3KQZA

Structure of a protease 2
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords M17 leucyl aminopeptidase
total genus 177
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kqzA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kqzA02
2AFXA 4NFRA 5FSZA 4X3RA 4UIBA 2ZEGA 5D8NA 2Q51A 8CPAA 5I4MA 4ZY1A 5LRKA 3ETIA 3FF3A 3NH4A 2F7VA 2EK9A 4FAIA 1Q7LA 2PJBA 2NSMA 1EE3P 4JCAA 3FH4A 3FJUA 4GM5A 2ACFA 2O53A 4F9VA 1YLOA 3EWQA 1LANA 3B35A 3GB0A 5CBMA 2BCOA 1TY8A 4JZ0A 3PFEA 4ZY2A 4ETKA 3BI0A 1TKHA 1FT7A 4EFDA 3KR5A 4MCPA 4PQAA 3HUVA 3IIFA 1VHOA 4NGSA 3DLJA 1CBXA 1TKJA 3EWPA 2GU2A 4Q7AA 2C6CA 2PJ7A 2WZNA 4UEZA 2PCUA 2GREA 3IIBA 3HLPA 3IC1A 2XEGA 2EEEA 2AFOA 2LGRA 3LMSA 5FSYA 2V77A 1UWYA 2C6PA 3K9TA 1BLLE 2I3CA 3TC8A 5LYLA 4ABLA 5DUSA 5ELYA 4BD9A 2V8VA 3VARA 3WABA 2BFQA 3VFQA 2DX6A 3WC6A 3SJFA 4KYBA 2C1CA 5AILA 3B3WA 5D29A 5JM6A 3KQXA 5J1QA 4NGTA 1HDQA 2EWBA 1Y7EA 4ZY0A 1ZG8A 3GPGA 3SIHA 1M4LA 1F2OA 3K2KA 2JBKA 4TWEA 4AXVA 1LCPA 4MHNA 4P10A 3H8EA 3RZAA 1LAPA 4PXCA 4JLLA 5LRGA 1XJOA 3LWUA 3SJXA 2C6GA 2ZELA 1CG2A 4P4JA 1TF9A 4P4FA 1RTQA 1XFOA 3ISXA 1YW4A 1LFWA 1SPVA 3D7HA 1VHUA 2HB6A 2PE3A 3EW5A 4NGMA 2POKA 3VATA 4DYOA 3CPXA 1ZR3A 4PXEA 1KWMA 4GVVA 5FSUA 5DS0A 3KHZA 4MHYA 3I1UA 3PB7X 3SJGA 4WJBA 3WT4A 3B7IA 4ZX9A 1TKFA 2PJ6A 2EK8A 1NSAA 1ELLP 2DEAA 3D67A 1CX8A 4MCQA 4J5RA 1ARMA 4MCSA 5FSVA 4W9YA 2PJAA 4OIDA 6CPAA 3T8WA 1PYTB 2HC9A 3SI0A 1AYEA 2WYRA 4X2TA 2QJ8A 3FEDA 3H8GA 1F57A 3H8FA 2G9DA 3MRUA 1OBRA 2PJCA 3B3SA 3PB6X 3BXMA 3V38A 4KSIA 2J9AA 4K0CA 1Y0YA 4DUKA 2XEFA 1R43A 4FUUA 4TNUA 1ZG9A 3B2YA 3D4UA 5K8NA 5CPAA 1Y0RA 2X47A 2FVGA 2ZEDA 3PB4X 4DJLA 4P4BA 2AFCA 3RBUA 3PFOA 2ZEOA 2OOTA 3B3VA 3EWRA 4MXUA 4R76A 2BOAA 4PPZA 1VIXA 3NH5A 1YW6A 2ZEFA 4K3NA 1BAVA 4ABKA 2XEJA 3KHXA 3EWOA 2V8GA 4GVWA 1CPSA 4F9UA 4J5QA 4O23A 2ABZA 1XRYA 3TX8A 4G1PA 1Z2LA 2AFUA 4IAVA 4P6YA 3RAMA 2BFRA 1QMUA 4GUAA 5K8MA 2IJZA 4X8IA 4R8FA 1ARLA 1CP6A 1LOKA 4H2KA 3SI2A 2CF4A 1NJRA 2VRIA 2PJ4A 1F2PA 4D86A 3S9NA 3B3TA 3PBBA 5CMSA 2V8DA 3GPOA 4Z65A 5K8PA 4ZYQA 1ZLIA 5LYIA 2PRQA 3WC7A 1CP7A 4UIAA 2PJ5A 3GUXA 4R7MA 4P44A 3CPAA 2ZEHA 3JZTA 1ZG7A 4ETJA 3KASA 1ELMP 3KGQA 4JVVA 3IFEA 3JRUA 3GQOA 5HVFA 2PJ1A 1H8LA 4F8ZA 1Z5RA 4P45A 