3KQZA

Structure of a protease 2
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqzA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqzA02
4PXEA 4FAIA 4J5QA 1DTDA 4EFDA 5CB3A 3D7HA 3EJFA 4JZ0A 3KR4A 3B3TA 3GQEA 2ABZA 2G9DA 2XEGA 3D7DA 2AFWA 4R76A 4UF4A 5JGFA 2PE3A 4P45A 3CT9A 2AFCA 2PVVA 3FVLA 5FSUA 3GB0A 3EKEA 4TWEA 2OOTA 3VH9A 1YD9A 3EJGA 3B3VA 2CTCA 5DUSA 1ZG7A 3GPOA 1VHOA 4JCAA 2BO9A 4A37A 2JEWA 3H8FA 2ZEMA 3D4UA 3MRUA 5D29A 4ZX8A 1NJRA 5JH9A 3B3WA 3T8WA 2V8GA 2EWBA 4G1PA 2QVPA 4IK2A 1QMUA 5JM6A 2V8HA 4NGTA 4P6YA 3NH5A 1KWMA 1TKJA 2PVWA 1ZG9A 1ZR5A 3QNVA 4X3RA 1IGBA 2PJ2A 3SIGA 3JZTA 4MRIA 2ZEEA 3SJGA 3KHXA 4W9YA 3B7IA 5LYLA 3SJXA 1M4LA 4J4ZA 3GPQA 4P10A 2PJ7A 4OC2A 4IHMA 4TNUA 1JQGA 5HOLA 2C1CA 2ZOFA 4ABLA 3HLPA 3EWPA 3D68A 2AFMA 2EEEA 3FECA 3PBEA 2AFXA 2RB7A 2PIYA 4FBEA 4AXVA 2V8DA 2GREA 1ZR3A 3IIDA 4EWTA 6CPAA 2I3CA 3B2YA 3IC1A 3L2NA 1XJOA 4KSIA 4FWUA 1VHEA 2AFUA 2NSMA 5DS0A 3GPGA 5LYIA 2XEIA 4OC4A 1Z8LA 2PJAA 1XMBA 4OKOA 1Z2LA 2ZEPA 5FSYA 3DGVA 4P4EA 3KR5A 3KL9A 4PXCA 4ZYQA 2GU2A 4GM5A 4NJRA 1YSJA 3IO1A 4R7MA 1BPMA 3D67A 3NA6A 1CBXA 2L8RA 1CPSA 1HDQA 5LYFA 1LCPA 1R43A 3WABA 2ZEHA 4KYBA 3BI1A 4JYWA 3B3SA 2ZEGA 4CPAA 4R6TA 3SJFA 4PXBA 4MHYA 1Y0YA 4NGQA 1HEEA 2PJ4A 3CPXA 4DUKA 3JRUA 4ZY0A 5F09A 2PJCA 3KQZA 1PCAA 3FH4A 3PB7X 1F2OA 1CG2A 1RTQA 4A39A 3I1UA 4TU0A 4UMLA 1TXZA 1LANA 3PBBA 2AFOA 3K9TA 3CPAA 2LGRA 3WC6A 1BLLE 3FX6A 2XD7A 2NYQA 2WZNA 2F7VA 2FAVA 1YLOA 4BD9A 3IFEA 5HVFA 2OR4A 1TF9A 2RFHA 2ANPA 4NGNA 3LMSA 4O23A 1LOKA 3WT4A 5K8PA 2ACFA 4OIWA 2V8VA 2ZEDA 5LRJA 2WYRA 3IWWA 4YU9A 1ELLP 3RAMA 5E3BA 1F57A 1YW6A 4PPZA 2C6GA 4ZX9A 5CBMA 5CMSA 4MHZA 3KZWA 3IIFA 3GUXA 3HUVA 3KASA 5LRGA 3VARA 3H8EA 5AILA 5CB5A 4ABKA 2CF4A 3V38A 5D8NA 2PJ6A 1GYTA 5HXDA 4MXUA 2ZENA 1Z5RA 2HB6A 5THWA 1HJZA 4GUAA 4H2KA 5K8NA 4P4JA 4P4BA 3CDXA 4OIDA 3H8GA 4K0CA 4NGPA 1ZG8A 4UIBA 2BFRA 1CP6A 1BPNA 1LAPA 4ZY2A 4J5RA 1VHUA 3FF3A 4Z65A 4JVVA 5K8MA 4P4FA 4J5SA 4LQGA 2EK8A 2Q51A 5LYDA 4OP4A 4IAVA 8CPAA 1TKFA 3S9LA 3EW5A 4OC3A 1TY8A 4F9VA 3KI9A 5IB9A 1HDUA 1UWYA 3GQOA 2GLFA 4R8FA 1CX8A 1ARMA 3FMCA 3D66A 4ZY1A 1ZLIA 3NH4A 4JLLA 2POKA 3ISXA 4D86A 1PYTB 4ETJA 4UEFA 3B3CA 4OC0A 4X8IA 3TC8A 3SIIA 2O4HA 4MHPA 3KQXA 1VGYA 4DYOA 3ETIA 2ZELA 4OMEA 3V7ZA 3PB6X 3MN8A 4JGKA 1ELMP 7CPAA 1XBUA 4B6ZA 3RBUA 4X2TA 1QQ9A 2JBJA 5K8OA 2ZEOA 3WC7A 4NGRA 1AYEA 2FXKA 3TX8A 5J1QA 3V45A 3PFOA 2C6PA 3FEDA 1ZLHA 1TXRA 1ARLA 2IMOA 1YMEA 5HVHA 4EMEA 5CPAA 4WWVA 2PJ8A 3KHZA 2CTBA 2IJZA 2V77A 3S9NA 2HC9A 1SPVA 2PJ0A 2PRQA 1TF8A 2EK9A 3PFEA 3IEHA 2X47A 2PJ3A 3PB9X 4PXDA 3Q71A 4MCSA 4MCQA 4RUHA 2PJ1A 3D7GA 2IQ6A 4NJQA 3D7FA 4IQYA 3S9MA 2AFZA 2ZOGA 3VFQA 4A94A 3SJEA 2Q43A 3GLJA 2QYVA 3VATA 3LWUA 1TKHA 4NGSA 2PIZA 2XEFA 5FSVA 2QJ8A 5ELYA 2CIJA 3SI0A 2FG1A 1LAMA 4NFRA 3NFZA 1R3NA 4YWYA 3SI2A 1Y7EA 2O53A 1Y0RA 4F9UA 3SIJA 3N5FA 1VIXA 4MCRA 5HIHA 3PEIA 1XRYA 4MHNA 3BHXA 5I4MA 3EWRA 2PJ9A 1CPXA 4WJBA 1XFOA 2C6CA 3PRTA 3B35A 4P4IA 1H8LA 3BI0A 3SI1A 2BCOA 3SIHA 4ZI6A 3PB8X 2DX6A 5FSZA 1OBRA 2BOAA 3Q6ZA 4UIAA 4PQAA 1DE4C 3NH8A 4OC5A 2J9AA 5HVGA 1YW4A 4F8ZA 3DLJA 3FJUA 2VL1A 3PB4X 4Q7AA 3FEEA 4P4DA 4UEZA 4K3NA 4ESSA 1Q7LA 4A38A 1EE3P 2PJ5A 3BXMA 2BFQA 3ISZA 4UEEA 2XEJA 3IIBA 3IJ3A 1BAVA 1IY7A 4NGMA 2FVGA 4ONWA 4ETKA 3WC5A 1NSAA 4GVWA 3RZAA 4FUUA 2VRIA 2PJBA 3EWQA 2JBKA 4DJLA 2PCUA 1FNOA 1CP7A 2ZEFA 1F2PA 3KGQA 2GLJA 4MCPA 1LFWA 2DEAA 5LRKA 1FT7A 3K2KA 2AFSA 1AMPA 3EWOA 4OC1A 4GVVA 2Q4ZA 3V2BA 2F8HA 4P44A 4MMOA 5FSXA
chains in the Genus database with same CATH superfamily
2R98A 4PXEA 4C68A 4J5QA 4FAIA 4Q38A 1DTDA 4EFDA 5CB3A 4IF5A 4CYNA 3D7HA 3EJFA 1KUVA 3GIUA 4JXQA 4JZ0A 5F47A 3TOBA 4F0YA 3KR4A 3B3TA 1RXTA 3GQEA 2ABZA 1IICA 1NSLA 3H4QA 2G9DA 2P6FA 4OLLA 2XEGA 2ZW7A 3D7DA 4UBRA 3RYOA 2AFWA 4KS9A 4C2ZA 2DPTA 1Z4RA 4R76A 2YNCA 4UF4A 2WPWA 5JGFA 2PE3A 2FXFA 2ARHA 1IU8A 3BJ8A 3CT9A 4LUAA 1IIDA 2AFCA 2PVVA 2F5IA 3FVLA 4C2YA 5FSUA 1S7KA 3GB0A 3QAYA 4XPDC 3EKEA 2PR1A 4TWEA 5HMNA 2OOTA 4NCZA 3TT2A 3EFAA 3IWEA 3LD2A 1YD9A 3VH9A 3BLNA 3EJGA 4UFXA 3S6FA 3B3VA 2CTCA 5DUSA 3JTKA 1ZG7A 3GPOA 4B11A 1VHOA 4JCAA 1XIXA 2BO9A 3GKRA 4A37A 1ON0A 2J8MA 2JEWA 3JUWA 2CY2A 3G3SA 3H8FA 2ZEMA 3D4UA 1MK4A 3MRUA 5D29A 3FRMA 1RO5A 1L0CA 4ZX8A 2OB0A 1NJRA 1U6MA 1Z9UA 2P0WA 3T8WA 2Q04A 2OZGA 2V8GA 2Z3LA 3B3WA 1QSMA 3T9YA 2EWBA 