3KQZA

Structure of a protease 2
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqzA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqzA02
2VRIA 4K3NA 1AMPA 3BHXA 3KI9A 3ISXA 5HVHA 3KASA 4PPZA 4P10A 2AFUA 4X8IA 3HUVA 4JVVA 5K8MA 4MCSA 4MHZA 1ELLP 4R7MA 1F57A 4MHPA 4OC5A 1CP7A 4A38A 2PJ5A 3GUXA 1YD9A 4K0CA 3PBEA 2V8VA 4NFRA 3WC7A 1TKHA 3SIJA 4J5QA 1ZR5A 2ZEOA 3H8FA 5LRGA 2PCUA 5K8PA 4IHMA 1CX8A 4GM5A 1LAPA 2GREA 4MHNA 3NH4A 3PBBA 3IIDA 5D8NA 4YU9A 4LQGA 1Z8LA 1CPSA 6CPAA 2PVVA 2ZELA 3B3VA 4JZ0A 3CPAA 4F9UA 2ZEFA 3EKEA 3T8WA 4PXCA 3D68A 4UEFA 2EEEA 4OIDA 1KWMA 3PB9X 3CDXA 3GQOA 1CBXA 2PJ4A 3LWUA 2CTCA 3B3CA 5FSXA 4F8ZA 3KR4A 3SIHA 1QQ9A 1AYEA 3PFOA 2ZOGA 1XRYA 1BLLE 2CTBA 3NH8A 2G9DA 8CPAA 5D29A 2BOAA 4NGPA 3MRUA 3PRTA 5HIHA 1DE4C 5F09A 4JYWA 1DTDA 5AILA 3S9MA 4MRIA 3KZWA 3EJGA 1VHUA 1HEEA 4OC3A 1R43A 4P4EA 2BCOA 7CPAA 4JLLA 2AFXA 2LGRA 3D7DA 2EK8A 2XEGA 3K9TA 3TC8A 4ZY1A 3PB7X 4P4FA 2XD7A 3V7ZA 2QJ8A 3FJUA 3IFEA 1TF8A 1CPXA 2ZENA 3FEDA 5E3BA 5LRJA 5CMSA 1HJZA 2ZEDA 4PXDA 4OC2A 2PJCA 4J4ZA 3IIBA 3D66A 4IQYA 3DLJA 1F2PA 1EE3P 3BI1A 5CB3A 4ONWA 4UEEA 4JGKA 3KHZA 4YWYA 1M4LA 3FF3A 4P4DA 4TWEA 1XFOA 4P44A 5DS0A 2PJ2A 1BPMA 1H8LA 4OKOA 1VHEA 3S9NA 4PQAA 2XEJA 1TF9A 2IMOA 3D67A 4NGQA 3KL9A 2AFZA 2Q4ZA 4F9VA 2FG1A 1LCPA 3ETIA 2V8HA 1XMBA 1CP6A 3KHXA 4ABLA 4PXEA 4OC0A 2PJ0A 3EW5A 1CG2A 4R6TA 4A94A 4TU0A 4OMEA 4EWTA 4NJQA 2CF4A 2AFWA 2PJ6A 2BO9A 4P6YA 3QNVA 4ZX8A 3KGQA 4UMLA 3WABA 5CBMA 5FSZA 4ZX9A 2VL1A 4JCAA 4UEZA 3VATA 3SIIA 2AFOA 4TNUA 4NGSA 1YW4A 1LFWA 2GLFA 4GVWA 1HDQA 1TKFA 3BI0A 3K2KA 1BAVA 2FVGA 2V8DA 4W9YA 3D7HA 3FEEA 2POKA 3SI2A 4H2KA 4X2TA 1XJOA 4CPAA 5K8OA 1R3NA 3MN8A 2JBJA 3KQZA 2PJ1A 5FSUA 2ZEMA 4DUKA 2ZOFA 2EWBA 3V2BA 3Q6ZA 4KYBA 2GLJA 3CT9A 3SJEA 5DUSA 2BFRA 4NGMA 1UWYA 3EJFA 1LANA 2GU2A 4BD9A 2JBKA 3IO1A 3PB8X 3N5FA 1VHOA 3EWQA 1Y7EA 1YMEA 3B35A 3B7IA 2AFMA 3NA6A 3TX8A 5CPAA 5HVFA 5LYLA 1FT7A 2JEWA 3EWPA 3FX6A 4NJRA 5I4MA 2PVWA 3GPGA 4OC1A 3S9LA 3PB6X 4KSIA 4G1PA 3VARA 4B6ZA 3NH5A 3B2YA 1ARMA 2FXKA 2IQ6A 2OOTA 1TXZA 2L8RA 3BXMA 4X3RA 4FBEA 2PIZA 5FSYA 3FVLA 4Q7AA 1ZG8A 4R8FA 2HC9A 4P4JA 4O23A 3RAMA 3V45A 2FAVA 1IY7A 5JGFA 2WZNA 4D86A 2O4HA 5JH9A 3IIFA 4MMOA 3KQXA 3CPXA 4AXVA 2I3CA 1ARLA 1ZG9A 4UIAA 2ACFA 5LYIA 3SI0A 2PJAA 3PEIA 3LMSA 1OBRA 1SPVA 2AFCA 2C6GA 4RUHA 3L2NA 2RB7A 4MHYA 3GPQA 2ZEGA 4A39A 3IJ3A 1XBUA 2ANPA 3D7GA 4FAIA 3H8GA 4ETKA 4GUAA 1YLOA 2ZEPA 3RBUA 2C1CA 2PJ9A 1VGYA 1Y0RA 4NGRA 1Z5RA 2DX6A 1FNOA 2QYVA 2PJ3A 4EFDA 3PB4X 2V77A 2O53A 5CB5A 1LOKA 3WT4A 3V38A 4J5RA 4FUUA 2F8HA 4FWUA 4Z65A 2AFSA 1RTQA 3D7FA 1TKJA 4OP4A 1IGBA 4MXUA 3KR5A 4R76A 3VFQA 3ISZA 4WWVA 2F7VA 4IK2A 3B3WA 1ZLHA 4WJBA 2NSMA 3PFEA 4NGNA 5J1QA 2Q51A 2PIYA 3FMCA 2QVPA 3B3SA 1Q7LA 1ZLIA 2X47A 2XEFA 4ESSA 1ELMP 5K8NA 4MCPA 2BFQA 1Z2LA 2Q43A 3SJGA 1Y0YA 2PJBA 3FH4A 1JQGA 2J9AA 4P4BA 5HVGA 3GPOA 1TXRA 2IJZA 4ZY0A 3IC1A 3SIGA 1ZG7A 4UIBA 3VH9A 4ZYQA 2PE3A 2PJ7A 4J5SA 4OC4A 1PYTB 2OR4A 1VIXA 1BPNA 3GQEA 3GB0A 2ABZA 3WC5A 3GLJA 5JM6A 3JZTA 5ELYA 3D4UA 3EWRA 3DGVA 3IEHA 5IB9A 1GYTA 3IWWA 2EK9A 4GVVA 3SJFA 1LAMA 4P4IA 2DEAA 5LYFA 4UF4A 4ETJA 4MCQA 4ZY2A 3FECA 4OIWA 3H8EA 3B3TA 2RFHA 2ZEHA 3SI1A 4MCRA 5HXDA 3HLPA 1PCAA 5LYDA 5HOLA 3NFZA 4A37A 2C6PA 1NJRA 5THWA 4P45A 1YSJA 4ABKA 2CIJA 2HB6A 2ZEEA 4DJLA 2C6CA 4PXBA 1QMUA 3Q71A 4NGTA 1HDUA 2NYQA 3JRUA 2PRQA 1F2OA 3SJXA 1NSAA 2WYRA 4EMEA 2XEIA 2PJ8A 1ZR3A 5LRKA 4DYOA 3I1UA 5FSVA 2V8GA 3WC6A 3EWOA 1TY8A 1YW6A 4IAVA 4ZI6A 3RZAA
chains in the Genus database with same CATH superfamily
2VRIA 4XNHC 3DDDA 4K3NA 1AMPA 3EXNA 3I3GA 3BHXA 1AUGA 2QIRA 4A31A 3KI9A 2B58A 3ISXA 3EO4A 5HVHA 1S7FA 3KASA 2VZYA 4PPZA 4P10A 2AFUA 3LD2A 4X8IA 3HUVA 4JVVA 5K8MA 4MCSA 4UWJA 3H4QA 1ELLP 4MHZA 4CYQA 4A32A 4R7MA 1F57A 4MHPA 2F5IA 4OC5A 1I1DA 1CP7A 4A38A 1S3ZA 2PJ5A 2FSRA 2FS5A 1YD9A 3GUXA 3W6XA 4KUAA 4K0CA 3PBEA 5JQ4A 2FE7A 2V8VA 3I9SA 3NE7A 3P2HA 4NFRA 4CGOA 2JZDA 1TKHA 3WC7A 3SIJA 4J5QA 1ZR5A 3E0KA 2ZEOA 3H8FA 5LRGA 4CS0B 1BO4A 1JWQA 2PCUA 4Y49C 4C2ZA 4CGPA 2OZHA 3DR6A 4ONUA 4A30A 5K8PA 4IHMA 1CX8A 4QB9A 4GM5A 1Q2YA 1LAPA 2D4OA 5EC4A 2WUUA 1S7KA 2GREA 3IU2A 4MHNA 1XOVA 3NH4A 2WPWA 3IU1A 3IIDA 3PBBA 5D8NA 3EC4A 4YU9A 5AGEA 4LQGA 2B3VA 1Z9UA 1Z8LA 2Z11A 1CPSA 6CPAA 2PVVA 2ZELA 3B3VA 4JZ0A 1MK4A 4UBRA 3CPAA 4AVBA 3TOBA 4F9UA 2ZEFA 