1YD9A 4IQYA 3IWWA 2PJ3A 3KL9A 2NYQA 4OMEA 1LAMA 2BO9A 3V45A 3EKEA 2JBJA 3FVLA 3CDXA 4IK2A 3D7FA 1BPMA 3V2BA 4WWVA 4EMEA 2GLFA 4PXDA 4LQGA 4NJRA 4A38A 5THWA 3PEIA 3SIGA 2Q4ZA 4IHMA 4EWTA 3CT9A 4A39A 3FEEA 4JYWA 5LYFA 1TXZA 2ZOGA 2CTCA 1XMBA 2FG1A 4OC0A 5HVGA 2Q43A 3BHXA 3MN8A 4MHZA 4PXBA 5HXDA 1TF8A 4OC4A 1HEEA 4NGRA 4ONWA 4NGQA 2JEWA 3IIDA 5HVHA 2AFMA 3Q6ZA 3PRTA 5K8OA 4ESSA 4P4EA 3ISZA 5FSXA 1AMPA 1VHEA 1HDUA 1PCAA 1YMEA 4OC1A 4OC2A 2ZEMA 4P4IA 2ZEEA 4OKOA 2PIYA 2OR4A 5F09A 3B3CA 4OP4A 2FAVA 3GQEA 4MMOA 2PJ0A 5E3BA 3KQZA 3SI1A 2IQ6A 1CPXA 3D7GA 3SJEA 2L8RA 4FBEA 4UEFA 2QYVA 4NGNA 2ANPA 3PB9X 5JH9A 4CPAA 2VL1A 3DGVA 1DE4C 5HOLA 3NA6A 2RFHA 1ZLHA 4TU0A 4P4DA 5CB3A 2ZOFA 4FWUA 1VGYA 1R3NA 3NFZA 4J4ZA 2PVWA 3BI1A 3L2NA 1JQGA 2O4HA 4UMLA 4NGPA 3EJGA 4A94A 3PBEA 4RUHA 1YSJA 2PJ9A 3PB8X 2FXKA 3KI9A 2PVVA 4OC3A 4NJQA 1GYTA 4MRIA 2RB7A 2V8HA 3D68A 4R6TA 2XD7A 2AFSA 2GLJA 4OIWA 3KR4A 5IB9A 3IJ3A 5HIHA 3SIJA 2CIJA 4ZI6A 2F8HA 3GLJA 3KZWA 4YWYA 2ZEPA 4ZX8A 3IO1A 4UEEA 2AFWA 1BPNA 4B6ZA 2AFZA 3Q71A 3D7DA 4J5SA 1ZR5A 3FX6A 1Z8LA 3FMCA 2PJ2A 4UF4A 3V7ZA 2QVPA 3S9MA 1FNOA 1DTDA 2XEIA 2IMOA 1HJZA 5LYDA 4MCRA 2CTBA 3IEHA 4A37A 3S9LA 3QNVA 2PIZA 1XBUA 5LRJA 3VH9A 4MHPA 1IGBA 4OC5A 3D66A 5CB5A 3GPQA 3FECA 4JGKA 1IY7A 3SIIA 1QQ9A 3NH8A 4YU9A 2ZENA 3WC5A 1TXRA 2PJ8A 3EJFA 3N5FA 7CPAA 5JGFA
chains in the Genus database with same CATH superfamily
1Y7RA 2AFXA 4NFRA 5FSZA 4NXYA 4X3RA 4QBJA 3D2MA 2ZEGA 4UIBA 5D8NA 2Q51A 8CPAA 5I4MA 4ZY1A 1KUVA 1IOFA 5LRKA 3ETIA 1I12A 3FF3A 4MFLA 1B87A 1BO4A 4MFQA 3NH4A 4EVYA 4M6HA 2F7VA 2J8MA 2ZW5A 4Y49C 2EK9A 4FAIA 4U5YA 1Q7LA 2GANA 5C82A 1YREA 1IYLA 4KVOE 2PJBA 3C26A 2YNDA 2NSMA 2VI7A 1RO5A 3R96A 4KSAA 1EE3P 4JCAA 3FH4A 2DF5A 3FJUA 3CXSA 4GM5A 4M3SA 2ACFA 4UCMA 4CAEA 3BJ8A 2O53A 2Z3NA 4CAXA 2REFA 4F9VA 4BBHA 4KSFA 2JZEA 1YLOA 3EWQA 4KVXA 1LANA 1IB1E 2ZXVA 3B35A 3GB0A 4M85A 4OADA 5CBMA 1XF8A 2BCOA 1TY8A 4JZ0A 4J3GA 4F6AA 3PFEA 4ZY2A 4ETKA 3RO0A 3BI0A 1TKHA 2G3AA 3RYOA 2FS5A 1FT7A 2K5TA 4EFDA 3KR5A 4MCPA 4PQAA 3HUVA 3IIFA 1VHOA 4NGSA 3DLJA 1CBXA 1TKJA 3EWPA 1XOVA 2J8NA 4KLWA 4MBUA 3W6XA 2GU2A 4Q7AA 4R3KA 3R9FA 2C6CA 2R98A 2PJ7A 2R7HA 2WZNA 4UEZA 4F0XA 2PCUA 2GREA 3IIBA 3HLPA 3G8WA 3IC1A 