1P0HA 2PRBA 2X7BA 3P2FA 2QVPA 3GYAA 4G1PA 4IK2A 3R1KA 1QMUA 4MFPA 5JM6A 2V8HA 5AG7A 3GY9A 4NGTA 4GXHA 4P6YA 3NH5A 1KWMA 2B4BA 1TKJA 2PVWA 4HNXB 1ZG9A 3IWGA 1Q2DA 1ZR5A 1XOVA 5E96A 3QNVA 4X3RA 1IGBA 2PJ2A 3SIGA 4ONUA 3JZTA 3FBUA 4MRIA 2ZEEA 3SJGA 4CAEA 3KHXA 4W9YA 3B7IA 5JPHA 5LYLA 3SJXA 3R9GA 1M4LA 3FNCA 4J4ZA 3GPQA 1WWZA 2B4DB 2PJ7A 2ZXVA 4OC2A 4P10A 4IHMA 2QIRA 2PSWA 4LQ6A 1JQGA 4PSWA 5HOLA 4TNUA 4XNHB 2C1CA 1N71A 2ZOFA 4KOVA 1B87A 4ABLA 2B3VA 3HLPA 4C7IA 3EWPA 3D68A 4H6ZA 1TIQA 3EO4A 5F49A 2AFMA 4MJ8A 4UCMA 2EEEA 1Y9KA 3FECA 3PBEA 4JLYA 4R9MA 2AFXA 2RB7A 2D4OA 2PIYA 3TCVA 4FBEA 2DXQA 4UCPA 4AXVA 2V8DA 1B6BA 2GREA 3F5BA 3E0KA 3V8IA 2J8NA 1ZR3A 3IIDA 4B13A 4EWTA 6CPAA 3TO9A 1BOBA 4PK2A 2I3CA 3B2YA 3IC1A 2Z0ZA 3L2NA 1XJOA 4IUSA 4KSIA 1V0CA 2I00A 4C7HA 4FWUA 1VHEA 2AFUA 5C82A 2HV2A 2NSMA 5DS0A 2NMTA 3GPGA 5LYIA 4KOUA 2Q0YA 2Z10A 2XEIA 4U5YA 4OC4A 4MBUA 1Z8LA 2W2GA 1XMBA 2PJAA 4OKOA 2HUZA 2ZW5A 3DR6A 1Z2LA 2ZEPA 5IV0A 5BWAB 5FSYA 5A28A 2G0BA 3DGVA 3NE7A 1YGHA 1YLEA 4KORA 4P4EA 2P6GA 2ZW4A 5F46A 4UCNA 3KR5A 3KL9A 4AVBA 4PXCA 4ZYQA 2GU2A 2YNDA 3S6GA 4GM5A 2B3UA 1YX0A 4XNHC 4NJRA 1YSJA 3IO1A 4PV6A 4R7MA 1BPMA 3CXSA 3D67A 4CRYB 1KZFA 3NA6A 4UFWA 1CBXA 4KVOE 2L8RA 4B10A 1CPSA 1HDQA 5H86A 5LYFA 1YREA 1LCPA 1R43A 3WABA 2ZEHA 4OAEA 2DF5A 2R8VA 4KYBA 4CAVA 3BI1A 2VBQA 4YRHA 4JYWA 4UIAA 3B3SA 2P6EA 2FIAA 2ZEGA 4AG7A 4CPAA 4R6TA 3SJFA 4PXBA 4MHYA 1M1DA 4A95A 1S7FA 1Y0YA 1HEEA 4NGQA 4B5OA 2GIVA 4XPKA 2HQYA 2PJ4A 3CPXA 4DUKA 4M6HA 3JRUA 4ZY0A 3N7ZA 5F09A 5G1ZA 2PJCA 3KQZA 1GHEA 1PCAA 3EC4A 4NEXA 4R87A 3W6XA 4F0XA 1ZO0A 3FH4A 3PB7X 3SXNA 1F2OA 1CG2A 1RTQA 1S5KA 1XF8A 4A39A 3I1UA 4JJXA 4A30A 3CXQA 4TU0A 2OH1A 5FVJA 1JWQA 1S3ZA 4UMLA 2Q4VA 1TXZA 1LANA 3PBBA 4K30A 4YFJA 5KTAA 2AFOA 3K9TA 2FIWA 1KUXA 2OZHA 3CPAA 2LGRA 2B58A 2Z3KA 3FXTA 2I79A 3WC6A 1BLLE 3FX6A 2XD7A 3B8GA 2NYQA 4YGOA 2BEIA 3RNZA 2WZNA 4AB7A 1Z8XA 2F7VA 1OZPA 1CM0A 2FAVA 1YLOA 2Q4ZA 4R3KA 4BD9A 3IFEA 4XPLA 5HVFA 4CAFA 1LRZA 1S7NA 5KTDA 4CGLA 4KUBA 2OR4A 1TF9A 1M4DA 3LACA 2RFHA 4E8OA 2ANPA 3VWEA 4AVCA 4NGNA 1Q2CA 3LMSA 2GANA 5JH9A 4O23A 1LOKA 3WT4A 1CJWA 1R57A 5K8PA 2GE3A 2ACFA 3F8KA 4JD6A 4OIWA 4A2ZA 2V8VA 2ZEDA 5LRJA 1XMTA 3D8PA 2ZW6A 5EBVA 4GS4A 1Q2YA 2WUUA 2O28A 2WYRA 3IWWA 4YU9A 1ELLP 3RAMA 1MJBA 5E3BA 1S7LA 1F57A 2A4NA 2EUIA 1YW6A 4B5PA 4QB9A 4BINA 2PQ8A 4PPZA 4CS0B 2C6GA 4ZX9A 1K4JA 4UA3A 2JZDA 5CBMA 5CMSA 2CXAA 4MHZA 4NXYA 2PC1A 3KZWA 3IIFA 1QSRA 3GUXA 1SQHA 4BBHA 3HUVA 4B5PB 3T90A 3KASA 3TE4A 5LRGA 3VARA 3TFYA 3H8EA 4KZTA 4ORFA 5AILA 3FIXA 3R95A 4E2AA 5CB5A 4ABKA 1AUGA 2CF4A 3V38A 5D8NA 2PJ6A 1GYTA 3VWDA 4PSXA 5HXDA 4MXUA 2Z3NA 5JQ4A 4AG9A 2ZENA 2EBJA 1Z5RA 5H84A 2HB6A 5THWA 1HJZA 2WSAA 4GUAA 1UFHA 4H2KA 2Q44A 5K8NA 4P4JA 2C27A 4P4BA 3CDXA 4OIDA 1QSTA 5HH1A 3R9EA 2ATRA 1IYLA 3H8GA 4CGOA 4K0CA 1QSOA 1ZG8A 2EVNA 4NGPA 4UIBA 4AVAA 2BFRA 3MGDA 1CP6A 1BPNA 4M6GA 1LAPA 4PK3A 4ZY2A 5AG4A 4J5RA 2BUEA 1YK3A 1VHUA 4Y49B 4H89A 4HPSA 2Y0MA 3FF3A 4Z65A 5AGEA 4JVVA 4JXRA 5K8MA 4P4FA 4J5SA 1IOFA 2EK8A 2Q51A 4M3SA 4LQGA 5LYDA 2WCTA 4OP4A 4IAVA 5G21A 8CPAA 2FE7A 2Q7BA 1TKFA 3S9LA 1PUAA 4QC6A 2YGWA 3EW5A 4OC3A 1TY8A 4F9VA 2EO8A 4MFKA 3KI9A 4EVYA 5IB9A 1A2ZA 1HDUA 1UWYA 3GQOA 1WK4A 2GLFA 2QMLA 1M4IA 2Q4YA 4R8FA 1CX8A 1ARMA 2RNKA 2AJ6A 2OZUA 3I9SA 2FSRA 3FMCA 3OWCA 3D66A 4ZY1A 1ZLIA 3NH4A 4JLLA 3BJ7A 2POKA 3ISXA 4D86A 1PYTB 1M44A 4ETJA 4UEFA 4CAXA 3QB8A 3B3CA 4OC0A 4XPDB 2Z3OA 2DPSA 4QUSA 4X8IA 3TC8A 1I1DA 3SIIA 2RC4A 5I0CA 2O4HA 4A33A 4MHPA 4E0AA 2JDDA 3KQXA 1VGYA 5IX3A 4DYOA 3ETIA 2ZELA 4OMEA 3V7ZA 4HNWB 3KKWA 3PB6X 3MN8A 4JGKA 1ELMP 7CPAA 1XBUA 2K5TA 4B6ZA 3RBUA 4C2XA 5GCNA 4X2TA 4MHDA 1QQ9A 4MY3A 2JBJA 5A27A 2ODFA 5K8OA 2ZEOA 3WC7A 4NGRA 4CGNA 1AYEA 4FD5A 5EC4A 2FXKA 3TO7A 5EMIA 3TX8A 5J1QA 3V45A 3PFOA 4KSFA 4A32A 2B5GA 2JEVA 2C6PA 5J8FA 4L8AA 3FEDA 3NE8A 1ZLHA 1TXRA 2VQYA 2CNMA 4A31A 1ARLA 2IMOA 2YNEA 1YMEA 2CNSA 5HVHA 4EMEA 5CPAA 4WWVA 2PJ8A 3KHZA 1IB1E 2CTBA 4B12A 3TO6A 3K9UA 1IOIA 2IJZA 2B5GB 2HC9A 2PDOA 2V77A 3IU1A 1SPVA 2PJ0A 2VEZA 5DWMA 3SHPA 2PRQA 1TF8A 2CNTA 4H6UA 2EK9A 3PP9A 3PFEA 4II9A 3IEHA 2X47A 2PJ3A 3PB9X 2REEA 4PXDA 2VXKA 3Q71A 2WPXA 1QSNA 3ZZIA 4MCSA 4MCQA 3S6KA 4RUHA 2PJ1A 3D7GA 5CNPA 2JDCA 5G20A 4KVXA 2IQ6A 2FT0A 4NJQA 3D7FA 4IQYA 4CAWA 2BL1A 4KOYA 3S9MA 1YVKA 2AFZA 3VFQA 