3EKEA 4MFKA 2Z3OA 3T8WA 4PV6A 4YGOA 4PXCA 2FIAA 3D68A 4UEFA 4F0XA 4KVXA 1BOBA 3D2PA 1NE9A 2IL4A 3CZXA 4JJXA 1NSLA 2EEEA 1S5KA 3FBUA 2VEZA 4OIDA 1KWMA 3PB9X 3CDXA 1IB1E 4C7IA 2JDDA 4JWPA 5HH1A 4MXUA 2P6EA 4FD5A 3FXTA 5IV0A 1MJ9A 3TO9A 2K5TA 3WR7A 2P6GA 3GQOA 4MFQA 1CBXA 2PJ4A 3R96A 3LWUA 2CTCA 3B3CA 5FSXA 4NF1A 4F8ZA 3KR4A 3SIHA 1QQ9A 2DF5A 3DSBA 1AYEA 3PFOA 4CGMA 2ZOGA 1M4IA 2Q44A 1XRYA 4MFLA 1Y9KA 4OAEA 1BLLE 2CTBA 3NH8A 4A2ZA 4AG7A 2G9DA 8CPAA 2Z10A 5D29A 2BOAA 4NGPA 2WCTA 3MRUA 1N71A 5HIHA 1DE4C 3EY5A 3PRTA 5F09A 4CRZB 4JYWA 1DTDA 5AILA 2Y0MA 3S9MA 2DXQA 3PP9A 4MRIA 3KZWA 4NSQA 3EJGA 1LRZA 4B14A 5KTDA 1X10A 1VHUA 3K9UA 1M4DA 1HEEA 4OC3A 4R3KA 4F6AA 1R43A 4CYNA 4P4EA 1U6MA 4M6GA 2BCOA 3FNCA 7CPAA 1WK4A 2FL4A 2ZW5A 4JLLA 3TO7A 1R57A 2AFXA 2D4PA 2LGRA 3D7DA 1PU9A 1YVOA 1L0CA 1M4GA 2EK8A 2REEA 3LACA 4NCZA 3C26A 1QSMA 1IOFA 1KUVA 1M1DA 2XEGA 3K9TA 4KOTA 3TC8A 4ZY1A 3PB7X 1XIXA 4R57A 4P4FA 4FD6A 2XD7A 3IGRA 3V7ZA 2QJ8A 3FJUA 2ARHA 4CAVA 3IFEA 1TF8A 1CPXA 2ZW4A 1CJWA 1Y7RA 2ZENA 3FEDA 5E3BA 4M6IA 1S7NA 5LRJA 5CMSA 1B87A 1HJZA 2CXAA 2GANA 2ZEDA 4XPDC 5DWNA 1YLEA 4PXDA 4HNYB 4OC2A 2PJCA 1X12A 4CYPA 4J4ZA 3IIBA 3D66A 3FRMA 1FY7A 4IQYA 3DLJA 1F2PA 4CAWA 1EE3P 4UFWA 3BI1A 5CB3A 4B12A 4ONWA 5I0CA 4UEEA 4JGKA 2YGWA 3KHZA 4YWYA 1M4LA 3FF3A 4P4DA 4TWEA 4E2AA 5G20A 1XFOA 2PSWA 3BJ8A 4P44A 2DPSA 2Q04A 4QBJA 5JPHA 5DS0A 3KKWA 2PJ2A 5AG7A 1BPMA 1H8LA 3R95A 2B4DA 4OKOA 1VHEA 4Q36A 3S9NA 4PQAA 1Q2DA 3DNSA 4LQ6A 4H6UA 2XEJA 1TF9A 2YNCC 4B5PA 2IMOA 3D67A 4NGQA 3KL9A 2B4DB 2AFZA 2Q4ZA 5KTAA 4F9VA 2FG1A 1GHEA 1LCPA 3NE8A 4L89A 2Z3NA 3ETIA 2J8NA 2V8HA 1XMBA 4NEXA 3TCVA 3SXNA 1CP6A 3KHXA 4ABLA 2BUEA 4PXEA 4B5PB 3S6KA 4OC0A 3D3SA 2PJ0A 4DNCA 3EW5A 1CG2A 1PUAA 1UFHA 4R6TA 5LYLA 4UFVA 5GCNA 2HQYA 4KZTA 4A94A 4BMHA 3H5ZA 5H86A 2RC4A 4TU0A 3FB3A 4OMEA 4KLWA 4B5OA 2VBQA 2ZW6A 1YX0A 2J8RA 4EWTA 2Q7SA 4NJQA 2CF4A 2AFWA 2PJ6A 2BO9A 2EUIA 4JXRA 3TOAA 4P6YA 3TE4A 3QNVA 3G8WA 2R7HA 4ZX8A 2KQVA 3KGQA 3TFYA 4UMLA 3WABA 5CBMA 5FSZA 4ZX9A 2VL1A 4JCAA 4HPSA 1QSTA 2ZXVA 4UEZA 3VATA 3A9LA 3SIIA 5AG4A 4YRHA 3CXPA 2Q7BA 2AFOA 4TNUA 3N7ZA 4NGSA 4CRYB 4II9A 1YW4A 2Z3LA 1S7LA 1LFWA 2GLFA 2JDCA 4GVWA 1HDQA 2PC1A 1TKFA 3BI0A 3K2KA 1BAVA 3QAYA 4C2XA 2FVGA 2V8DA 2BEIA 4W9YA 5AG6A 3D7HA 2GIVA 2GE3A 3FEEA 4L8AA 4MJ8A 2POKA 3RO0A 4NXYA 3SHPA 3SI2A 4H2KA 4JLYA 4X2TA 1XJOA 2Z3KA 4CPAA 5K8OA 2H5MA 3RNZA 1XF8A 2R1IA 3GY9A 3UY5A 1R3NA 1Z8TA 3MN8A 5CNPA 5F47A 2JBJA 3KQZA 2J8MA 2PJ1A 5FSUA 2ZEMA 4U9ZA 2EWBA 2ZOFA 3V2BA 4DUKA 3Q6ZA 4KYBA 2GLJA 2AJ6A 3CT9A 3SJEA 5G1ZA 4H6ZA 5DUSA 2Z3PA 2BFRA 4JXQA 4NGMA 5G22A 1UWYA 4HNXB 2W2GA 3EJFA 2Q4VA 1LANA 2GU2A 1SQHA 4FD7A 4BD9A 2JBKA 3IO1A 3PB8X 3N5FA 4LUAA 5FVJA 1VHOA 2R98A 3EWQA 1Y7EA 1YMEA 3B35A 1YQEA 4LX9A 3B7IA 2AFMA 3NA6A 3T90A 3TX8A 4KOUA 2JLMA 5CPAA 5HVFA 1FT7A 2JEWA 3EWPA 3IWEA 4Y49B 4BINA 3FX6A 1VHSA 1A2ZA 2OB0A 2REFA 4NJRA 5I4MA 2PVWA 4A33A 4YFJA 3DR8A 3GPGA 4C2YA 4C7HA 4OC1A 3S9LA 3PB6X 4KSIA 4G1PA 3VARA 1YR0A 3R1KA 3NH5A 4B6ZA 1VKCA 2ZPAA 3B2YA 3P2FA 4MY3A 1ARMA 3R9FA 5G21A 2FXKA 2IQ6A 4GXHA 2OOTA 4K30A 1TXZA 3S6HA 2L8RA 3BXMA 1QSRA 4X3RA 4KS9A 4FBEA 2PIZA 3JVNA 5FSYA 4RN7A 5F46A 1MJAA 1YK3A 2EVNA 3FVLA 4Q7AA 1ZG8A 4R8FA 2HC9A 3R9GA 5A27A 1IYKA 4P4JA 5E96A 4O23A 3RAMA 3V45A 2FAVA 1XE4A 1IY7A 1J4JA 1WWZA 2CNTA 4H89A 1NMTA 2WSAA 3BJ7A 1KZFA 3QAHA 5JGFA 5ISVA 2WZNA 4D86A 2O4HA 5JH9A 4QC6A 3G3SA 3IIFA 1M44A 3EFAA 2Q4YA 2CNMA 4MMOA 4AG9A 3KQXA 3CPXA 1I21A 4AXVA 5BWAB 2I3CA 4PK2A 1ARLA 1ZG9A 4KVOE 4UIAA 3SXOA 3OWCA 2ACFA 5LYIA 4OADA 2FCKA 3SI0A 4KSAA 2PJAA 1IIDA 1IU8A 3PEIA 3LMSA 1OBRA 1SPVA 1ZO0A 2YNDA 4KOSA 4KOWA 2AFCA 4ZBGA 4R87A 3LODA 3BLNA 2C6GA 3D8PA 4RUHA 3L2NA 2RB7A 4MHYA 3GPQA 2ZEGA 5F48A 2B5GA 4A39A 3IJ3A 1XBUA 2ANPA 3D7GA 2QMLA 4XPLA 4FAIA 3H8GA 4C68A 4ETKA 4GUAA 2YNEA 4UWIA 1YLOA 2Z0ZA 2ZEPA 3RBUA 2C1CA 4KOXA 4U5YA 2PJ9A 4PK3A 4B11A 1VGYA 4U9YA 2BL1A 4KOVA 1Y0RA 4NGRA 1Z5RA 3W91A 2B5GB 2DX6A 1FNOA 2G0BA 3IWGA 4GS4A 1YREA 2QYVA 2JZFA 2PJ3A 1TIQA 4Q38A 4EFDA 1ON0A 3PB4X 3TTHA 4PSXA 2V77A 4UCNA 4ORFA 3T9YA 4ZGYB 4RS2A 3RYOA 4OLLA 2O53A 5CB5A 1LOKA 1Z4RA 4BBHA 3WT4A 3GKRA 4UFXA 3V38A 3FIXA 4KSFA 4J5RA 4FUUA 4XPDB 5EBVA 2F8HA 4FWUA 5KTCA 4Z65A 4J3GA 4KORA 2AFSA 1RTQA 3D7FA 1TKJA 5C88A 4OP4A 2OU2A 5EMIA 3TT2A 1IGBA 1QSNA 2VXKA 3KR5A 4R76A 