1WK4A 2XEGA 2EEEA 1A2ZA 2OH1A 2AFOA 4UBRA 2LGRA 3LMSA 5FSYA 2QMLA 2V77A 5H86A 1UWYA 2C6PA 2WUUA 3K9TA 1BLLE 3DDDA 2I3CA 2PRBA 3DR8A 3TC8A 4CGLA 5LYLA 1S3ZA 4ABLA 4UWJA 1M4GA 2PQ8A 3GYAA 5DUSA 5ELYA 4BD9A 2V8VA 3VARA 3JVNA 4C7IA 3WABA 4KUBA 1IICA 2BFQA 3VFQA 1SQHA 2DX6A 4PSWA 3WC6A 2Z3MA 3SJFA 4KYBA 2NMTA 3EXNA 2C1CA 5AILA 3JUWA 2B3UA 3F0AA 3B3WA 3FB3A 3QAYA 4H89A 4MFJA 5D29A 2C27A 5JM6A 3KQXA 2R8VA 5IB0A 3T90A 2KQVA 4NGTA 1HDQA 5J1QA 2EWBA 1Y7EA 1IYKA 4ZY0A 1KZFA 1ZG8A 1S60A 3GPGA 2VQYA 3SIHA 3SXOA 2PR8A 4KOUA 1M4LA 2FL4A 2P6GA 4RN7A 3WR7A 1F2OA 3K2KA 2JBKA 4C2YA 4TWEA 1Q2DA 4AXVA 1LCPA 4MHNA 4P10A 4C7HA 3H8EA 4FD7A 5A28A 2ZW6A 2Q4YA 2WSAA 3W6SA 3RNZA 3RZAA 2IL4A 4PK2A 1LAPA 2Z10A 4OAEA 1J4JA 4PXCA 4JLLA 5LRGA 4JLYA 1XJOA 3LWUA 3SJXA 2C6GA 2B3VA 2BL1A 2ZELA 3D8PA 1CG2A 4UCNA 2JDCA 4P4JA 5EBVA 2PDOA 1TF9A 2JLMA 1RTQA 4P4FA 1XFOA 3ISXA 1YW4A 4NCZA 1LFWA 1SPVA 1Z8TA 3GKRA 2D4OA 3PZJA 2FXFA 5AG7A 3D7HA 1VHUA 2HB6A 4L8AA 3DR6A 2PE3A 2CNTA 3EW5A 1QSNA 4LUAA 4NGMA 2YNCA 4K30A 2POKA 3VATA 2AJ6A 2O28A 3GIUA 4DYOA 4R87A 3CPXA 1ZR3A 1KUXA 2DPSA 4PXEA 1KWMA 1Z8WA 2JZDA 1Z4EA 4GVVA 1MJBA 4MHDA 5FSUA 3D2PA 4AG9A 5DS0A 1CJWA 4KUAA 3E0KA 3KHZA 4MHYA 1X12A 4ZBGA 3I1UA 2HQYA 3PB7X 3W91A 5AG5A 2WPWA 2FIAA 1XMTA 1Y9WA 4RI1A 3SJGA 1RXTA 4WJBA 3WT4A 3MGDA 4JWPA 3P2FA 2P0WA 1BOBA 3B7IA 4ZX9A 4YRHA 1TKFA 2CNSA 2PJ6A 2EK8A 1NSAA 5IX3A 1PU9A 1ELLP 2DEAA 1P0HA 3D67A 1CX8A 4MCQA 1OZPA 2Q4VA 4J5RA 1ARMA 3PGPA 4MCSA 3V8IA 5FSVA 4OLLA 2PJAA 4W9YA 4OIDA 2JEVA 6CPAA 2PR1A 1ZO0A 3T8WA 3I9SA 1PYTB 2HC9A 2Q0YA 3SI0A 2FSRA 2ATRA 5DWNA 1I21A 4QB9A 4MY0A 1AYEA 2WYRA 4X2TA 2QJ8A 4MY3A 1GHEA 2EO8A 3H8GA 1F57A 3FEDA 3H8FA 2G9DA 3MRUA 1OBRA 3P2HA 3TOAA 2PJCA 3B3SA 3PB6X 3NE7A 2H5MA 5GCNA 2B4BA 1XIXA 2EVNA 3BXMA 3R95A 4IF5A 3V38A 4A31A 4KSIA 2J9AA 3NE8A 1S7LA 3ZJ0A 4K0CA 2HV2A 4NF1A 1Y0YA 4MFZA 3FBUA 4XPKA 4DUKA 2XEFA 1R43A 4KVME 2WPXA 4FUUA 4JXQA 4TNUA 3BLNA 1ZG9A 3S6GA 3B2YA 3TO7A 3D4UA 5K8NA 2GIVA 4IUSA 3H4QA 5KTAA 5CPAA 5G1ZA 1AUGA 4E2AA 1Y0RA 2X47A 3BJ7A 4XNHC 2B5GA 1YQEA 2FVGA 2A4NA 2ZEDA 3PB4X 4LQ6A 4P4BA 2AFCA 3IWEA 3RBUA 4DJLA 5AG4A 3PFOA 1YVKA 2ZEOA 3S6FA 1CM0A 1JWQA 2DPTA 2OOTA 3B3VA 3EWRA 3R9GA 4MXUA 4ZGYB 4R76A 3T9YA 2BOAA 