1BO4A 2QECA 2ZOGA 4P45A 4Q36A 4A94A 3SJEA 4QVTA 2Q43A 2G3TA 3GLJA 4RS2A 3ZJ0A 3R96A 4JWPA 2QYVA 4M85A 3VATA 1Y9WA 3LWUA 2VZZA 1TKHA 1FY7A 3EXNA 3FB3A 4NGSA 2PIZA 4KLWA 2XEFA 3F0AA 2VI7A 1VKCA 5FSVA 4CYQA 4NF1A 3DDDA 2QJ8A 4RN7A 3DSBA 5ELYA 1J4JA 1MJ9A 2CIJA 3PGPA 3SI0A 1M4GA 1MJAA 2FG1A 1YR0A 1LAMA 3S6HA 4NFRA 5IB0A 3NFZA 3D2PA 3WR7A 4R57A 1R3NA 1P4NA 2Q7SA 2Z11A 4YWYA 2B4DA 1IYKA 4M6IA 1PU9A 3FYNA 4J3GA 3SI2A 1Y7EA 3R9FA 2O53A 2YNCC 2Z3MA 4KLVA 1I12A 1Y0RA 4F9UA 4UFVA 2VZYA 3SIJA 2GFQA 5ISVA 4L89A 3N5FA 1VIXA 1Z8TA 3PZJA 4FD7A 2JZFA 4U9ZA 3IU2A 4LX9A 4MCRA 1I21A 4DNCA 3JVNA 2H5MA 4UWIA 5HIHA 3PEIA 1XRYA 4KSAA 4F6AA 4MHNA 4NSQA 4ZBGA 3RO0A 2D4PA 1YQEA 3G8WA 3BHXA 4X5KA 5F48A 4BMHA 5I4MA 3EWRA 2PJ9A 1CPXA 2KCWA 2Z3PA 4CYPA 4WJBA 4RI1A 1XFOA 2C6CA 3H5ZA 3PRTA 4KOSA 3B35A 4P4IA 1H8LA 2FCKA 3BI0A 2BCOA 2AE6A 3SI1A 4B14A 3SIHA 2JLMA 4HKFA 3D3SA 3S9NA 4ZI6A 4CYOA 3TOAA 3C26A 3PB8X 2DX6A 5FSZA 1OBRA 2BOAA 3Q6ZA 1X10A 3DNSA 3CXPA 3P2HA 4PQAA 1DE4C 1Y7RA 4MY0A 3NH8A 4OC5A 5C88A 2JZEA 3UY5A 1X12A 2J8RA 4MFQA 1VHSA 2J9AA 3DR8A 4HNYB 4CRZB 5HVGA 3W6SA 4CGPA 3CZXA 3D2MA 1YW4A 2FL4A 2R1IA 4F8ZA 4KVME 2R7HA 3DLJA 3FJUA 1NE9A 2VL1A 4UWJA 1KUYA 1YVOA 3PB4X 4MFJA 2OU2A 4Q7AA 3FEEA 4FD6A 4I49A 4K3NA 4P4DA 4ESSA 1Q7LA 4U9YA 4UEZA 3SXOA 4A38A 1EE3P 2BSWA 2PJ5A 1Z4EA 3BXMA 2BFQA 3IGRA 3QAHA 3ISZA 1NMTA 2XEJA 2ZPAA 3IIBA 4UEEA 5KTCA 3I3GA 3IJ3A 2KQVA 1BAVA 1IY7A 4KOTA 4NGMA 5AG6A 2FVGA 4QBJA 2IL4A 3LODA 4ETKA 4KUAA 4ONWA 4R3LA 3WC5A 3EY5A 1NSAA 4GVWA 3TTHA 5G22A 1S60A 4FUUA 3RZAA 4ZGYB 2PR8A 4OADA 2VRIA 2PJBA 3EWQA 2G3AA 2JBKA 4DJLA 2PCUA 1FNOA 4MFZA 4CGMA 1CP7A 2ZEFA 4MFLA 1F2PA 2REFA 4KOWA 3KGQA 3A9LA 4Y49C 5DWNA 1Z8WA 2FS5A 1XE4A 2GLJA 4MCPA 1LFWA 2DEAA 5J8CA 4FD4A 5LRKA 4KOXA 1FT7A 3K2KA 2AFSA 1AMPA 4MI4A 3W91A 3EWOA 4OC1A 5AG5A 4GVVA 1XEBA 3V2BA 2F8HA 4P44A 4MMOA 5FSXA
chains in the Genus database with same CATH topology
4PXEA 4FAIA 4J5QA 1DTDA 4EFDA 5CB3A 3D7HA 3EJFA 4JZ0A 3KR4A 3B3TA 3GQEA 2ABZA 2G9DA 2XEGA 3D7DA 2AFWA 4R76A 4UF4A 5JGFA 2PE3A 4P45A 3CT9A 2AFCA 2PVVA 3FVLA 5FSUA 3GB0A 3EKEA 4TWEA 2OOTA 3VH9A 1YD9A 3EJGA 3B3VA 2CTCA 5DUSA 1ZG7A 3GPOA 1VHOA 4JCAA 2BO9A 4A37A 2JEWA 3H8FA 2ZEMA 3D4UA 3MRUA 5D29A 4ZX8A 1NJRA 5JH9A 3B3WA 3T8WA 2V8GA 2EWBA 4G1PA 2QVPA 4IK2A 1QMUA 5JM6A 2V8HA 4NGTA 4P6YA 3NH5A 1KWMA 1TKJA 2PVWA 1ZG9A 1ZR5A 3QNVA 4X3RA 1IGBA 2PJ2A 3SIGA 3JZTA 4MRIA 2ZEEA 3SJGA 3KHXA 4W9YA 3B7IA 5LYLA 3SJXA 1M4LA 4J4ZA 3GPQA 4P10A 2PJ7A 4OC2A 4IHMA 4TNUA 1JQGA 5HOLA 2C1CA 2ZOFA 4ABLA 3HLPA 3EWPA 3D68A 2AFMA 2EEEA 3FECA 3PBEA 2AFXA 2RB7A 2PIYA 4FBEA 4AXVA 2V8DA 2GREA 1ZR3A 3IIDA 4EWTA 6CPAA 2I3CA 3B2YA 3IC1A 3L2NA 1XJOA 4KSIA 4FWUA 1VHEA 2AFUA 2NSMA 5DS0A 3GPGA 5LYIA 2XEIA 4OC4A 1Z8LA 2PJAA 1XMBA 4OKOA 1Z2LA 2ZEPA 5FSYA 3DGVA 4P4EA 3KR5A 3KL9A 4PXCA 4ZYQA 2GU2A 4GM5A 4NJRA 1YSJA 3IO1A 4R7MA 1BPMA 3D67A 3NA6A 1CBXA 2L8RA 1CPSA 1HDQA 5LYFA 1LCPA 1R43A 3WABA 2ZEHA 4KYBA 3BI1A 4JYWA 3B3SA 2ZEGA 4CPAA 4R6TA 3SJFA 4PXBA 4MHYA 1Y0YA 4NGQA 1HEEA 2PJ4A 3CPXA 4DUKA 3JRUA 4ZY0A 5F09A 2PJCA 3KQZA 1PCAA 3FH4A 3PB7X 1F2OA 1CG2A 1RTQA 4A39A 3I1UA 4TU0A 4UMLA 1TXZA 1LANA 3PBBA 2AFOA 3K9TA 3CPAA 2LGRA 3WC6A 1BLLE 3FX6A 2XD7A 2NYQA 2WZNA 2F7VA 2FAVA 1YLOA 4BD9A 3IFEA 5HVFA 2OR4A 1TF9A 2RFHA 2ANPA 4NGNA 3LMSA 4O23A 1LOKA 3WT4A 5K8PA 2ACFA 4OIWA 2V8VA 2ZEDA 5LRJA 2WYRA 3IWWA 4YU9A 1ELLP 3RAMA 5E3BA 1F57A 1YW6A 4PPZA 2C6GA 4ZX9A 5CBMA 5CMSA 4MHZA 3KZWA 3IIFA 3GUXA 3HUVA 3KASA 5LRGA 3VARA 3H8EA 5AILA 5CB5A 4ABKA 2CF4A 3V38A 5D8NA 2PJ6A 1GYTA 5HXDA 4MXUA 2ZENA 1Z5RA 2HB6A 5THWA 1HJZA 4GUAA 4H2KA 5K8NA 4P4JA 4P4BA 3CDXA 4OIDA 3H8GA 4K0CA 4NGPA 1ZG8A 4UIBA 2BFRA 1CP6A 1BPNA 1LAPA 4ZY2A 4J5RA 1VHUA 3FF3A 4Z65A 4JVVA 5K8MA 4P4FA 4J5SA 4LQGA 2EK8A 2Q51A 5LYDA 4OP4A 4IAVA 8CPAA 1TKFA 3S9LA 3EW5A 4OC3A 1TY8A 4F9VA 3KI9A 5IB9A 1HDUA 1UWYA 3GQOA 2GLFA 4R8FA 1CX8A 1ARMA 3FMCA 3D66A 4ZY1A 1ZLIA 3NH4A 4JLLA 2POKA 3ISXA 4D86A 1PYTB 4ETJA 4UEFA 3B3CA 4OC0A 4X8IA 3TC8A 3SIIA 2O4HA 4MHPA 3KQXA 1VGYA 4DYOA 3ETIA 2ZELA 4OMEA 3V7ZA 3PB6X 3MN8A 4JGKA 1ELMP 7CPAA 1XBUA 4B6ZA 3RBUA 4X2TA 1QQ9A 2JBJA 5K8OA 2ZEOA 3WC7A 4NGRA 1AYEA 2FXKA 3TX8A 5J1QA 3V45A 3PFOA 2C6PA 3FEDA 1ZLHA 1TXRA 1ARLA 2IMOA 1YMEA 5HVHA 4EMEA 5CPAA 4WWVA 2PJ8A 3KHZA 2CTBA 2IJZA 2V77A 3S9NA 2HC9A 1SPVA 2PJ0A 2PRQA 1TF8A 