3VFQA 1RXTA 3ISZA 2F7VA 2VI7A 4IK2A 1XMTA 4WWVA 4QUSA 5C82A 4XPKA 3B3WA 4AB7A 1ZLHA 2PR1A 4WJBA 2NSMA 3PGPA 3PFEA 4R9MA 3MGDA 2PDOA 3PZJA 4KUBA 3F8KA 4IUSA 4NGNA 2NMTA 5J1QA 2Q51A 4M3SA 2PIYA 5IX3A 2YNCA 3FMCA 2QVPA 3S6FA 3B3SA 2O28A 4M6HA 1Q7LA 4MHDA 4CGLA 1Z4EA 1Z8WA 2PRBA 2B3UA 4RI1A 1ZLIA 5DWMA 2X47A 4UCMA 4XNHB 5AG5A 2WPXA 2XEFA 2AE6A 4ESSA 2EO8A 1ELMP 1CM0A 4MY0A 1S60A 5K8NA 1YGHA 4KVME 4PSWA 1K4JA 5J8CA 1RO5A 2BFQA 1Z2LA 2PR8A 2VQYA 3F5BA 2Q43A 4KLVA 2X7BA 4MCPA 4UCPA 3SJGA 1Y0YA 3VWEA 2PJBA 4CGNA 1KUXA 2G3AA 2I79A 3FH4A 1QSOA 2ODFA 4MFPA 4F0YA 1JQGA 3V8IA 2J9AA 2A4NA 2GFQA 4P4BA 5H84A 3GPOA 4CAXA 1TXRA 2FXFA 5HVGA 2IJZA 4ZY0A 3IC1A 4E8OA 1I12A 5IB0A 4HKFA 3SIGA 1ZG7A 2OZUA 3ZJ0A 4A95A 4UIBA 3VH9A 4ZYQA 2PE3A 1KUYA 2FT0A 2QECA 4FD4A 4AVAA 2JEVA 2FIWA 4J5SA 2PJ7A 4OC4A 5J8FA 3S6GA 2B4BA 4UA3A 2R8VA 3GIUA 4CAFA 1PYTB 2OR4A 4IF5A 4X5KA 1VIXA 1IICA 1BPNA 3GQEA 3GB0A 2ABZA 3WC5A 3GLJA 4KOYA 2HUZA 5JM6A 4QVTA 3JZTA 5ELYA 3D4UA 3EWRA 1MJBA 2VZZA 3DGVA 3CXQA 2ATRA 1GYTA 3IEHA 5IB9A 3IWWA 2EK9A 4MFJA 4E0AA 4GVVA 2CNSA 4MBUA 3SJFA 1LAMA 4P4IA 2DEAA 3FYNA 4UF4A 5LYFA 4ETJA 4MCQA 4ZY2A 3FECA 4HNWB 4CAEA 4MI4A 4OIWA 5HMNA 2P0WA 5F49A 2ZW7A 1OZPA 3H8EA 3B3TA 2CY2A 2RFHA 2ZEHA 3SI1A 4MCRA 4EVYA 1IYLA 2G3TA 1Z8XA 2PQ8A 3F0AA 5HXDA 3HLPA 1Y9WA 1PCAA 2BSWA 5LYDA 2HV2A 5HOLA 3JTKA 1V0CA 2OZGA 2Q0YA 3NFZA 3W6SA 4A37A 2C6PA 1P0HA 1Q2CA 2Z3MA 3GYAA 2OH1A 1NJRA 3JUWA 5THWA 2C27A 1YSJA 4P45A 1IOIA 4ABKA 1B6BA 4JD6A 4B13A 2CIJA 2HB6A 3ZZIA 2ZEEA 4DJLA 2C6CA 3B8GA 4R3LA 1XEBA 2I00A 4PXBA 1QMUA 3CXSA 3VWDA 5A28A 2EBJA 3Q71A 4NGTA 1HDUA 2NYQA 3JRUA 2PRQA 4CYOA 1F2OA 2DPTA 4I49A 1YVKA 3D2MA 2P6FA 2RNKA 1NSAA 4M85A 2WYRA 3SJXA 4EMEA 3R9EA 2XEIA 1P4NA 2PJ8A 1ZR3A 3TO6A 3QB8A 5LRKA 4DYOA 4MFZA 4AVCA 2JZEA 2KCWA 5FSVA 3I1UA 2V8GA 3WC6A 3EWOA 4B10A 1TY8A 1YW6A 4IAVA 4ZI6A 3RZAA
chains in the Genus database with same CATH topology
2VRIA 4K3NA 1AMPA 3BHXA 3KI9A 3ISXA 5HVHA 3KASA 4PPZA 4P10A 2AFUA 4X8IA 3HUVA 4JVVA 5K8MA 4MCSA 4MHZA 1ELLP 4R7MA 1F57A 4MHPA 4OC5A 1CP7A 4A38A 2PJ5A 3GUXA 1YD9A 4K0CA 3PBEA 2V8VA 4NFRA 3WC7A 1TKHA 3SIJA 4J5QA 1ZR5A 2ZEOA 3H8FA 5LRGA 2PCUA 5K8PA 4IHMA 1CX8A 4GM5A 1LAPA 2GREA 4MHNA 3NH4A 3PBBA 3IIDA 5D8NA 4YU9A 4LQGA 1Z8LA 1CPSA 6CPAA 2PVVA 2ZELA 3B3VA 4JZ0A 3CPAA 4F9UA 2ZEFA 3EKEA 3T8WA 4PXCA 3D68A 4UEFA 2EEEA 4OIDA 1KWMA 3PB9X 3CDXA 3GQOA 1CBXA 2PJ4A 3LWUA 2CTCA 3B3CA 5FSXA 4F8ZA 3KR4A 3SIHA 1QQ9A 1AYEA 3PFOA 2ZOGA 1XRYA 1BLLE 2CTBA 3NH8A 2G9DA 8CPAA 5D29A 2BOAA 4NGPA 3MRUA 3PRTA 5HIHA 1DE4C 5F09A 4JYWA 1DTDA 5AILA 3S9MA 4MRIA 3KZWA 3EJGA 1VHUA 1HEEA 4OC3A 1R43A 4P4EA 2BCOA 7CPAA 4JLLA 2AFXA 2LGRA 3D7DA 2EK8A 2XEGA 3K9TA 3TC8A 4ZY1A 3PB7X 4P4FA 2XD7A 3V7ZA 2QJ8A 3FJUA 3IFEA 1TF8A 1CPXA 2ZENA 3FEDA 5E3BA 5LRJA 5CMSA 1HJZA 2ZEDA 4PXDA 4OC2A 2PJCA 4J4ZA 3IIBA 3D66A 4IQYA 3DLJA 1F2PA 1EE3P 3BI1A 5CB3A 4ONWA 4UEEA 4JGKA 3KHZA 4YWYA 1M4LA 3FF3A 4P4DA 4TWEA 1XFOA 4P44A 5DS0A 2PJ2A 1BPMA 1H8LA 4OKOA 1VHEA 3S9NA 4PQAA 2XEJA 1TF9A 2IMOA 3D67A 4NGQA 3KL9A 2AFZA 2Q4ZA 4F9VA 2FG1A 1LCPA 3ETIA 2V8HA 1XMBA 1CP6A 3KHXA 4ABLA 4PXEA 4OC0A 2PJ0A 3EW5A 1CG2A 4R6TA 4A94A 4TU0A 4OMEA 4EWTA 4NJQA 2CF4A 2AFWA 2PJ6A 2BO9A 4P6YA 3QNVA 4ZX8A 3KGQA 4UMLA 3WABA 5CBMA 5FSZA 4ZX9A 2VL1A 4JCAA 4UEZA 3VATA 3SIIA 2AFOA 4TNUA 4NGSA 1YW4A 1LFWA 2GLFA 4GVWA 1HDQA 1TKFA 3BI0A 3K2KA 1BAVA 2FVGA 2V8DA 4W9YA 3D7HA 3FEEA 2POKA 3SI2A 4H2KA 4X2TA 1XJOA 4CPAA 5K8OA 1R3NA 3MN8A 2JBJA 3KQZA 2PJ1A 5FSUA 2ZEMA 4DUKA 2ZOFA 2EWBA 3V2BA 3Q6ZA 4KYBA 2GLJA 3CT9A 3SJEA 5DUSA 2BFRA 4NGMA 1UWYA 3EJFA 1LANA 2GU2A 4BD9A 2JBKA 3IO1A 3PB8X 3N5FA 1VHOA 3EWQA 1Y7EA 1YMEA 3B35A 3B7IA 2AFMA 3NA6A 3TX8A 5CPAA 5HVFA 5LYLA 1FT7A 2JEWA 3EWPA 3FX6A 4NJRA 5I4MA 2PVWA 3GPGA 4OC1A 3S9LA 3PB6X 4KSIA 4G1PA 3VARA 4B6ZA 3NH5A 3B2YA 1ARMA 2FXKA 2IQ6A 2OOTA 1TXZA 2L8RA 3BXMA 4X3RA 4FBEA 2PIZA 5FSYA 3FVLA 4Q7AA 1ZG8A 4R8FA 2HC9A 4P4JA 4O23A 3RAMA 3V45A 2FAVA 1IY7A 5JGFA 2WZNA 4D86A 2O4HA 5JH9A 3IIFA 4MMOA 3KQXA 3CPXA 4AXVA 2I3CA 1ARLA 1ZG9A 4UIAA 2ACFA 5LYIA 3SI0A 2PJAA 3PEIA 3LMSA 1OBRA 1SPVA 2AFCA 2C6GA 4RUHA 3L2NA 2RB7A 4MHYA 3GPQA 2ZEGA 4A39A 3IJ3A 1XBUA 2ANPA 3D7GA 4FAIA 3H8GA 4ETKA 4GUAA 1YLOA 2ZEPA 3RBUA 2C1CA 2PJ9A 1VGYA 1Y0RA 4NGRA 1Z5RA 2DX6A 1FNOA 2QYVA 2PJ3A 4EFDA 3PB4X 2V77A 2O53A 5CB5A 1LOKA 3WT4A 