4PPZA 1VIXA 2BEIA 3NH5A 4MFPA 4B13A 4CS0B 4YFJA 4A2ZA 2ZW4A 3OWCA 1YW6A 2ZEFA 4K3NA 1BAVA 4ABKA 2P6EA 2XEJA 3KHXA 4AB7A 3EWOA 2V8GA 4GVWA 1CPSA 1S7KA 4J5QA 4E8OA 4F9UA 4O23A 1P4NA 2ABZA 4UCPA 1XRYA 1IOIA 4MI4A 3TX8A 1WWZA 3VWDA 5FVJA 3K9UA 2OU2A 4G1PA 1Z2LA 2AFUA 4IAVA 5H84A 4P6YA 3RAMA 2BFRA 3TOBA 4B12A 1QMUA 2Y0MA 4C68A 4GUAA 2YGWA 3N7ZA 5K8MA 2IJZA 4MJ8A 4X8IA 2Q7SA 1N71A 4R8FA 1MJAA 5J8CA 1ARLA 1M4DA 1CP6A 1B6BA 1LOKA 1YX0A 3FYNA 4CGOA 4H2KA 3SI2A 2CF4A 1NJRA 3TTHA 2VRIA 2PJ4A 4KOYA 4FD5A 2QIRA 3IU1A 4B5OA 5CNPA 1F2PA 4R57A 4D86A 3DSBA 3S9NA 3SHPA 3B3TA 5DWMA 3PBBA 5CMSA 4X5KA 4UWIA 5C88A 1M4IA 5J8FA 2V8DA 4ORFA 2ARHA 3GPOA 3EC4A 3IGRA 4L89A 4Z65A 4CGNA 4ZYQA 1ZLIA 5LYIA 5K8PA 2PRQA 3IU2A 2YNCC 3WC7A 4GXHA 1CP7A 2AE6A 4UIAA 2PJ5A 3F5BA 3GUXA 2ZW7A 2Z11A 4R7MA 4P44A 3CPAA 2ZEHA 3JZTA 1ZG7A 4M6IA 4ETJA 1L0CA 3KASA 1ELMP 3KGQA 3S6HA 4JVVA 3IFEA 1S7FA 4GS4A 1U6MA 5IV0A 3QB8A 3JRUA 3GQOA 5HVFA 4U9YA 1LRZA 1H8LA 2PJ1A 4Q36A 4AG7A 4CAWA 4A95A 4F0YA 2P6FA 1Z5RA 4P45A 4F8ZA 1YD9A 4IQYA 2B4DB 1KUYA 3IWWA 4AVCA 4AVBA 2PJ3A 3KL9A 1Z4RA 2GE3A 2CY2A 4JXRA 1MJ9A 4FD4A 3TO6A 2NYQA 3A9LA 3FXTA 4KOTA 4OMEA 1LAMA 2BO9A 2PSWA 3V45A 2Q04A 2R1IA 3PP9A 3EKEA 1Z9UA 2QECA 5E96A 1YLEA 2JBJA 3GY9A 1NSLA 3FVLA 2Z3PA 3CDXA 4IK2A 3D7FA 3QAHA 1BPMA 3V2BA 4WWVA 4EMEA 3SXNA 3EO4A 2GLFA 2CXAA 2I00A 2F5IA 4I49A 4PXDA 5HH1A 2ZPAA 4UFXA 4LQGA 4AVAA 3TCVA 4CRZB 2W2GA 4NJRA 4E0AA 1QSOA 5THWA 4A38A 2Q7BA 3PEIA 3SIGA 2Q4ZA 3LODA 4IHMA 4EWTA 3CT9A 1S7NA 4A39A 3FEEA 4JYWA 5LYFA 1TXZA 1YR0A 2ZOGA 2CTCA 3CXQA 4KOSA 2B58A 4B5PB 1YK3A 3IWGA 1XMBA 2G0BA 1Z8XA 2B5GB 2FG1A 4LX9A 4OC0A 4R3LA 5HVGA 2Q44A 4KOVA 4UFVA 5G21A 4A33A 1K4JA 2Z3OA 2Q43A 3BHXA 3MN8A 5JPHA 4KLVA 4MHZA 4PXBA 2HUZA 4XPLA 5HXDA 1TF8A 3FRMA 4QVTA 4OC4A 4CRYB 1HEEA 4QC6A 5F48A 4NGRA 3DNSA 4NGQA 1Q2YA 4ONWA 2JEWA 3TO9A 4YU9A 3IIDA 2X7BA 5HVHA 4XPDB 2AFMA 3Q6ZA 3PRTA 2Z3KA 2OZUA 3KKWA 4CYPA 5K8OA 2OB0A 5EC4A 1IIDA 2Z0ZA 4ESSA 3B8GA 3I3GA 3ISZA 4P4EA 4C2ZA 3TFYA 5FSXA 1AMPA 3EFAA 3LACA 1VHEA 1HDUA 1PCAA 2WCTA 1YMEA 4OC1A 4CAFA 4DNCA 4PSXA 5F47A 4OC2A 2ZEMA 3G3SA 4MFKA 5HMNA 4H6UA 4P4IA 3FIXA 5EMIA 2ZEEA 4OKOA 2FIWA 5BWAB 2PIYA 2OR4A 3F8KA 5F09A 3B3CA 4OP4A 2BUEA 2FAVA 4KZTA 