2EK9A 3PFEA 3IEHA 2X47A 2PJ3A 3PB9X 4PXDA 3Q71A 4MCSA 4MCQA 4RUHA 2PJ1A 3D7GA 2IQ6A 4NJQA 3D7FA 4IQYA 3S9MA 2AFZA 2ZOGA 3VFQA 4A94A 3SJEA 2Q43A 3GLJA 2QYVA 3VATA 3LWUA 1TKHA 4NGSA 2PIZA 2XEFA 5FSVA 2QJ8A 5ELYA 2CIJA 3SI0A 2FG1A 1LAMA 4NFRA 3NFZA 1R3NA 4YWYA 3SI2A 1Y7EA 2O53A 1Y0RA 4F9UA 3SIJA 3N5FA 1VIXA 4MCRA 5HIHA 3PEIA 1XRYA 4MHNA 3BHXA 5I4MA 3EWRA 2PJ9A 1CPXA 4WJBA 1XFOA 2C6CA 3PRTA 3B35A 4P4IA 1H8LA 3BI0A 3SI1A 2BCOA 3SIHA 4ZI6A 3PB8X 2DX6A 5FSZA 1OBRA 2BOAA 3Q6ZA 4UIAA 4PQAA 1DE4C 3NH8A 4OC5A 2J9AA 5HVGA 1YW4A 4F8ZA 3DLJA 3FJUA 2VL1A 3PB4X 4Q7AA 3FEEA 4P4DA 4UEZA 4K3NA 4ESSA 1Q7LA 4A38A 1EE3P 2PJ5A 3BXMA 2BFQA 3ISZA 4UEEA 2XEJA 3IIBA 3IJ3A 1BAVA 1IY7A 4NGMA 2FVGA 4ONWA 4ETKA 3WC5A 1NSAA 4GVWA 3RZAA 4FUUA 2VRIA 2PJBA 3EWQA 2JBKA 4DJLA 2PCUA 1FNOA 1CP7A 2ZEFA 1F2PA 3KGQA 2GLJA 4MCPA 1LFWA 2DEAA 5LRKA 1FT7A 3K2KA 2AFSA 1AMPA 3EWOA 4OC1A 4GVVA 2Q4ZA 3V2BA 2F8HA 4P44A 4MMOA 5FSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXE A;  4FAI A;  4J5Q A;  1DTD A;  4EFD A;  5CB3 A;  3D7H A;  3EJF A;  4JZ0 A;  3KR4 A;  3B3T A;  3GQE A;  2ABZ A;  2G9D A;  2XEG A;  3D7D A;  2AFW A;  4R76 A;  4UF4 A;  5JGF A;  2PE3 A;  4P45 A;  3CT9 A;  2AFC A;  2PVV A;  3FVL A;  5FSU A;  3GB0 A;  3EKE A;  4TWE A;  2OOT A;  3VH9 A;  1YD9 A;  3EJG A;  3B3V A;  2CTC A;  5DUS A;  1ZG7 A;  3GPO A;  1VHO A;  4JCA A;  2BO9 A;  4A37 A;  2JEW A;  3H8F A;  2ZEM A;  3D4U A;  3MRU A;  5D29 A;  4ZX8 A;  1NJR A;  5JH9 A;  3B3W A;  3T8W A;  2V8G A;  2EWB A;  4G1P A;  2QVP A;  4IK2 A;  1QMU A;  5JM6 A;  2V8H A;  4NGT A;  4P6Y A;  3NH5 A;  1KWM A;  1TKJ A;  2PVW A;  1ZG9 A;  1ZR5 A;  3QNV A;  4X3R A;  1IGB A;  2PJ2 A;  3SIG A;  3JZT A;  4MRI A;  2ZEE A;  3SJG A;  3KHX A;  4W9Y A;  3B7I A;  5LYL A;  3SJX A;  1M4L A;  4J4Z A;  3GPQ A;  4P10 A;  2PJ7 A;  4OC2 A;  4IHM A;  4TNU A;  1JQG A;  5HOL A;  2C1C A;  2ZOF A;  4ABL A;  3HLP A;  3EWP A;  3D68 A;  2AFM A;  2EEE A;  3FEC A;  3PBE A;  2AFX A;  2RB7 A;  2PIY A;  4FBE A;  4AXV A;  2V8D A;  2GRE A;  1ZR3 A;  3IID A;  4EWT A;  6CPA A;  2I3C A;  3B2Y A;  3IC1 A;  3L2N A;  1XJO A;  4KSI A;  4FWU A;  1VHE A;  2AFU A;  2NSM A;  5DS0 A;  3GPG A;  5LYI A;  2XEI A;  4OC4 A;  1Z8L A;  2PJA A;  1XMB A;  4OKO A;  1Z2L A;  2ZEP A;  5FSY A;  3DGV A;  4P4E A;  3KR5 A;  3KL9 A;  4PXC A;  4ZYQ A;  2GU2 A;  4GM5 A;  4NJR A;  1YSJ A;  3IO1 A;  4R7M A;  1BPM A;  3D67 A;  3NA6 A;  1CBX A;  2L8R A;  1CPS A;  1HDQ A;  5LYF A;  1LCP A;  1R43 A;  3WAB A;  2ZEH A;  4KYB A;  3BI1 A;  4JYW A;  3B3S A;  2ZEG A;  4CPA A;  4R6T A;  3SJF A;  4PXB A;  4MHY A;  1Y0Y A;  4NGQ A;  1HEE A;  2PJ4 A;  3CPX A;  4DUK A;  3JRU A;  4ZY0 A;  5F09 A;  2PJC A;  3KQZ A;  1PCA A;  3FH4 A;  3PB7 X;  1F2O A;  1CG2 A;  1RTQ A;  4A39 A;  3I1U A;  4TU0 A;  4UML A;  1TXZ A;  1LAN A;  3PBB A;  2AFO A;  3K9T A;  3CPA A;  2LGR A;  3WC6 A;  1BLL E;  3FX6 A;  2XD7 A;  2NYQ A;  2WZN A;  2F7V A;  2FAV A;  1YLO A;  4BD9 A;  3IFE A;  5HVF A;  2OR4 A;  1TF9 A;  2RFH A;  2ANP A;  4NGN A;  3LMS A;  4O23 A;  1LOK A;  3WT4 A;  5K8P A;  2ACF A;  4OIW A;  2V8V A;  2ZED A;  5LRJ A;  2WYR A;  3IWW A;  4YU9 A;  1ELL P;  3RAM A;  5E3B A;  1F57 A;  1YW6 A;  4PPZ A;  2C6G A;  4ZX9 A;  5CBM A;  5CMS A;  4MHZ A;  3KZW A;  3IIF A;  3GUX A;  3HUV A;  3KAS A;  5LRG A;  3VAR A;  3H8E A;  5AIL A;  5CB5 A;  4ABK A;  2CF4 A;  3V38 A;  5D8N A;  2PJ6 A;  1GYT A;  5HXD A;  4MXU A;  2ZEN A;  1Z5R A;  2HB6 A;  5THW A;  1HJZ A;  4GUA A;  4H2K A;  5K8N A;  4P4J A;  4P4B A;  3CDX A;  4OID A;  3H8G A;  4K0C A;  4NGP A;  1ZG8 A;  4UIB A;  2BFR A;  1CP6 A;  1BPN A;  1LAP A;  4ZY2 A;  4J5R A;  1VHU A;  3FF3 A;  4Z65 A;  4JVV A;  5K8M A;  4P4F A;  4J5S A;  4LQG A;  2EK8 A;  2Q51 A;  5LYD A;  4OP4 A;  4IAV A;  8CPA A;  1TKF A;  3S9L A;  3EW5 A;  4OC3 A;  1TY8 A;  4F9V A;  3KI9 A;  5IB9 A;  1HDU A;  1UWY A;  3GQO A;  2GLF A;  4R8F A;  1CX8 A;  1ARM A;  3FMC A;  3D66 A;  4ZY1 A;  1ZLI A;  3NH4 A;  4JLL A;  2POK A;  3ISX A;  4D86 A;  1PYT B;  4ETJ A;  4UEF A;  3B3C A;  4OC0 A;  4X8I A;  3TC8 A;  3SII A;  2O4H A;  4MHP A;  3KQX A;  1VGY A;  4DYO A;  3ETI A;  2ZEL A;  4OME A;  3V7Z A;  3PB6 X;  3MN8 A;  4JGK A;  1ELM P;  7CPA A;  1XBU A;  4B6Z A;  3RBU A;  4X2T A;  1QQ9 A;  2JBJ A;  5K8O A;  2ZEO A;  3WC7 A;  4NGR A;  1AYE A;  