K3N A;  2GU2 A;  4P4E A;  1XMB A;  2I3C A;  3PRT A;  3V38 A;  4NFR A;  3BI0 A;  2XEJ A;  2C6C A;  4P4F A;  3KGQ A;  1PCA A;  2V8H A;  3PB6 X;  3FH4 A;  2ABZ A;  3D7D A;  2BOA A;  1GYT A;  3D68 A;  4CPA A;  3PFE A;  4J5S A;  3EWP A;  3D4U A;  2CTB A;  3B7I A;  2EWB A;  1Y0Y A;  2V8V A;  4K0C A;  3EWO A;  5I4M A;  4GUA A;  4JVV A;  4ZYQ A;  2ANP A;  5JH9 A;  4ETJ A;  2CF4 A;  3BXM A;  1ZR5 A;  1OBR A;  4MCQ A;  5AIL A;  3HLP A;  5FSU A;  4J5Q A;  4ZY2 A;  2BFQ A;  2C6G A;  2QVP A;  4ABL A;  2AFM A;  4P10 A;  2PJ6 A;  4UEZ A;  1RTQ A;  2ZEP A;  3KHZ A;  4ZY0 A;  1Q7L A;  4EWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...