3GQEA 1YVOA 4MMOA 2PJ0A 5E3BA 4A32A 3KQZA 3SI1A 3CXPA 2IQ6A 1CPXA 2FE7A 3EY5A 3D7GA 3SJEA 2L8RA 4FBEA 2JZFA 2VZZA 4UEFA 2QYVA 2FT0A 4CAVA 4NGNA 2ANPA 3PB9X 4PV6A 4CYOA 5JH9A 5KTDA 4CPAA 2VL1A 3DGVA 1DE4C 1ON0A 4B5PA 2KCWA 1R57A 2B4DA 5HOLA 2OZHA 5AG6A 3NA6A 2OZGA 1QSRA 2RFHA 4UFWA 2BSWA 1ZLHA 4TU0A 4M6GA 5G20A 1XEBA 4QUSA 4P4DA 4BMHA 2ODFA 5CB3A 2I79A 4KOWA 2ZOFA 4FWUA 1FY7A 1VGYA 1VKCA 1MK4A 4CGMA 1R3NA 3H5ZA 4UA3A 3NFZA 5KTCA 4J4ZA 2PVWA 3BI1A 3L2NA 1V0CA 4BINA 4HNWB 4JD6A 1JQGA 2O4HA 4UMLA 4NGPA 3EJGA 4B14A 4A94A 3PBEA 4RUHA 1I1DA 1M44A 2Z3LA 3CZXA 1YSJA 4B11A 2PJ9A 3PB8X 2FXKA 3ZZIA 3KI9A 1PUAA 1Y9KA 2PVVA 1QSTA 4OC3A 4NJQA 1XE4A 2YNEA 1GYTA 5AGEA 4MRIA 3TE4A 2RB7A 2V8HA 3D68A 4R6TA 2VEZA 1M1DA 2XD7A 4KOXA 2AFSA 2GLJA 4CGPA 4OIWA 3KR4A 5IB9A 1X10A 4CYQA 2D4PA 1VHSA 3IJ3A 5HIHA 3SIJA 4H6ZA 5G22A 2CIJA 2DXQA 4ZI6A 3S6KA 2F8HA 3GLJA 3KZWA 2G3TA 4YWYA 2ZEPA 3JTKA 2VZYA 4ZX8A 3IO1A 4NEXA 4RS2A 3LD2A 4UEEA 2AFWA 1BPNA 2RNKA 1Q2CA 4C2XA 2VBQA 3TT2A 4B6ZA 2AFZA 3Q71A 4KS9A 3D7DA 3UY5A 4J5SA 1Z8LA 1ZR5A 2CNMA 2PJ2A 3FMCA 3FX6A 4KORA 4PK3A 4HPSA 4UF4A 4XNHB 2QVPA 4YGOA 3S9MA 3V7ZA 1FNOA 3FNCA 1DTDA 4B10A 4II9A 2XEIA 5JQ4A 5I0CA 2IMOA 4HNXB 4HNYB 4NSQA 3VWEA 4R9MA 1HJZA 4ONUA 5LYDA 4MCRA 2GFQA 2VXKA 4JJXA 5A27A 2PC1A 2CTBA 3IEHA 1YGHA 4A37A 3R1KA 3S9LA 2RC4A 4Y49B 3QNVA 2PIZA 1XBUA 2FCKA 4HKFA 4MHPA 1IGBA 1NMTA 2EBJA 4OC5A 3D66A 5LRJA 3VH9A 2J8RA 5CB5A 3GPQA 4XPDC 3R9EA 3D3SA 5ISVA 1TIQA 3FECA 1UFHA 4JGKA 1IY7A 3SIIA 1NE9A 1QQ9A 1QSMA 2JDDA 2REEA 2ZENA 3NH8A 4FD6A 5F49A 3WC5A 4A30A 1IU8A 1TXRA 2PJ8A 1S5KA 5F46A 4U9ZA 3EJFA 2EUIA 4Q38A 4CYNA 3N5FA 7CPAA 5JGFA
chains in the Genus database with same CATH topology
2AFXA 4NFRA 5FSZA 4X3RA 4UIBA 2ZEGA 5D8NA 2Q51A 8CPAA 5I4MA 4ZY1A 5LRKA 3ETIA 3FF3A 3NH4A 2F7VA 2EK9A 4FAIA 1Q7LA 2PJBA 2NSMA 1EE3P 4JCAA 3FH4A 3FJUA 4GM5A 2ACFA 2O53A 4F9VA 1YLOA 3EWQA 1LANA 3B35A 3GB0A 5CBMA 2BCOA 1TY8A 4JZ0A 3PFEA 4ZY2A 4ETKA 3BI0A 1TKHA 1FT7A 4EFDA 3KR5A 4MCPA 4PQAA 3HUVA 3IIFA 1VHOA 4NGSA 3DLJA 1CBXA 1TKJA 3EWPA 2GU2A 4Q7AA 2C6CA 2PJ7A 2WZNA 4UEZA 2PCUA 2GREA 3IIBA 3HLPA 3IC1A 2XEGA 2EEEA 2AFOA 2LGRA 3LMSA 5FSYA 2V77A 1UWYA 2C6PA 3K9TA 1BLLE 2I3CA 3TC8A 5LYLA 4ABLA 5DUSA 5ELYA 