2FXK A;  3TX8 A;  5J1Q A;  3V45 A;  3PFO A;  2C6P A;  3FED A;  1ZLH A;  1TXR A;  1ARL A;  2IMO A;  1YME A;  5HVH A;  4EME A;  5CPA A;  4WWV A;  2PJ8 A;  3KHZ A;  2CTB A;  2IJZ A;  2V77 A;  3S9N A;  2HC9 A;  1SPV A;  2PJ0 A;  2PRQ A;  1TF8 A;  2EK9 A;  3PFE A;  3IEH A;  2X47 A;  2PJ3 A;  3PB9 X;  4PXD A;  3Q71 A;  4MCS A;  4MCQ A;  4RUH A;  2PJ1 A;  3D7G A;  2IQ6 A;  4NJQ A;  3D7F A;  4IQY A;  3S9M A;  2AFZ A;  2ZOG A;  3VFQ A;  4A94 A;  3SJE A;  2Q43 A;  3GLJ A;  2QYV A;  3VAT A;  3LWU A;  1TKH A;  4NGS A;  2PIZ A;  2XEF A;  5FSV A;  2QJ8 A;  5ELY A;  2CIJ A;  3SI0 A;  2FG1 A;  1LAM A;  4NFR A;  3NFZ A;  1R3N A;  4YWY A;  3SI2 A;  1Y7E A;  2O53 A;  1Y0R A;  4F9U A;  3SIJ A;  3N5F A;  1VIX A;  4MCR A;  5HIH A;  3PEI A;  1XRY A;  4MHN A;  3BHX A;  5I4M A;  3EWR A;  2PJ9 A;  1CPX A;  4WJB A;  1XFO A;  2C6C A;  3PRT A;  3B35 A;  4P4I A;  1H8L A;  3BI0 A;  3SI1 A;  2BCO A;  3SIH A;  4ZI6 A;  3PB8 X;  2DX6 A;  5FSZ A;  1OBR A;  2BOA A;  3Q6Z A;  4UIA A;  4PQA A;  1DE4 C;  3NH8 A;  4OC5 A;  2J9A A;  5HVG A;  1YW4 A;  4F8Z A;  3DLJ A;  3FJU A;  2VL1 A;  3PB4 X;  4Q7A A;  3FEE A;  4P4D A;  4UEZ A;  4K3N A;  4ESS A;  1Q7L A;  4A38 A;  1EE3 P;  2PJ5 A;  3BXM A;  2BFQ A;  3ISZ A;  4UEE A;  2XEJ A;  3IIB A;  3IJ3 A;  1BAV A;  1IY7 A;  4NGM A;  2FVG A;  4ONW A;  4ETK A;  3WC5 A;  1NSA A;  4GVW A;  3RZA A;  4FUU A;  2VRI A;  2PJB A;  3EWQ A;  2JBK A;  4DJL A;  2PCU A;  1FNO A;  1CP7 A;  2ZEF A;  1F2P A;  3KGQ A;  2GLJ A;  4MCP A;  1LFW A;  2DEA A;  5LRK A;  1FT7 A;  3K2K A;  2AFS A;  1AMP A;  3EWO A;  4OC1 A;  4GVV A;  2Q4Z A;  3V2B A;  2F8H A;  4P44 A;  4MMO A;  5FSX A; 
#chains in the Genus database with same CATH topology
 2R98 A;  4PXE A;  4C68 A;  4J5Q A;  4FAI A;  4Q38 A;  1DTD A;  4EFD A;  5CB3 A;  4IF5 A;  4CYN A;  3D7H A;  3EJF A;  1KUV A;  3GIU A;  4JXQ A;  4JZ0 A;  5F47 A;  3TOB A;  4F0Y A;  3KR4 A;  3B3T A;  1RXT A;  3GQE A;  2ABZ A;  1IIC A;  1NSL A;  3H4Q A;  2G9D A;  2P6F A;  4OLL A;  2XEG A;  2ZW7 A;  3D7D A;  4UBR A;  3RYO A;  2AFW A;  4KS9 A;  4C2Z A;  2DPT A;  1Z4R A;  4R76 A;  2YNC A;  4UF4 A;  2WPW A;  5JGF A;  2PE3 A;  2FXF A;  2ARH A;  1IU8 A;  3BJ8 A;  3CT9 A;  4LUA A;  1IID A;  2AFC A;  2PVV A;  2F5I A;  3FVL A;  4C2Y A;  5FSU A;  1S7K A;  3GB0 A;  3QAY A;  4XPD C;  3EKE A;  2PR1 A;  4TWE A;  5HMN A;  2OOT A;  4NCZ A;  3TT2 A;  3EFA A;  3IWE A;  3LD2 A;  1YD9 A;  3VH9 A;  3BLN A;  3EJG A;  4UFX A;  3S6F A;  3B3V A;  2CTC A;  5DUS A;  3JTK A;  1ZG7 A;  3GPO A;  4B11 A;  1VHO A;  4JCA A;  1XIX A;  2BO9 A;  3GKR A;  4A37 A;  1ON0 A;  2J8M A;  2JEW A;  3JUW A;  2CY2 A;  3G3S A;  3H8F A;  2ZEM A;  3D4U A;  1MK4 A;  3MRU A;  5D29 A;  3FRM A;  1RO5 A;  1L0C A;  4ZX8 A;  2OB0 A;  1NJR A;  1U6M A;  1Z9U A;  2P0W A;  3T8W A;  2Q04 A;  2OZG A;  2V8G A;  2Z3L A;  3B3W A;  1QSM A;  3T9Y A;  2EWB A;  1P0H A;  2PRB A;  2X7B A;  3P2F A;  2QVP A;  3GYA A;  4G1P A;  4IK2 A;  3R1K A;  1QMU A;  4MFP A;  5JM6 A;  2V8H A;  5AG7 A;  3GY9 A;  4NGT A;  4GXH A;  4P6Y A;  3NH5 A;  1KWM A;  2B4B A;  1TKJ A;  2PVW A;  4HNX B;  1ZG9 A;  3IWG A;  1Q2D A;  1ZR5 A;  1XOV A;  5E96 A;  3QNV A;  4X3R A;  1IGB A;  2PJ2 A;  3SIG A;  4ONU A;  3JZT A;  3FBU A;  4MRI A;  2ZEE A;  3SJG A;  4CAE A;  3KHX A;  4W9Y A;  3B7I A;  5JPH A;  5LYL A;  3SJX A;  3R9G A;  1M4L A;  3FNC A;  4J4Z A;  3GPQ A;  1WWZ A;  2B4D B;  2PJ7 A;  2ZXV A;  4OC2 A;  4P10 A;  4IHM A;  2QIR A;  2PSW A;  4LQ6 A;  1JQG A;  4PSW A;  5HOL A;  4TNU A;  4XNH B;  2C1C A;  1N71 A;  2ZOF A;  4KOV A;  1B87 A;  4ABL A;  2B3V A;  3HLP A;  4C7I A;  3EWP A;  3D68 A;  4H6Z A;  1TIQ A;  3EO4 A;  5F49 A;  2AFM A;  4MJ8 A;  4UCM A;  2EEE A;  1Y9K A;  3FEC A;  3PBE A;  4JLY A;  4R9M A;  2AFX A;  2RB7 A;  2D4O A;  2PIY A;  3TCV A;  4FBE A;  2DXQ A;  4UCP A;  4AXV A;  2V8D A;  1B6B A;  2GRE A;  3F5B A;  3E0K A;  3V8I A;  2J8N A;  1ZR3 A;  3IID A;  4B13 A;  4EWT A;  6CPA A;  3TO9 A;  1BOB A;  4PK2 A;  2I3C A;  3B2Y A;  3IC1 A;  2Z0Z A;  3L2N A;  1XJO A;  4IUS A;  4KSI A;  1V0C A;  2I00 A;  4C7H A;  4FWU A;  1VHE A;  2AFU A;  5C82 A;  2HV2 A;  2NSM A;  5DS0 A;  2NMT A;  3GPG A;  5LYI A;  4KOU A;  2Q0Y A;  2Z10 A;  2XEI A;  4U5Y A;  4OC4 A;  4MBU A;  1Z8L A;  2W2G A;  1XMB A;  2PJA A;  4OKO A;  2HUZ A;  2ZW5 A;  3DR6 