3V38A 4J5RA 4FUUA 2F8HA 4FWUA 4Z65A 2AFSA 1RTQA 3D7FA 1TKJA 4OP4A 1IGBA 4MXUA 3KR5A 4R76A 3VFQA 3ISZA 4WWVA 2F7VA 4IK2A 3B3WA 1ZLHA 4WJBA 2NSMA 3PFEA 4NGNA 5J1QA 2Q51A 2PIYA 3FMCA 2QVPA 3B3SA 1Q7LA 1ZLIA 2X47A 2XEFA 4ESSA 1ELMP 5K8NA 4MCPA 2BFQA 1Z2LA 2Q43A 3SJGA 1Y0YA 2PJBA 3FH4A 1JQGA 2J9AA 4P4BA 5HVGA 3GPOA 1TXRA 2IJZA 4ZY0A 3IC1A 3SIGA 1ZG7A 4UIBA 3VH9A 4ZYQA 2PE3A 2PJ7A 4J5SA 4OC4A 1PYTB 2OR4A 1VIXA 1BPNA 3GQEA 3GB0A 2ABZA 3WC5A 3GLJA 5JM6A 3JZTA 5ELYA 3D4UA 3EWRA 3DGVA 3IEHA 5IB9A 1GYTA 3IWWA 2EK9A 4GVVA 3SJFA 1LAMA 4P4IA 2DEAA 5LYFA 4UF4A 4ETJA 4MCQA 4ZY2A 3FECA 4OIWA 3H8EA 3B3TA 2RFHA 2ZEHA 3SI1A 4MCRA 5HXDA 3HLPA 1PCAA 5LYDA 5HOLA 3NFZA 4A37A 2C6PA 1NJRA 5THWA 4P45A 1YSJA 4ABKA 2CIJA 2HB6A 2ZEEA 4DJLA 2C6CA 4PXBA 1QMUA 3Q71A 4NGTA 1HDUA 2NYQA 3JRUA 2PRQA 1F2OA 3SJXA 1NSAA 2WYRA 4EMEA 2XEIA 2PJ8A 1ZR3A 5LRKA 4DYOA 3I1UA 5FSVA 2V8GA 3WC6A 3EWOA 1TY8A 1YW6A 4IAVA 4ZI6A 3RZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRI A;  4K3N A;  1AMP A;  3BHX A;  3KI9 A;  3ISX A;  5HVH A;  3KAS A;  4PPZ A;  4P10 A;  2AFU A;  4X8I A;  3HUV A;  4JVV A;  5K8M A;  4MCS A;  4MHZ A;  1ELL P;  4R7M A;  1F57 A;  4MHP A;  4OC5 A;  1CP7 A;  4A38 A;  2PJ5 A;  3GUX A;  1YD9 A;  4K0C A;  3PBE A;  2V8V A;  4NFR A;  3WC7 A;  1TKH A;  3SIJ A;  4J5Q A;  1ZR5 A;  2ZEO A;  3H8F A;  5LRG A;  2PCU A;  5K8P A;  4IHM A;  1CX8 A;  4GM5 A;  1LAP A;  2GRE A;  4MHN A;  3NH4 A;  3PBB A;  3IID A;  5D8N A;  4YU9 A;  4LQG A;  1Z8L A;  1CPS A;  6CPA A;  2PVV A;  2ZEL A;  3B3V A;  4JZ0 A;  3CPA A;  4F9U A;  2ZEF A;  3EKE A;  3T8W A;  4PXC A;  3D68 A;  4UEF A;  2EEE A;  4OID A;  1KWM A;  3PB9 X;  3CDX A;  3GQO A;  1CBX A;  2PJ4 A;  3LWU A;  2CTC A;  3B3C A;  5FSX A;  4F8Z A;  3KR4 A;  3SIH A;  1QQ9 A;  1AYE A;  3PFO A;  2ZOG A;  1XRY A;  1BLL E;  2CTB A;  3NH8 A;  2G9D A;  8CPA A;  5D29 A;  2BOA A;  4NGP A;  3MRU A;  3PRT A;  5HIH A;  1DE4 C;  5F09 A;  4JYW A;  1DTD A;  5AIL A;  3S9M A;  4MRI A;  3KZW A;  3EJG A;  1VHU A;  1HEE A;  4OC3 A;  1R43 A;  4P4E A;  2BCO A;  7CPA A;  4JLL A;  2AFX A;  2LGR A;  3D7D A;  2EK8 A;  2XEG A;  3K9T A;  3TC8 A;  4ZY1 A;  3PB7 X;  4P4F A;  2XD7 A;  3V7Z A;  2QJ8 A;  3FJU A;  3IFE A;  1TF8 A;  1CPX A;  2ZEN A;  3FED A;  5E3B A;  5LRJ A;  5CMS A;  1HJZ A;  2ZED A;  4PXD A;  4OC2 A;  2PJC A;  4J4Z A;  3IIB A;  3D66 A;  4IQY A;  3DLJ A;  1F2P A;  1EE3 P;  3BI1 A;  5CB3 A;  4ONW A;  4UEE A;  4JGK A;  3KHZ A;  4YWY A;  1M4L A;  3FF3 A;  4P4D A;  4TWE A;  1XFO A;  4P44 A;  5DS0 A;  2PJ2 A;  1BPM A;  1H8L A;  4OKO A;  1VHE A;  3S9N A;  4PQA A;  2XEJ A;  1TF9 A;  2IMO A;  3D67 A;  4NGQ A;  3KL9 A;  2AFZ A;  2Q4Z A;  4F9V A;  2FG1 A;  1LCP A;  3ETI A;  2V8H A;  1XMB A;  1CP6 A;  3KHX A;  4ABL A;  4PXE A;  4OC0 A;  2PJ0 A;  3EW5 A;  1CG2 A;  4R6T A;  4A94 A;  4TU0 A;  4OME A;  4EWT A;  4NJQ A;  2CF4 A;  2AFW A;  2PJ6 A;  2BO9 A;  4P6Y A;  3QNV A;  4ZX8 A;  3KGQ A;  4UML A;  3WAB A;  5CBM A;  5FSZ A;  4ZX9 A;  2VL1 A;  4JCA A;  4UEZ A;  3VAT A;  3SII A;  2AFO A;  4TNU A;  4NGS A;  1YW4 A;  1LFW A;  2GLF A;  4GVW A;  1HDQ A;  1TKF A;  3BI0 A;  3K2K A;  1BAV A;  2FVG A;  2V8D A;  4W9Y A;  3D7H A;  3FEE A;  2POK A;  3SI2 A;  4H2K A;  4X2T A;  1XJO A;  4CPA A;  5K8O A;  1R3N A;  3MN8 A;  2JBJ A;  3KQZ A;  2PJ1 A;  5FSU A;  2ZEM A;  4DUK A;  2ZOF A;  2EWB A;  3V2B A;  3Q6Z A;  4KYB A;  2GLJ A;  3CT9 A;  3SJE A;  5DUS A;  2BFR A;  4NGM A;  1UWY A;  3EJF A;  1LAN A;  2GU2 A;  4BD9 A;  2JBK A;  3IO1 A;  3PB8 X;  3N5F A;  1VHO A;  3EWQ A;  1Y7E A;  1YME A;  3B35 A;  3B7I A;  2AFM A;  3NA6 A;  3TX8 A;  5CPA A;  5HVF A;  5LYL A;  1FT7 A;  2JEW A;  3EWP A;  3FX6 A;  4NJR A;  5I4M A;  2PVW A;  3GPG A;  4OC1 A;  3S9L A;  3PB6 X;  4KSI A;  4G1P A;  3VAR A;  4B6Z A;  3NH5 A;  3B2Y A;  1ARM A;  2FXK A;  2IQ6 A;  2OOT A;  1TXZ A;  2L8R A;  3BXM A;  4X3R A;  4FBE A;  2PIZ A;  5FSY A;  3FVL A;  4Q7A A;  1ZG8 A;  4R8F A;  2HC9 A;  4P4J A;  4O23 A;  3RAM A;  3V45 A;  2FAV A;  1IY7 A;  5JGF A;  2WZN A;  4D86 A;  2O4H A;  5JH9 A;  3IIF A;  4MMO A;  3KQX A;  3CPX A;  4AXV A;  2I3C A;  1ARL A;  1ZG9 A;  4UIA A;  2ACF A;  5LYI A;  3SI0 A;  2PJA A;  3PEI A;  3LMS A;  1OBR A;  1SPV A;  2AFC A;  2C6G A;  4RUH A;  3L2N A;  2RB7 A;  4MHY A;  3GPQ A;  2ZEG A;  4A39 A;  3IJ3 A;  