4BD9A 2V8VA 3VARA 3WABA 2BFQA 3VFQA 2DX6A 3WC6A 3SJFA 4KYBA 2C1CA 5AILA 3B3WA 5D29A 5JM6A 3KQXA 5J1QA 4NGTA 1HDQA 2EWBA 1Y7EA 4ZY0A 1ZG8A 3GPGA 3SIHA 1M4LA 1F2OA 3K2KA 2JBKA 4TWEA 4AXVA 1LCPA 4MHNA 4P10A 3H8EA 3RZAA 1LAPA 4PXCA 4JLLA 5LRGA 1XJOA 3LWUA 3SJXA 2C6GA 2ZELA 1CG2A 4P4JA 1TF9A 4P4FA 1RTQA 1XFOA 3ISXA 1YW4A 1LFWA 1SPVA 3D7HA 1VHUA 2HB6A 2PE3A 3EW5A 4NGMA 2POKA 3VATA 4DYOA 3CPXA 1ZR3A 4PXEA 1KWMA 4GVVA 5FSUA 5DS0A 3KHZA 4MHYA 3I1UA 3PB7X 3SJGA 4WJBA 3WT4A 3B7IA 4ZX9A 1TKFA 2PJ6A 2EK8A 1NSAA 1ELLP 2DEAA 3D67A 1CX8A 4MCQA 4J5RA 1ARMA 4MCSA 5FSVA 4W9YA 2PJAA 4OIDA 6CPAA 3T8WA 1PYTB 2HC9A 3SI0A 1AYEA 2WYRA 4X2TA 2QJ8A 3FEDA 3H8GA 1F57A 3H8FA 2G9DA 3MRUA 1OBRA 2PJCA 3B3SA 3PB6X 3BXMA 3V38A 4KSIA 2J9AA 4K0CA 1Y0YA 4DUKA 2XEFA 1R43A 4FUUA 4TNUA 1ZG9A 3B2YA 3D4UA 5K8NA 5CPAA 1Y0RA 2X47A 2FVGA 2ZEDA 3PB4X 4DJLA 4P4BA 2AFCA 3RBUA 3PFOA 2ZEOA 2OOTA 3B3VA 3EWRA 4MXUA 4R76A 2BOAA 4PPZA 1VIXA 3NH5A 1YW6A 2ZEFA 4K3NA 1BAVA 4ABKA 2XEJA 3KHXA 3EWOA 2V8GA 4GVWA 1CPSA 4F9UA 4J5QA 4O23A 2ABZA 1XRYA 3TX8A 4G1PA 1Z2LA 2AFUA 4IAVA 4P6YA 3RAMA 2BFRA 1QMUA 4GUAA 5K8MA 2IJZA 4X8IA 4R8FA 1ARLA 1CP6A 1LOKA 4H2KA 3SI2A 2CF4A 1NJRA 2VRIA 2PJ4A 1F2PA 4D86A 3S9NA 3B3TA 3PBBA 5CMSA 2V8DA 3GPOA 4Z65A 5K8PA 4ZYQA 1ZLIA 5LYIA 2PRQA 3WC7A 1CP7A 4UIAA 2PJ5A 3GUXA 4R7MA 4P44A 3CPAA 2ZEHA 3JZTA 1ZG7A 4ETJA 3KASA 1ELMP 3KGQA 4JVVA 3IFEA 3JRUA 3GQOA 5HVFA 2PJ1A 1H8LA 4F8ZA 1Z5RA 4P45A 1YD9A 4IQYA 3IWWA 2PJ3A 3KL9A 2NYQA 4OMEA 1LAMA 2BO9A 3V45A 3EKEA 2JBJA 3FVLA 3CDXA 4IK2A 3D7FA 1BPMA 3V2BA 4WWVA 4EMEA 2GLFA 4PXDA 4LQGA 4NJRA 4A38A 5THWA 3PEIA 3SIGA 2Q4ZA 4IHMA 4EWTA 3CT9A 4A39A 3FEEA 4JYWA 5LYFA 1TXZA 2ZOGA 2CTCA 1XMBA 2FG1A 4OC0A 5HVGA 2Q43A 3BHXA 3MN8A 4MHZA 4PXBA 5HXDA 1TF8A 4OC4A 1HEEA 4NGRA 4ONWA 4NGQA 2JEWA 3IIDA 5HVHA 2AFMA 3Q6ZA 3PRTA 5K8OA 4ESSA 4P4EA 3ISZA 5FSXA 1AMPA 1VHEA 1HDUA 1PCAA 1YMEA 4OC1A 4OC2A 2ZEMA 4P4IA 2ZEEA 4OKOA 2PIYA 2OR4A 5F09A 3B3CA 4OP4A 2FAVA 3GQEA 4MMOA 2PJ0A 5E3BA 3KQZA 3SI1A 2IQ6A 1CPXA 3D7GA 3SJEA 2L8RA 4FBEA 4UEFA 2QYVA 4NGNA 2ANPA 3PB9X 5JH9A 4CPAA 2VL1A 3DGVA 1DE4C 5HOLA 3NA6A 2RFHA 1ZLHA 4TU0A 4P4DA 5CB3A 2ZOFA 4FWUA 1VGYA 1R3NA 3NFZA 4J4ZA 2PVWA 3BI1A 3L2NA 1JQGA 2O4HA 4UMLA 4NGPA 3EJGA 