A;  1Z2L A;  2ZEP A;  5IV0 A;  5BWA B;  5FSY A;  5A28 A;  2G0B A;  3DGV A;  3NE7 A;  1YGH A;  1YLE A;  4KOR A;  4P4E A;  2P6G A;  2ZW4 A;  5F46 A;  4UCN A;  3KR5 A;  3KL9 A;  4AVB A;  4PXC A;  4ZYQ A;  2GU2 A;  2YND A;  3S6G A;  4GM5 A;  2B3U A;  1YX0 A;  4XNH C;  4NJR A;  1YSJ A;  3IO1 A;  4PV6 A;  4R7M A;  1BPM A;  3CXS A;  3D67 A;  4CRY B;  1KZF A;  3NA6 A;  4UFW A;  1CBX A;  4KVO E;  2L8R A;  4B10 A;  1CPS A;  1HDQ A;  5H86 A;  5LYF A;  1YRE A;  1LCP A;  1R43 A;  3WAB A;  2ZEH A;  4OAE A;  2DF5 A;  2R8V A;  4KYB A;  4CAV A;  3BI1 A;  2VBQ A;  4YRH A;  4JYW A;  4UIA A;  3B3S A;  2P6E A;  2FIA A;  2ZEG A;  4AG7 A;  4CPA A;  4R6T A;  3SJF A;  4PXB A;  4MHY A;  1M1D A;  4A95 A;  1S7F A;  1Y0Y A;  1HEE A;  4NGQ A;  4B5O A;  2GIV A;  4XPK A;  2HQY A;  2PJ4 A;  3CPX A;  4DUK A;  4M6H A;  3JRU A;  4ZY0 A;  3N7Z A;  5F09 A;  5G1Z A;  2PJC A;  3KQZ A;  1GHE A;  1PCA A;  3EC4 A;  4NEX A;  4R87 A;  3W6X A;  4F0X A;  1ZO0 A;  3FH4 A;  3PB7 X;  3SXN A;  1F2O A;  1CG2 A;  1RTQ A;  1S5K A;  1XF8 A;  4A39 A;  3I1U A;  4JJX A;  4A30 A;  3CXQ A;  4TU0 A;  2OH1 A;  5FVJ A;  1JWQ A;  1S3Z A;  4UML A;  2Q4V A;  1TXZ A;  1LAN A;  3PBB A;  4K30 A;  4YFJ A;  5KTA A;  2AFO A;  3K9T A;  2FIW A;  1KUX A;  2OZH A;  3CPA A;  2LGR A;  2B58 A;  2Z3K A;  3FXT A;  2I79 A;  3WC6 A;  1BLL E;  3FX6 A;  2XD7 A;  3B8G A;  2NYQ A;  4YGO A;  2BEI A;  3RNZ A;  2WZN A;  4AB7 A;  1Z8X A;  2F7V A;  1OZP A;  1CM0 A;  2FAV A;  1YLO A;  2Q4Z A;  4R3K A;  4BD9 A;  3IFE A;  4XPL A;  5HVF A;  4CAF A;  1LRZ A;  1S7N A;  5KTD A;  4CGL A;  4KUB A;  2OR4 A;  1TF9 A;  1M4D A;  3LAC A;  2RFH A;  4E8O A;  2ANP A;  3VWE A;  4AVC A;  4NGN A;  1Q2C A;  3LMS A;  2GAN A;  5JH9 A;  4O23 A;  1LOK A;  3WT4 A;  1CJW A;  1R57 A;  5K8P A;  2GE3 A;  2ACF A;  3F8K A;  4JD6 A;  4OIW A;  4A2Z A;  2V8V A;  2ZED A;  5LRJ A;  1XMT A;  3D8P A;  2ZW6 A;  5EBV A;  4GS4 A;  1Q2Y A;  2WUU A;  2O28 A;  2WYR A;  3IWW A;  4YU9 A;  1ELL P;  3RAM A;  1MJB A;  5E3B A;  1S7L A;  1F57 A;  2A4N A;  2EUI A;  1YW6 A;  4B5P A;  4QB9 A;  4BIN A;  2PQ8 A;  4PPZ A;  4CS0 B;  2C6G A;  4ZX9 A;  1K4J A;  4UA3 A;  2JZD A;  5CBM A;  5CMS A;  2CXA A;  4MHZ A;  4NXY A;  2PC1 A;  3KZW A;  3IIF A;  1QSR A;  3GUX A;  1SQH A;  4BBH A;  3HUV A;  4B5P B;  3T90 A;  3KAS A;  3TE4 A;  5LRG A;  3VAR A;  3TFY A;  3H8E A;  4KZT A;  4ORF A;  5AIL A;  3FIX A;  3R95 A;  4E2A A;  5CB5 A;  4ABK A;  1AUG A;  2CF4 A;  3V38 A;  5D8N A;  2PJ6 A;  1GYT A;  3VWD A;  4PSX A;  5HXD A;  4MXU A;  2Z3N A;  5JQ4 A;  4AG9 A;  2ZEN A;  2EBJ A;  1Z5R A;  5H84 A;  2HB6 A;  5THW A;  1HJZ A;  2WSA A;  4GUA A;  1UFH A;  4H2K A;  2Q44 A;  5K8N A;  4P4J A;  2C27 A;  4P4B A;  3CDX A;  4OID A;  1QST A;  5HH1 A;  3R9E A;  2ATR A;  1IYL A;  3H8G A;  4CGO A;  4K0C A;  1QSO A;  1ZG8 A;  2EVN A;  4NGP A;  4UIB A;  4AVA A;  2BFR A;  3MGD A;  1CP6 A;  1BPN A;  4M6G A;  1LAP A;  4PK3 A;  4ZY2 A;  5AG4 A;  4J5R A;  2BUE A;  1YK3 A;  1VHU A;  4Y49 B;  4H89 A;  4HPS A;  2Y0M A;  3FF3 A;  4Z65 A;  5AGE A;  4JVV A;  4JXR A;  5K8M A;  4P4F A;  4J5S A;  1IOF A;  2EK8 A;  2Q51 A;  4M3S A;  4LQG A;  5LYD A;  2WCT A;  4OP4 A;  4IAV A;  5G21 A;  8CPA A;  2FE7 A;  2Q7B A;  1TKF A;  3S9L A;  1PUA A;  4QC6 A;  2YGW A;  3EW5 A;  4OC3 A;  1TY8 A;  4F9V A;  2EO8 A;  4MFK A;  3KI9 A;  4EVY A;  5IB9 A;  1A2Z A;  1HDU A;  1UWY A;  3GQO A;  1WK4 A;  2GLF A;  2QML A;  1M4I A;  2Q4Y A;  4R8F A;  1CX8 A;  1ARM A;  2RNK A;  2AJ6 A;  2OZU A;  3I9S A;  2FSR A;  3FMC A;  3OWC A;  3D66 A;  4ZY1 A;  1ZLI A;  3NH4 A;  4JLL A;  3BJ7 A;  2POK A;  3ISX A;  4D86 A;  1PYT B;  1M44 A;  4ETJ A;  4UEF A;  4CAX A;  3QB8 A;  3B3C A;  4OC0 A;  4XPD B;  2Z3O A;  2DPS A;  4QUS A;  4X8I A;  3TC8 A;  1I1D A;  3SII A;  2RC4 A;  5I0C A;  2O4H A;  4A33 A;  4MHP A;  4E0A A;  2JDD A;  3KQX A;  1VGY A;  5IX3 A;  4DYO A;  3ETI A;  2ZEL A;  4OME A;  3V7Z A;  4HNW B;  3KKW A;  3PB6 X;  3MN8 A;  4JGK A;  1ELM P;  7CPA A;  1XBU A;  2K5T A;  4B6Z A;  3RBU A;  4C2X A;  5GCN A;  4X2T A;  4MHD A;  1QQ9 A;  4MY3 A;  2JBJ A;  5A27 A;  2ODF A;  5K8O A;  2ZEO A;  3WC7 A;  4NGR A;  4CGN A;  1AYE A;  4FD5 A;  5EC4 A;  2FXK A;  3TO7 A;  5EMI A;  3TX8 A;  5J1Q A;  3V45 A;  3PFO A;  4KSF A;  4A32 A;  2B5G A;  2JEV A;  2C6P A;  5J8F A;  4L8A