1XBU A;  2ANP A;  3D7G A;  4FAI A;  3H8G A;  4ETK A;  4GUA A;  1YLO A;  2ZEP A;  3RBU A;  2C1C A;  2PJ9 A;  1VGY A;  1Y0R A;  4NGR A;  1Z5R A;  2DX6 A;  1FNO A;  2QYV A;  2PJ3 A;  4EFD A;  3PB4 X;  2V77 A;  2O53 A;  5CB5 A;  1LOK A;  3WT4 A;  3V38 A;  4J5R A;  4FUU A;  2F8H A;  4FWU A;  4Z65 A;  2AFS A;  1RTQ A;  3D7F A;  1TKJ A;  4OP4 A;  1IGB A;  4MXU A;  3KR5 A;  4R76 A;  3VFQ A;  3ISZ A;  4WWV A;  2F7V A;  4IK2 A;  3B3W A;  1ZLH A;  4WJB A;  2NSM A;  3PFE A;  4NGN A;  5J1Q A;  2Q51 A;  2PIY A;  3FMC A;  2QVP A;  3B3S A;  1Q7L A;  1ZLI A;  2X47 A;  2XEF A;  4ESS A;  1ELM P;  5K8N A;  4MCP A;  2BFQ A;  1Z2L A;  2Q43 A;  3SJG A;  1Y0Y A;  2PJB A;  3FH4 A;  1JQG A;  2J9A A;  4P4B A;  5HVG A;  3GPO A;  1TXR A;  2IJZ A;  4ZY0 A;  3IC1 A;  3SIG A;  1ZG7 A;  4UIB A;  3VH9 A;  4ZYQ A;  2PE3 A;  2PJ7 A;  4J5S A;  4OC4 A;  1PYT B;  2OR4 A;  1VIX A;  1BPN A;  3GQE A;  3GB0 A;  2ABZ A;  3WC5 A;  3GLJ A;  5JM6 A;  3JZT A;  5ELY A;  3D4U A;  3EWR A;  3DGV A;  3IEH A;  5IB9 A;  1GYT A;  3IWW A;  2EK9 A;  4GVV A;  3SJF A;  1LAM A;  4P4I A;  2DEA A;  5LYF A;  4UF4 A;  4ETJ A;  4MCQ A;  4ZY2 A;  3FEC A;  4OIW A;  3H8E A;  3B3T A;  2RFH A;  2ZEH A;  3SI1 A;  4MCR A;  5HXD A;  3HLP A;  1PCA A;  5LYD A;  5HOL A;  3NFZ A;  4A37 A;  2C6P A;  1NJR A;  5THW A;  4P45 A;  1YSJ A;  4ABK A;  2CIJ A;  2HB6 A;  2ZEE A;  4DJL A;  2C6C A;  4PXB A;  1QMU A;  3Q71 A;  4NGT A;  1HDU A;  2NYQ A;  3JRU A;  2PRQ A;  1F2O A;  3SJX A;  1NSA A;  2WYR A;  4EME A;  2XEI A;  2PJ8 A;  1ZR3 A;  5LRK A;  4DYO A;  3I1U A;  5FSV A;  2V8G A;  3WC6 A;  3EWO A;  1TY8 A;  1YW6 A;  4IAV A;  4ZI6 A;  3RZA A; 
#chains in the Genus database with same CATH topology
 2VRI A;  4XNH C;  3DDD A;  4K3N A;  1AMP A;  3EXN A;  3I3G A;  3BHX A;  1AUG A;  2QIR A;  4A31 A;  3KI9 A;  2B58 A;  3ISX A;  3EO4 A;  5HVH A;  1S7F A;  3KAS A;  2VZY A;  4PPZ A;  4P10 A;  2AFU A;  3LD2 A;  4X8I A;  3HUV A;  4JVV A;  5K8M A;  4MCS A;  4UWJ A;  3H4Q A;  1ELL P;  4MHZ A;  4CYQ A;  4A32 A;  4R7M A;  1F57 A;  4MHP A;  2F5I A;  4OC5 A;  1I1D A;  1CP7 A;  4A38 A;  1S3Z A;  2PJ5 A;  2FSR A;  2FS5 A;  1YD9 A;  3GUX A;  3W6X A;  4KUA A;  4K0C A;  3PBE A;  5JQ4 A;  2FE7 A;  2V8V A;  3I9S A;  3NE7 A;  3P2H A;  4NFR A;  4CGO A;  2JZD A;  1TKH A;  3WC7 A;  3SIJ A;  4J5Q A;  1ZR5 A;  3E0K A;  2ZEO A;  3H8F A;  5LRG A;  4CS0 B;  1BO4 A;  1JWQ A;  2PCU A;  4Y49 C;  4C2Z A;  4CGP A;  2OZH A;  3DR6 A;  4ONU A;  4A30 A;  5K8P A;  4IHM A;  1CX8 A;  4QB9 A;  4GM5 A;  1Q2Y A;  1LAP A;  2D4O A;  5EC4 A;  2WUU A;  1S7K A;  2GRE A;  3IU2 A;  4MHN A;  1XOV A;  3NH4 A;  2WPW A;  3IU1 A;  3IID A;  3PBB A;  5D8N A;  3EC4 A;  4YU9 A;  5AGE A;  4LQG A;  2B3V A;  1Z9U A;  1Z8L A;  2Z11 A;  1CPS A;  6CPA A;  2PVV A;  2ZEL A;  3B3V A;  4JZ0 A;  1MK4 A;  4UBR A;  3CPA A;  4AVB A;  3TOB A;  4F9U A;  2ZEF A;  3EKE A;  4MFK A;  2Z3O A;  3T8W A;  4PV6 A;  4YGO A;  4PXC A;  2FIA A;  3D68 A;  4UEF A;  4F0X A;  4KVX A;  1BOB A;  3D2P A;  1NE9 A;  2IL4 A;  3CZX A;  4JJX A;  1NSL A;  2EEE A;  1S5K A;  3FBU A;  2VEZ A;  4OID A;  1KWM A;  3PB9 X;  3CDX A;  1IB1 E;  4C7I A;  2JDD A;  4JWP A;  5HH1 A;  4MXU A;  2P6E A;  4FD5 A;  3FXT A;  5IV0 A;  1MJ9 A;  3TO9 A;  2K5T A;  3WR7 A;  2P6G A;  3GQO A;  4MFQ A;  1CBX A;  2PJ4 A;  3R96 A;  3LWU A;  2CTC A;  3B3C A;  5FSX A;  4NF1 A;  4F8Z A;  3KR4 A;  3SIH A;  1QQ9 A;  2DF5 A;  3DSB A;  1AYE A;  3PFO A;  4CGM A;  2ZOG A;  1M4I A;  2Q44 A;  1XRY A;  4MFL A;  1Y9K A;  4OAE A;  1BLL E;  2CTB A;  3NH8 A;  4A2Z A;  4AG7 A;  2G9D A;  8CPA A;  2Z10 A;  5D29 A;  2BOA A;  4NGP A;  2WCT A;  3MRU A;  1N71 A;  5HIH A;  1DE4 C;  3EY5 A;  3PRT A;  5F09 A;  4CRZ B;  4JYW A;  1DTD A;  5AIL A;  2Y0M A;  3S9M A;  2DXQ A;  3PP9 A;  4MRI A;  3KZW A;  4NSQ A;  3EJG A;  1LRZ A;  4B14 A;  5KTD A;  1X10 A;  1VHU A;  3K9U A;  1M4D A;  1HEE A;  4OC3 A;  4R3K A;  4F6A A;  1R43 A;  4CYN A;  4P4E A;  1U6M A;  4M6G A;  2BCO A;  3FNC A;  7CPA A;  1WK4 A;  2FL4 A;  2ZW5 A;  4JLL A;  3TO7 A;  1R57 A;  2AFX A;  2D4P A;  2LGR A;  3D7D A;  1PU9 A;  1YVO A;  1L0C A;  1M4G A;  2EK8 A;  2REE A;  3LAC A;  4NCZ A;  3C26 A;  1QSM A;  1IOF A;  1KUV A;  1M1D A;  2XEG A;  3K9T A;  4KOT A;  3TC8 A;  4ZY1 A;  3PB7 X;  1XIX A;  4R57 A;  4P4F A;  4FD6 A;  2XD7 