4A94A 3PBEA 4RUHA 1YSJA 2PJ9A 3PB8X 2FXKA 3KI9A 2PVVA 4OC3A 4NJQA 1GYTA 4MRIA 2RB7A 2V8HA 3D68A 4R6TA 2XD7A 2AFSA 2GLJA 4OIWA 3KR4A 5IB9A 3IJ3A 5HIHA 3SIJA 2CIJA 4ZI6A 2F8HA 3GLJA 3KZWA 4YWYA 2ZEPA 4ZX8A 3IO1A 4UEEA 2AFWA 1BPNA 4B6ZA 2AFZA 3Q71A 3D7DA 4J5SA 1ZR5A 3FX6A 1Z8LA 3FMCA 2PJ2A 4UF4A 3V7ZA 2QVPA 3S9MA 1FNOA 1DTDA 2XEIA 2IMOA 1HJZA 5LYDA 4MCRA 2CTBA 3IEHA 4A37A 3S9LA 3QNVA 2PIZA 1XBUA 5LRJA 3VH9A 4MHPA 1IGBA 4OC5A 3D66A 5CB5A 3GPQA 3FECA 4JGKA 1IY7A 3SIIA 1QQ9A 3NH8A 4YU9A 2ZENA 3WC5A 1TXRA 2PJ8A 3EJFA 3N5FA 7CPAA 5JGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFX A;  4NFR A;  5FSZ A;  4X3R A;  4UIB A;  2ZEG A;  5D8N A;  2Q51 A;  8CPA A;  5I4M A;  4ZY1 A;  5LRK A;  3ETI A;  3FF3 A;  3NH4 A;  2F7V A;  2EK9 A;  4FAI A;  1Q7L A;  2PJB A;  2NSM A;  1EE3 P;  4JCA A;  3FH4 A;  3FJU A;  4GM5 A;  2ACF A;  2O53 A;  4F9V A;  1YLO A;  3EWQ A;  1LAN A;  3B35 A;  3GB0 A;  5CBM A;  2BCO A;  1TY8 A;  4JZ0 A;  3PFE A;  4ZY2 A;  4ETK A;  3BI0 A;  1TKH A;  1FT7 A;  4EFD A;  3KR5 A;  4MCP A;  4PQA A;  3HUV A;  3IIF A;  1VHO A;  4NGS A;  3DLJ A;  1CBX A;  1TKJ A;  3EWP A;  2GU2 A;  4Q7A A;  2C6C A;  2PJ7 A;  2WZN A;  4UEZ A;  2PCU A;  2GRE A;  3IIB A;  3HLP A;  3IC1 A;  2XEG A;  2EEE A;  2AFO A;  2LGR A;  3LMS A;  5FSY A;  2V77 A;  1UWY A;  2C6P A;  3K9T A;  1BLL E;  2I3C A;  3TC8 A;  5LYL A;  4ABL A;  5DUS A;  5ELY A;  4BD9 A;  2V8V A;  3VAR A;  3WAB A;  2BFQ A;  3VFQ A;  2DX6 A;  3WC6 A;  3SJF A;  4KYB A;  2C1C A;  5AIL A;  3B3W A;  5D29 A;  5JM6 A;  3KQX A;  5J1Q A;  4NGT A;  1HDQ A;  2EWB A;  1Y7E A;  4ZY0 A;  1ZG8 A;  3GPG A;  3SIH A;  1M4L A;  1F2O A;  3K2K A;  2JBK A;  4TWE A;  4AXV A;  1LCP A;  4MHN A;  4P10 A;  3H8E A;  3RZA A;  1LAP A;  4PXC A;  4JLL A;  5LRG A;  1XJO A;  3LWU A;  3SJX A;  2C6G A;  2ZEL A;  1CG2 A;  4P4J A;  1TF9 A;  4P4F A;  1RTQ A;  1XFO A;  3ISX A;  1YW4 A;  1LFW A;  1SPV A;  3D7H A;  1VHU A;  2HB6 A;  2PE3 A;  3EW5 A;  4NGM A;  2POK A;  3VAT A;  4DYO A;  3CPX A;  1ZR3 A;  4PXE A;  1KWM A;  4GVV A;  5FSU A;  5DS0 A;  3KHZ A;  4MHY A;  3I1U A;  3PB7 X;  3SJG A;  4WJB A;  3WT4 A;  3B7I A;  4ZX9 A;  1TKF A;  2PJ6 A;  2EK8 A;  1NSA A;  1ELL P;  2DEA A;  3D67 A;  1CX8 A;  