A;  3FED A;  3NE8 A;  1ZLH A;  1TXR A;  2VQY A;  2CNM A;  4A31 A;  1ARL A;  2IMO A;  2YNE A;  1YME A;  2CNS A;  5HVH A;  4EME A;  5CPA A;  4WWV A;  2PJ8 A;  3KHZ A;  1IB1 E;  2CTB A;  4B12 A;  3TO6 A;  3K9U A;  1IOI A;  2IJZ A;  2B5G B;  2HC9 A;  2PDO A;  2V77 A;  3IU1 A;  1SPV A;  2PJ0 A;  2VEZ A;  5DWM A;  3SHP A;  2PRQ A;  1TF8 A;  2CNT A;  4H6U A;  2EK9 A;  3PP9 A;  3PFE A;  4II9 A;  3IEH A;  2X47 A;  2PJ3 A;  3PB9 X;  2REE A;  4PXD A;  2VXK A;  3Q71 A;  2WPX A;  1QSN A;  3ZZI A;  4MCS A;  4MCQ A;  3S6K A;  4RUH A;  2PJ1 A;  3D7G A;  5CNP A;  2JDC A;  5G20 A;  4KVX A;  2IQ6 A;  2FT0 A;  4NJQ A;  3D7F A;  4IQY A;  4CAW A;  2BL1 A;  4KOY A;  3S9M A;  1YVK A;  2AFZ A;  3VFQ A;  1BO4 A;  2QEC A;  2ZOG A;  4P45 A;  4Q36 A;  4A94 A;  3SJE A;  4QVT A;  2Q43 A;  2G3T A;  3GLJ A;  4RS2 A;  3ZJ0 A;  3R96 A;  4JWP A;  2QYV A;  4M85 A;  3VAT A;  1Y9W A;  3LWU A;  2VZZ A;  1TKH A;  1FY7 A;  3EXN A;  3FB3 A;  4NGS A;  2PIZ A;  4KLW A;  2XEF A;  3F0A A;  2VI7 A;  1VKC A;  5FSV A;  4CYQ A;  4NF1 A;  3DDD A;  2QJ8 A;  4RN7 A;  3DSB A;  5ELY A;  1J4J A;  1MJ9 A;  2CIJ A;  3PGP A;  3SI0 A;  1M4G A;  1MJA A;  2FG1 A;  1YR0 A;  1LAM A;  3S6H A;  4NFR A;  5IB0 A;  3NFZ A;  3D2P A;  3WR7 A;  4R57 A;  1R3N A;  1P4N A;  2Q7S A;  2Z11 A;  4YWY A;  2B4D A;  1IYK A;  4M6I A;  1PU9 A;  3FYN A;  4J3G A;  3SI2 A;  1Y7E A;  3R9F A;  2O53 A;  2YNC C;  2Z3M A;  4KLV A;  1I12 A;  1Y0R A;  4F9U A;  4UFV A;  2VZY A;  3SIJ A;  2GFQ A;  5ISV A;  4L89 A;  3N5F A;  1VIX A;  1Z8T A;  3PZJ A;  4FD7 A;  2JZF A;  4U9Z A;  3IU2 A;  4LX9 A;  4MCR A;  1I21 A;  4DNC A;  3JVN A;  2H5M A;  4UWI A;  5HIH A;  3PEI A;  1XRY A;  4KSA A;  4F6A A;  4MHN A;  4NSQ A;  4ZBG A;  3RO0 A;  2D4P A;  1YQE A;  3G8W A;  3BHX A;  4X5K A;  5F48 A;  4BMH A;  5I4M A;  3EWR A;  2PJ9 A;  1CPX A;  2KCW A;  2Z3P A;  4CYP A;  4WJB A;  4RI1 A;  1XFO A;  2C6C A;  3H5Z A;  3PRT A;  4KOS A;  3B35 A;  4P4I A;  1H8L A;  2FCK A;  3BI0 A;  2BCO A;  2AE6 A;  3SI1 A;  4B14 A;  3SIH A;  2JLM A;  4HKF A;  3D3S A;  3S9N A;  4ZI6 A;  4CYO A;  3TOA A;  3C26 A;  3PB8 X;  2DX6 A;  5FSZ A;  1OBR A;  2BOA A;  3Q6Z A;  1X10 A;  3DNS A;  3CXP A;  3P2H A;  4PQA A;  1DE4 C;  1Y7R A;  4MY0 A;  3NH8 A;  4OC5 A;  5C88 A;  2JZE A;  3UY5 A;  1X12 A;  2J8R A;  4MFQ A;  1VHS A;  2J9A A;  3DR8 A;  4HNY B;  4CRZ B;  5HVG A;  3W6S A;  4CGP A;  3CZX A;  3D2M A;  1YW4 A;  2FL4 A;  2R1I A;  4F8Z A;  4KVM E;  2R7H A;  3DLJ A;  3FJU A;  1NE9 A;  2VL1 A;  4UWJ A;  1KUY A;  1YVO A;  3PB4 X;  4MFJ A;  2OU2 A;  4Q7A A;  3FEE A;  4FD6 A;  4I49 A;  4K3N A;  4P4D A;  4ESS A;  1Q7L A;  4U9Y A;  4UEZ A;  3SXO A;  4A38 A;  1EE3 P;  2BSW A;  2PJ5 A;  1Z4E A;  3BXM A;  2BFQ A;  3IGR A;  3QAH A;  3ISZ A;  1NMT A;  2XEJ A;  2ZPA A;  3IIB A;  4UEE A;  5KTC A;  3I3G A;  3IJ3 A;  2KQV A;  1BAV A;  1IY7 A;  4KOT A;  4NGM A;  5AG6 A;  2FVG A;  4QBJ A;  2IL4 A;  3LOD A;  4ETK A;  4KUA A;  4ONW A;  4R3L A;  3WC5 A;  3EY5 A;  1NSA A;  4GVW A;  3TTH A;  5G22 A;  1S60 A;  4FUU A;  3RZA A;  4ZGY B;  2PR8 A;  4OAD A;  2VRI A;  2PJB A;  3EWQ A;  2G3A A;  2JBK A;  4DJL A;  2PCU A;  1FNO A;  4MFZ A;  4CGM A;  1CP7 A;  2ZEF A;  4MFL A;  1F2P A;  2REF A;  4KOW A;  3KGQ A;  3A9L A;  4Y49 C;  5DWN A;  1Z8W A;  2FS5 A;  1XE4 A;  2GLJ A;  4MCP A;  1LFW A;  2DEA A;  5J8C A;  4FD4 A;  5LRK A;  4KOX A;  1FT7 A;  3K2K A;  2AFS A;  1AMP A;  4MI4 A;  3W91 A;  3EWO A;  4OC1 A;  5AG5 A;  4GVV A;  1XEB A;  3V2B A;  2F8H A;  4P44 A;  4MMO A;  5FSX A; 
#chains in the Genus database with same CATH homology
 4PXE A;  4FAI A;  4J5Q A;  1DTD A;  4EFD A;  5CB3 A;  3D7H A;  3EJF A;  4JZ0 A;  3KR4 A;  3B3T A;  3GQE A;  2ABZ A;  2G9D A;  2XEG A;  3D7D A;  2AFW A;  4R76 A;  4UF4 A;  5JGF A;  2PE3 A;  4P45 A;  3CT9 A;  2AFC A;  2PVV A;  3FVL A;  5FSU A;  3GB0 A;  3EKE A;  4TWE A;  2OOT A;  3VH9 A;  1YD9 A;  3EJG A;  3B3V A;  2CTC A;  5DUS A;  1ZG7 A;  3GPO A;  1VHO A;  4JCA A;  2BO9 A;  4A37 A;  2JEW A;  3H8F A;  2ZEM A;  3D4U A;  3MRU A;  5D29 A;  4ZX8 A;  1NJR A;  5JH9 A;  3B3W A;  3T8W A;  2V8G A;  2EWB A;  4G1P A;  2QVP A;  4IK2 A;  1QMU A;  5JM6 A;  2V8H A;  4NGT A;  4P6Y A;  3NH5 A;  1KWM A;  1TKJ A;  2PVW A;  1ZG9 A;  1ZR5 A;  3QNV A;  4X3R A;  1IGB A;  2PJ2 A;  3SIG A;  3JZT A;  4MRI A;  