A;  3IGR A;  3V7Z A;  2QJ8 A;  3FJU A;  2ARH A;  4CAV A;  3IFE A;  1TF8 A;  1CPX A;  2ZW4 A;  1CJW A;  1Y7R A;  2ZEN A;  3FED A;  5E3B A;  4M6I A;  1S7N A;  5LRJ A;  5CMS A;  1B87 A;  1HJZ A;  2CXA A;  2GAN A;  2ZED A;  4XPD C;  5DWN A;  1YLE A;  4PXD A;  4HNY B;  4OC2 A;  2PJC A;  1X12 A;  4CYP A;  4J4Z A;  3IIB A;  3D66 A;  3FRM A;  1FY7 A;  4IQY A;  3DLJ A;  1F2P A;  4CAW A;  1EE3 P;  4UFW A;  3BI1 A;  5CB3 A;  4B12 A;  4ONW A;  5I0C A;  4UEE A;  4JGK A;  2YGW A;  3KHZ A;  4YWY A;  1M4L A;  3FF3 A;  4P4D A;  4TWE A;  4E2A A;  5G20 A;  1XFO A;  2PSW A;  3BJ8 A;  4P44 A;  2DPS A;  2Q04 A;  4QBJ A;  5JPH A;  5DS0 A;  3KKW A;  2PJ2 A;  5AG7 A;  1BPM A;  1H8L A;  3R95 A;  2B4D A;  4OKO A;  1VHE A;  4Q36 A;  3S9N A;  4PQA A;  1Q2D A;  3DNS A;  4LQ6 A;  4H6U A;  2XEJ A;  1TF9 A;  2YNC C;  4B5P A;  2IMO A;  3D67 A;  4NGQ A;  3KL9 A;  2B4D B;  2AFZ A;  2Q4Z A;  5KTA A;  4F9V A;  2FG1 A;  1GHE A;  1LCP A;  3NE8 A;  4L89 A;  2Z3N A;  3ETI A;  2J8N A;  2V8H A;  1XMB A;  4NEX A;  3TCV A;  3SXN A;  1CP6 A;  3KHX A;  4ABL A;  2BUE A;  4PXE A;  4B5P B;  3S6K A;  4OC0 A;  3D3S A;  2PJ0 A;  4DNC A;  3EW5 A;  1CG2 A;  1PUA A;  1UFH A;  4R6T A;  5LYL A;  4UFV A;  5GCN A;  2HQY A;  4KZT A;  4A94 A;  4BMH A;  3H5Z A;  5H86 A;  2RC4 A;  4TU0 A;  3FB3 A;  4OME A;  4KLW A;  4B5O A;  2VBQ A;  2ZW6 A;  1YX0 A;  2J8R A;  4EWT A;  2Q7S A;  4NJQ A;  2CF4 A;  2AFW A;  2PJ6 A;  2BO9 A;  2EUI A;  4JXR A;  3TOA A;  4P6Y A;  3TE4 A;  3QNV A;  3G8W A;  2R7H A;  4ZX8 A;  2KQV A;  3KGQ A;  3TFY A;  4UML A;  3WAB A;  5CBM A;  5FSZ A;  4ZX9 A;  2VL1 A;  4JCA A;  4HPS A;  1QST A;  2ZXV A;  4UEZ A;  3VAT A;  3A9L A;  3SII A;  5AG4 A;  4YRH A;  3CXP A;  2Q7B A;  2AFO A;  4TNU A;  3N7Z A;  4NGS A;  4CRY B;  4II9 A;  1YW4 A;  2Z3L A;  1S7L A;  1LFW A;  2GLF A;  2JDC A;  4GVW A;  1HDQ A;  2PC1 A;  1TKF A;  3BI0 A;  3K2K A;  1BAV A;  3QAY A;  4C2X A;  2FVG A;  2V8D A;  2BEI A;  4W9Y A;  5AG6 A;  3D7H A;  2GIV A;  2GE3 A;  3FEE A;  4L8A A;  4MJ8 A;  2POK A;  3RO0 A;  4NXY A;  3SHP A;  3SI2 A;  4H2K A;  4JLY A;  4X2T A;  1XJO A;  2Z3K A;  4CPA A;  5K8O A;  2H5M A;  3RNZ A;  1XF8 A;  2R1I A;  3GY9 A;  3UY5 A;  1R3N A;  1Z8T A;  3MN8 A;  5CNP A;  5F47 A;  2JBJ A;  3KQZ A;  2J8M A;  2PJ1 A;  5FSU A;  2ZEM A;  4U9Z A;  2EWB A;  2ZOF A;  3V2B A;  4DUK A;  3Q6Z A;  4KYB A;  2GLJ A;  2AJ6 A;  3CT9 A;  3SJE A;  5G1Z A;  4H6Z A;  5DUS A;  2Z3P A;  2BFR A;  4JXQ A;  4NGM A;  5G22 A;  1UWY A;  4HNX B;  2W2G A;  3EJF A;  2Q4V A;  1LAN A;  2GU2 A;  1SQH A;  4FD7 A;  4BD9 A;  2JBK A;  3IO1 A;  3PB8 X;  3N5F A;  4LUA A;  5FVJ A;  1VHO A;  2R98 A;  3EWQ A;  1Y7E A;  1YME A;  3B35 A;  1YQE A;  4LX9 A;  3B7I A;  2AFM A;  3NA6 A;  3T90 A;  3TX8 A;  4KOU A;  2JLM A;  5CPA A;  5HVF A;  1FT7 A;  2JEW A;  3EWP A;  3IWE A;  4Y49 B;  4BIN A;  3FX6 A;  1VHS A;  1A2Z A;  2OB0 A;  2REF A;  4NJR A;  5I4M A;  2PVW A;  4A33 A;  4YFJ A;  3DR8 A;  3GPG A;  4C2Y A;  4C7H A;  4OC1 A;  3S9L A;  3PB6 X;  4KSI A;  4G1P A;  3VAR A;  1YR0 A;  3R1K A;  3NH5 A;  4B6Z A;  1VKC A;  2ZPA A;  3B2Y A;  3P2F A;  4MY3 A;  1ARM A;  3R9F A;  5G21 A;  2FXK A;  2IQ6 A;  4GXH A;  2OOT A;  4K30 A;  1TXZ A;  3S6H A;  2L8R A;  3BXM A;  1QSR A;  4X3R A;  4KS9 A;  4FBE A;  2PIZ A;  3JVN A;  5FSY A;  4RN7 A;  5F46 A;  1MJA A;  1YK3 A;  2EVN A;  3FVL A;  4Q7A A;  1ZG8 A;  4R8F A;  2HC9 A;  3R9G A;  5A27 A;  1IYK A;  4P4J A;  5E96 A;  4O23 A;  3RAM A;  3V45 A;  2FAV A;  1XE4 A;  1IY7 A;  1J4J A;  1WWZ A;  2CNT A;  4H89 A;  1NMT A;  2WSA A;  3BJ7 A;  1KZF A;  3QAH A;  5JGF A;  5ISV A;  2WZN A;  4D86 A;  2O4H A;  5JH9 A;  4QC6 A;  3G3S A;  3IIF A;  1M44 A;  3EFA A;  2Q4Y A;  2CNM A;  4MMO A;  4AG9 A;  3KQX A;  3CPX A;  1I21 A;  4AXV A;  5BWA B;  2I3C A;  4PK2 A;  1ARL A;  1ZG9 A;  4KVO E;  4UIA A;  3SXO A;  3OWC A;  2ACF A;  5LYI A;  4OAD A;  2FCK A;  3SI0 A;  4KSA A;  2PJA A;  1IID A;  1IU8 A;  3PEI A;  3LMS A;  1OBR A;  1SPV A;  1ZO0 A;  2YND A;  4KOS A;  4KOW A;  2AFC A;  4ZBG A;  4R87 A;  3LOD A;  3BLN A;  2C6G A;  3D8P A;  4RUH A;  3L2N A;  2RB7 A;  4MHY A;  3GPQ A;  2ZEG A;  5F48 A;  2B5G A;  4A39 A;  3IJ3 A;  1XBU A;  2ANP A;  3D7G A;  2QML A;  4XPL A;  4FAI A;  3H8G A;  4C68 A;  4ETK A;  4GUA A;  2YNE A;  4UWI A;  1YLO A;  2Z0Z A;  2ZEP A;  3RBU A;  2C1C A;  4KOX A;  4U5Y A;  2PJ9 A;  4PK3 A;  4B11 A;  1VGY A;  4U9Y A;  2BL1 A;  4KOV A;  1Y0R A;  4NGR A;  1Z5R A;  3W91 A;  2B5G B;  2DX6 A;  1FNO A;  2G0B A;  3IWG A;  4GS4 A;  1YRE A;  2QYV A;  2JZF A;  2PJ3 A;  1TIQ A;  4Q38 A;  4EFD A;  1ON0 A;  3PB4 X;  3TTH A;  4PSX A;  2V77 A;  4UCN A;  4ORF A;  3T9Y A;  4ZGY B;  4RS2 A;  3RYO A;  4OLL A;  2O53 A;  5CB5 A;  1LOK A;  1Z4R A;  4BBH A;  3WT4 A;  3GKR A;  4UFX A;  3V38 A;  3FIX A;  4KSF A;  4J5R A;  4FUU A;  4XPD B;  5EBV A;  2F8H A;  4FWU A;  5KTC A;  4Z65 A;  4J3G A;  4KOR A;  2AFS A;  1RTQ A;  3D7F A;  1TKJ A;  5C88 A;  4OP4 A;  2OU2 A;  5EMI A;  3TT2 A;  1IGB A;  1QSN A;  2VXK A;  3KR5 A;  4R76 A;  3VFQ A;  1RXT A;  3ISZ A;  2F7V A;  2VI7 A;  4IK2 A;  1XMT A;  4WWV A;  4QUS A;  5C82 A;  4XPK A;  3B3W A;  4AB7 A;  1ZLH A;  2PR1 A;  4WJB A;  2NSM A;  3PGP A;  3PFE A;  4R9M A;  3MGD A;  2PDO A;  3PZJ A;  4KUB A;  3F8K A;  4IUS A;  4NGN A;  2NMT A;  5J1Q A;  2Q51 A;  4M3S A;  2PIY A;  5IX3 A;  2YNC A;  3FMC A;  2QVP A;  3S6F A;  3B3S A;  2O28 A;  4M6H A;  1Q7L A;  4MHD A;  4CGL A;  1Z4E A;  1Z8W A;  2PRB A;  2B3U A;  4RI1 A;  1ZLI A;  5DWM A;  2X47 A;  4UCM A;  4XNH B;  5AG5 A;  2WPX A;  2XEF A;  2AE6 A;  4ESS A;  2EO8 A;  1ELM P;  1CM0 A;  4MY0 A;  1S60 A;  5K8N A;  1YGH A;  4KVM E;  4PSW A;  1K4J A;  5J8C A;  1RO5 A;  2BFQ A;  1Z2L A;  2PR8 A;  2VQY A;  3F5B A;  2Q43 A;  4KLV A;  2X7B A;  4MCP A;  4UCP A;  3SJG A;  1Y0Y A;  3VWE A;  2PJB A;  4CGN A;  1KUX A;  2G3A A;  2I79 A;  3FH4 A;  1QSO A;  2ODF A;  4MFP A;  4F0Y A;  1JQG A;  3V8I A;  2J9A A;  2A4N A;  2GFQ A;  4P4B A;  5H84 A;  3GPO A;  4CAX A;  1TXR A;  2FXF A;  5HVG A;  2IJZ A;  4ZY0 A;  3IC1 A;  4E8O A;  1I12 A;  5IB0 A;  4HKF A;  3SIG A;  1ZG7 A;  2OZU A;  3ZJ0 A;  4A95 A;  4UIB A;  3VH9 A;  4ZYQ A;  2PE3 A;  1KUY A;  2FT0 A;  2QEC A;  4FD4 A;  4AVA A;  2JEV A;  2FIW A;  4J5S A;  2PJ7 A;  4OC4 A;  5J8F A;  3S6G A;  2B4B A;  4UA3 A;  2R8V A;  3GIU A;  4CAF A;  1PYT B;  2OR4 A;  4IF5 A;  4X5K A;  1VIX A;  1IIC A;  1BPN A;  3GQE A;  3GB0 A;  2ABZ A;  3WC5 A;  3GLJ A;  4KOY A;  2HUZ A;  5JM6 A;  4QVT A;  3JZT A;  5ELY A;  3D4U A;  3EWR A;  1MJB A;  2VZZ A;  3DGV A;  3CXQ A;  2ATR A;  1GYT A;  3IEH A;  5IB9 A;  3IWW A;  2EK9 A;  4MFJ A;  4E0A A;  4GVV A;  2CNS A;  4MBU A;  3SJF A;  1LAM A;  4P4I A;  2DEA A;  3FYN A;  4UF4 A;  5LYF A;  4ETJ A;  4MCQ A;  4ZY2 A;  3FEC A;  4HNW B;  4CAE A;  4MI4 A;  4OIW A;  5HMN A;  2P0W A;  5F49 A;  2ZW7 A;  1OZP A;  3H8E A;  3B3T A;  2CY2 A;  2RFH A;  2ZEH A;  3SI1 A;  4MCR A;  4EVY A;  1IYL A;  2G3T A;  1Z8X A;  2PQ8 A;  3F0A A;  5HXD A;  3HLP A;  1Y9W A;  1PCA A;  2BSW A;  5LYD A;  2HV2 A;  5HOL A;  3JTK A;  1V0C A;  2OZG A;  2Q0Y A;  3NFZ A;  3W6S A;  4A37 A;  2C6P A;  1P0H A;  1Q2C A;  2Z3M A;  3GYA A;  2OH1 A;  1NJR A;  3JUW A;  5THW A;  2C27 A;  1YSJ A;  4P45 A;  1IOI A;  4ABK A;  1B6B A;  4JD6 A;  4B13 A;  2CIJ A;  2HB6 A;  3ZZI A;  2ZEE A;  4DJL A;  2C6C A;  3B8G A;  4R3L A;  1XEB A;  2I00 A;  4PXB A;  1QMU A;  3CXS A;  3VWD A;  5A28 A;  2EBJ A;  3Q71 A;  4NGT A;  1HDU A;  2NYQ A;  3JRU A;  2PRQ A;  4CYO A;  1F2O A;  2DPT A;  4I49 A;  1YVK A;  3D2M A;  2P6F A;  2RNK A;  1NSA A;  4M85 A;  2WYR A;  3SJX A;  4EME A;  3R9E A;  2XEI A;  1P4N A;  2PJ8 A;  1ZR3 A;  3TO6 A;  3QB8 A;  5LRK A;  4DYO A;  4MFZ A;  4AVC A;  2JZE A;  2KCW A;  5FSV A;  3I1U A;  2V8G A;  3WC6 A;  3EWO A;  4B10 A;  1TY8 A;  1YW6 A;  4IAV A;  4ZI6 A;  3RZA A; 
#chains in the Genus database with same CATH homology
 2VRI A;  4K3N A;  1AMP A;  3BHX A;  3KI9 A;  3ISX A;  5HVH A;  3KAS A;  4PPZ A;  4P10 A;  2AFU A;  4X8I A;  3HUV A;  4JVV A;  5K8M A;  4MCS A;  4MHZ A;  1ELL P;  4R7M A;  1F57 A;  4MHP A;  4OC5 A;  1CP7 A;  4A38 A;  2PJ5 A;  3GUX A;  1YD9 A;  4K0C A;  3PBE A;  2V8V A;  4NFR A;  3WC7 A;  1TKH A;  3SIJ A;  4J5Q A;  1ZR5 A;  2ZEO A;  3H8F A;  5LRG A;  2PCU A;  5K8P A;  4IHM A;  1CX8 A;  4GM5 A;  1LAP A;  2GRE A;  4MHN A;  3NH4 A;  3PBB A;  3IID A;  5D8N A;  4YU9 A;  4LQG A;  1Z8L A;  1CPS A;  6CPA A;  2PVV A;  2ZEL A;  3B3V A;  4JZ0 A;  3CPA A;  4F9U A;  2ZEF A;  3EKE A;  3T8W A;  4PXC A;  3D68 A;  4UEF A;  2EEE A;  4OID A;  1KWM A;  3PB9 X;  3CDX A;  3GQO A;  1CBX A;  2PJ4 A;  3LWU A;  