2ZEE A;  3SJG A;  3KHX A;  4W9Y A;  3B7I A;  5LYL A;  3SJX A;  1M4L A;  4J4Z A;  3GPQ A;  4P10 A;  2PJ7 A;  4OC2 A;  4IHM A;  4TNU A;  1JQG A;  5HOL A;  2C1C A;  2ZOF A;  4ABL A;  3HLP A;  3EWP A;  3D68 A;  2AFM A;  2EEE A;  3FEC A;  3PBE A;  2AFX A;  2RB7 A;  2PIY A;  4FBE A;  4AXV A;  2V8D A;  2GRE A;  1ZR3 A;  3IID A;  4EWT A;  6CPA A;  2I3C A;  3B2Y A;  3IC1 A;  3L2N A;  1XJO A;  4KSI A;  4FWU A;  1VHE A;  2AFU A;  2NSM A;  5DS0 A;  3GPG A;  5LYI A;  2XEI A;  4OC4 A;  1Z8L A;  2PJA A;  1XMB A;  4OKO A;  1Z2L A;  2ZEP A;  5FSY A;  3DGV A;  4P4E A;  3KR5 A;  3KL9 A;  4PXC A;  4ZYQ A;  2GU2 A;  4GM5 A;  4NJR A;  1YSJ A;  3IO1 A;  4R7M A;  1BPM A;  3D67 A;  3NA6 A;  1CBX A;  2L8R A;  1CPS A;  1HDQ A;  5LYF A;  1LCP A;  1R43 A;  3WAB A;  2ZEH A;  4KYB A;  3BI1 A;  4JYW A;  3B3S A;  2ZEG A;  4CPA A;  4R6T A;  3SJF A;  4PXB A;  4MHY A;  1Y0Y A;  4NGQ A;  1HEE A;  2PJ4 A;  3CPX A;  4DUK A;  3JRU A;  4ZY0 A;  5F09 A;  2PJC A;  3KQZ A;  1PCA A;  3FH4 A;  3PB7 X;  1F2O A;  1CG2 A;  1RTQ A;  4A39 A;  3I1U A;  4TU0 A;  4UML A;  1TXZ A;  1LAN A;  3PBB A;  2AFO A;  3K9T A;  3CPA A;  2LGR A;  3WC6 A;  1BLL E;  3FX6 A;  2XD7 A;  2NYQ A;  2WZN A;  2F7V A;  2FAV A;  1YLO A;  4BD9 A;  3IFE A;  5HVF A;  2OR4 A;  1TF9 A;  2RFH A;  2ANP A;  4NGN A;  3LMS A;  4O23 A;  1LOK A;  3WT4 A;  5K8P A;  2ACF A;  4OIW A;  2V8V A;  2ZED A;  5LRJ A;  2WYR A;  3IWW A;  4YU9 A;  1ELL P;  3RAM A;  5E3B A;  1F57 A;  1YW6 A;  4PPZ A;  2C6G A;  4ZX9 A;  5CBM A;  5CMS A;  4MHZ A;  3KZW A;  3IIF A;  3GUX A;  3HUV A;  3KAS A;  5LRG A;  3VAR A;  3H8E A;  5AIL A;  5CB5 A;  4ABK A;  2CF4 A;  3V38 A;  5D8N A;  2PJ6 A;  1GYT A;  5HXD A;  4MXU A;  2ZEN A;  1Z5R A;  2HB6 A;  5THW A;  1HJZ A;  4GUA A;  4H2K A;  5K8N A;  4P4J A;  4P4B A;  3CDX A;  4OID A;  3H8G A;  4K0C A;  4NGP A;  1ZG8 A;  4UIB A;  2BFR A;  1CP6 A;  1BPN A;  1LAP A;  4ZY2 A;  4J5R A;  1VHU A;  3FF3 A;  4Z65 A;  4JVV A;  5K8M A;  4P4F A;  4J5S A;  4LQG A;  2EK8 A;  2Q51 A;  5LYD A;  4OP4 A;  4IAV A;  8CPA A;  1TKF A;  3S9L A;  3EW5 A;  4OC3 A;  1TY8 A;  4F9V A;  3KI9 A;  5IB9 A;  1HDU A;  1UWY A;  3GQO A;  2GLF A;  4R8F A;  1CX8 A;  1ARM A;  3FMC A;  3D66 A;  4ZY1 A;  1ZLI A;  3NH4 A;  4JLL A;  2POK A;  3ISX A;  4D86 A;  1PYT B;  4ETJ A;  4UEF A;  3B3C A;  4OC0 A;  4X8I A;  3TC8 A;  3SII A;  2O4H A;  4MHP A;  3KQX A;  1VGY A;  4DYO A;  3ETI A;  2ZEL A;  4OME A;  3V7Z A;  3PB6 X;  3MN8 A;  4JGK A;  1ELM P;  7CPA A;  1XBU A;  4B6Z A;  3RBU A;  4X2T A;  1QQ9 A;  2JBJ A;  5K8O A;  2ZEO A;  3WC7 A;  4NGR A;  1AYE A;  2FXK A;  3TX8 A;  5J1Q A;  3V45 A;  3PFO A;  2C6P A;  3FED A;  1ZLH A;  1TXR A;  1ARL A;  2IMO A;  1YME A;  5HVH A;  4EME A;  5CPA A;  4WWV A;  2PJ8 A;  3KHZ A;  2CTB A;  2IJZ A;  2V77 A;  3S9N A;  2HC9 A;  1SPV A;  2PJ0 A;  2PRQ A;  1TF8 A;  2EK9 A;  3PFE A;  3IEH A;  2X47 A;  2PJ3 A;  3PB9 X;  4PXD A;  3Q71 A;  4MCS A;  4MCQ A;  4RUH A;  2PJ1 A;  3D7G A;  2IQ6 A;  4NJQ A;  3D7F A;  4IQY A;  3S9M A;  2AFZ A;  2ZOG A;  3VFQ A;  4A94 A;  3SJE A;  2Q43 A;  3GLJ A;  2QYV A;  3VAT A;  3LWU A;  1TKH A;  4NGS A;  2PIZ A;  2XEF A;  5FSV A;  2QJ8 A;  5ELY A;  2CIJ A;  3SI0 A;  2FG1 A;  1LAM A;  4NFR A;  3NFZ A;  1R3N A;  4YWY A;  3SI2 A;  1Y7E A;  2O53 A;  1Y0R A;  4F9U A;  3SIJ A;  3N5F A;  1VIX A;  4MCR A;  5HIH A;  3PEI A;  1XRY A;  4MHN A;  3BHX A;  5I4M A;  3EWR A;  2PJ9 A;  1CPX A;  4WJB A;  1XFO A;  2C6C A;  3PRT A;  3B35 A;  4P4I A;  1H8L A;  3BI0 A;  3SI1 A;  2BCO A;  3SIH A;  4ZI6 A;  3PB8 X;  2DX6 A;  5FSZ A;  1OBR A;  2BOA A;  3Q6Z A;  4UIA A;  4PQA A;  1DE4 C;  3NH8 A;  4OC5 A;  2J9A A;  5HVG A;  1YW4 A;  4F8Z A;  3DLJ A;  3FJU A;  2VL1 A;  3PB4 X;  4Q7A A;  3FEE A;  4P4D A;  4UEZ A;  4K3N A;  4ESS A;  1Q7L A;  4A38 A;  1EE3 P;  2PJ5 A;  3BXM A;  2BFQ A;  3ISZ A;  4UEE A;  2XEJ A;  3IIB A;  3IJ3 A;  1BAV A;  1IY7 A;  4NGM A;  2FVG A;  4ONW A;  4ETK A;  3WC5 A;  1NSA A;  4GVW A;  3RZA A;  4FUU A;  2VRI A;  2PJB A;  3EWQ A;  2JBK A;  4DJL A;  2PCU A;  1FNO A;  1CP7 A;  2ZEF A;  1F2P A;  3KGQ A;  2GLJ A;  4MCP A;  1LFW A;  2DEA A;  5LRK A;  1FT7 A;  3K2K A;  2AFS A;  1AMP A;  3EWO A;  4OC1 A;  4GVV A;  2Q4Z A;  3V2B A;  2F8H A;  4P44 A;  4MMO A;  5FSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...