2CTC A;  3B3C A;  5FSX A;  4F8Z A;  3KR4 A;  3SIH A;  1QQ9 A;  1AYE A;  3PFO A;  2ZOG A;  1XRY A;  1BLL E;  2CTB A;  3NH8 A;  2G9D A;  8CPA A;  5D29 A;  2BOA A;  4NGP A;  3MRU A;  3PRT A;  5HIH A;  1DE4 C;  5F09 A;  4JYW A;  1DTD A;  5AIL A;  3S9M A;  4MRI A;  3KZW A;  3EJG A;  1VHU A;  1HEE A;  4OC3 A;  1R43 A;  4P4E A;  2BCO A;  7CPA A;  4JLL A;  2AFX A;  2LGR A;  3D7D A;  2EK8 A;  2XEG A;  3K9T A;  3TC8 A;  4ZY1 A;  3PB7 X;  4P4F A;  2XD7 A;  3V7Z A;  2QJ8 A;  3FJU A;  3IFE A;  1TF8 A;  1CPX A;  2ZEN A;  3FED A;  5E3B A;  5LRJ A;  5CMS A;  1HJZ A;  2ZED A;  4PXD A;  4OC2 A;  2PJC A;  4J4Z A;  3IIB A;  3D66 A;  4IQY A;  3DLJ A;  1F2P A;  1EE3 P;  3BI1 A;  5CB3 A;  4ONW A;  4UEE A;  4JGK A;  3KHZ A;  4YWY A;  1M4L A;  3FF3 A;  4P4D A;  4TWE A;  1XFO A;  4P44 A;  5DS0 A;  2PJ2 A;  1BPM A;  1H8L A;  4OKO A;  1VHE A;  3S9N A;  4PQA A;  2XEJ A;  1TF9 A;  2IMO A;  3D67 A;  4NGQ A;  3KL9 A;  2AFZ A;  2Q4Z A;  4F9V A;  2FG1 A;  1LCP A;  3ETI A;  2V8H A;  1XMB A;  1CP6 A;  3KHX A;  4ABL A;  4PXE A;  4OC0 A;  2PJ0 A;  3EW5 A;  1CG2 A;  4R6T A;  4A94 A;  4TU0 A;  4OME A;  4EWT A;  4NJQ A;  2CF4 A;  2AFW A;  2PJ6 A;  2BO9 A;  4P6Y A;  3QNV A;  4ZX8 A;  3KGQ A;  4UML A;  3WAB A;  5CBM A;  5FSZ A;  4ZX9 A;  2VL1 A;  4JCA A;  4UEZ A;  3VAT A;  3SII A;  2AFO A;  4TNU A;  4NGS A;  1YW4 A;  1LFW A;  2GLF A;  4GVW A;  1HDQ A;  1TKF A;  3BI0 A;  3K2K A;  1BAV A;  2FVG A;  2V8D A;  4W9Y A;  3D7H A;  3FEE A;  2POK A;  3SI2 A;  4H2K A;  4X2T A;  1XJO A;  4CPA A;  5K8O A;  1R3N A;  3MN8 A;  2JBJ A;  3KQZ A;  2PJ1 A;  5FSU A;  2ZEM A;  4DUK A;  2ZOF A;  2EWB A;  3V2B A;  3Q6Z A;  4KYB A;  2GLJ A;  3CT9 A;  3SJE A;  5DUS A;  2BFR A;  4NGM A;  1UWY A;  3EJF A;  1LAN A;  2GU2 A;  4BD9 A;  2JBK A;  3IO1 A;  3PB8 X;  3N5F A;  1VHO A;  3EWQ A;  1Y7E A;  1YME A;  3B35 A;  3B7I A;  2AFM A;  3NA6 A;  3TX8 A;  5CPA A;  5HVF A;  5LYL A;  1FT7 A;  2JEW A;  3EWP A;  3FX6 A;  4NJR A;  5I4M A;  2PVW A;  3GPG A;  4OC1 A;  3S9L A;  3PB6 X;  4KSI A;  4G1P A;  3VAR A;  4B6Z A;  3NH5 A;  3B2Y A;  1ARM A;  2FXK A;  2IQ6 A;  2OOT A;  1TXZ A;  2L8R A;  3BXM A;  4X3R A;  4FBE A;  2PIZ A;  5FSY A;  3FVL A;  4Q7A A;  1ZG8 A;  4R8F A;  2HC9 A;  4P4J A;  4O23 A;  3RAM A;  3V45 A;  2FAV A;  1IY7 A;  5JGF A;  2WZN A;  4D86 A;  2O4H A;  5JH9 A;  3IIF A;  4MMO A;  3KQX A;  3CPX A;  4AXV A;  2I3C A;  1ARL A;  1ZG9 A;  4UIA A;  2ACF A;  5LYI A;  3SI0 A;  2PJA A;  3PEI A;  3LMS A;  1OBR A;  1SPV A;  2AFC A;  2C6G A;  4RUH A;  3L2N A;  2RB7 A;  4MHY A;  3GPQ A;  2ZEG A;  4A39 A;  3IJ3 A;  1XBU A;  2ANP A;  3D7G A;  4FAI A;  3H8G A;  4ETK A;  4GUA A;  1YLO A;  2ZEP A;  3RBU A;  2C1C A;  2PJ9 A;  1VGY A;  1Y0R A;  4NGR A;  1Z5R A;  2DX6 A;  1FNO A;  2QYV A;  2PJ3 A;  4EFD A;  3PB4 X;  2V77 A;  2O53 A;  5CB5 A;  1LOK A;  3WT4 A;  3V38 A;  4J5R A;  4FUU A;  2F8H A;  4FWU A;  4Z65 A;  2AFS A;  1RTQ A;  3D7F A;  1TKJ A;  4OP4 A;  1IGB A;  4MXU A;  3KR5 A;  4R76 A;  3VFQ A;  3ISZ A;  4WWV A;  2F7V A;  4IK2 A;  3B3W A;  1ZLH A;  4WJB A;  2NSM A;  3PFE A;  4NGN A;  5J1Q A;  2Q51 A;  2PIY A;  3FMC A;  2QVP A;  3B3S A;  1Q7L A;  1ZLI A;  2X47 A;  2XEF A;  4ESS A;  1ELM P;  5K8N A;  4MCP A;  2BFQ A;  1Z2L A;  2Q43 A;  3SJG A;  1Y0Y A;  2PJB A;  3FH4 A;  1JQG A;  2J9A A;  4P4B A;  5HVG A;  3GPO A;  1TXR A;  2IJZ A;  4ZY0 A;  3IC1 A;  3SIG A;  1ZG7 A;  4UIB A;  3VH9 A;  4ZYQ A;  2PE3 A;  2PJ7 A;  4J5S A;  4OC4 A;  1PYT B;  2OR4 A;  1VIX A;  1BPN A;  3GQE A;  3GB0 A;  2ABZ A;  3WC5 A;  3GLJ A;  5JM6 A;  3JZT A;  5ELY A;  3D4U A;  3EWR A;  3DGV A;  3IEH A;  5IB9 A;  1GYT A;  3IWW A;  2EK9 A;  4GVV A;  3SJF A;  1LAM A;  4P4I A;  2DEA A;  5LYF A;  4UF4 A;  4ETJ A;  4MCQ A;  4ZY2 A;  3FEC A;  4OIW A;  3H8E A;  3B3T A;  2RFH A;  2ZEH A;  3SI1 A;  4MCR A;  5HXD A;  3HLP A;  1PCA A;  5LYD A;  5HOL A;  3NFZ A;  4A37 A;  2C6P A;  1NJR A;  5THW A;  4P45 A;  1YSJ A;  4ABK A;  2CIJ A;  2HB6 A;  2ZEE A;  4DJL A;  2C6C A;  4PXB A;  1QMU A;  3Q71 A;  4NGT A;  1HDU A;  2NYQ A;  3JRU A;  2PRQ A;  1F2O A;  3SJX A;  1NSA A;  2WYR A;  4EME A;  2XEI A;  2PJ8 A;  1ZR3 A;  5LRK A;  4DYO A;  3I1U A;  5FSV A;  2V8G A;  3WC6 A;  3EWO A;  1TY8 A;  1YW6 A;  4IAV A;  4ZI6 A;  3RZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...