4MCQ A;  4J5R A;  1ARM A;  4MCS A;  5FSV A;  4W9Y A;  2PJA A;  4OID A;  6CPA A;  3T8W A;  1PYT B;  2HC9 A;  3SI0 A;  1AYE A;  2WYR A;  4X2T A;  2QJ8 A;  3FED A;  3H8G A;  1F57 A;  3H8F A;  2G9D A;  3MRU A;  1OBR A;  2PJC A;  3B3S A;  3PB6 X;  3BXM A;  3V38 A;  4KSI A;  2J9A A;  4K0C A;  1Y0Y A;  4DUK A;  2XEF A;  1R43 A;  4FUU A;  4TNU A;  1ZG9 A;  3B2Y A;  3D4U A;  5K8N A;  5CPA A;  1Y0R A;  2X47 A;  2FVG A;  2ZED A;  3PB4 X;  4DJL A;  4P4B A;  2AFC A;  3RBU A;  3PFO A;  2ZEO A;  2OOT A;  3B3V A;  3EWR A;  4MXU A;  4R76 A;  2BOA A;  4PPZ A;  1VIX A;  3NH5 A;  1YW6 A;  2ZEF A;  4K3N A;  1BAV A;  4ABK A;  2XEJ A;  3KHX A;  3EWO A;  2V8G A;  4GVW A;  1CPS A;  4F9U A;  4J5Q A;  4O23 A;  2ABZ A;  1XRY A;  3TX8 A;  4G1P A;  1Z2L A;  2AFU A;  4IAV A;  4P6Y A;  3RAM A;  2BFR A;  1QMU A;  4GUA A;  5K8M A;  2IJZ A;  4X8I A;  4R8F A;  1ARL A;  1CP6 A;  1LOK A;  4H2K A;  3SI2 A;  2CF4 A;  1NJR A;  2VRI A;  2PJ4 A;  1F2P A;  4D86 A;  3S9N A;  3B3T A;  3PBB A;  5CMS A;  2V8D A;  3GPO A;  4Z65 A;  5K8P A;  4ZYQ A;  1ZLI A;  5LYI A;  2PRQ A;  3WC7 A;  1CP7 A;  4UIA A;  2PJ5 A;  3GUX A;  4R7M A;  4P44 A;  3CPA A;  2ZEH A;  3JZT A;  1ZG7 A;  4ETJ A;  3KAS A;  1ELM P;  3KGQ A;  4JVV A;  3IFE A;  3JRU A;  3GQO A;  5HVF A;  2PJ1 A;  1H8L A;  4F8Z A;  1Z5R A;  4P45 A;  1YD9 A;  4IQY A;  3IWW A;  2PJ3 A;  3KL9 A;  2NYQ A;  4OME A;  1LAM A;  2BO9 A;  3V45 A;  3EKE A;  2JBJ A;  3FVL A;  3CDX A;  4IK2 A;  3D7F A;  1BPM A;  3V2B A;  4WWV A;  4EME A;  2GLF A;  4PXD A;  4LQG A;  4NJR A;  4A38 A;  5THW A;  3PEI A;  3SIG A;  2Q4Z A;  4IHM A;  4EWT A;  3CT9 A;  4A39 A;  3FEE A;  4JYW A;  5LYF A;  1TXZ A;  2ZOG A;  2CTC A;  1XMB A;  2FG1 A;  4OC0 A;  5HVG A;  2Q43 A;  3BHX A;  3MN8 A;  4MHZ A;  4PXB A;  5HXD A;  1TF8 A;  4OC4 A;  1HEE A;  4NGR A;  4ONW A;  4NGQ A;  2JEW A;  3IID A;  5HVH A;  2AFM A;  3Q6Z A;  3PRT A;  5K8O A;  4ESS A;  4P4E A;  3ISZ A;  5FSX A;  1AMP A;  1VHE A;  1HDU A;  1PCA A;  1YME A;  4OC1 A;  4OC2 A;  2ZEM A;  4P4I A;  2ZEE A;  4OKO A;  2PIY A;  2OR4 A;  5F09 A;  3B3C A;  4OP4 A;  2FAV A;  3GQE A;  4MMO A;  2PJ0 A;  5E3B A;  3KQZ A;  3SI1 A;  2IQ6 A;  1CPX A;  3D7G A;  3SJE A;  2L8R A;  4FBE A;  4UEF A;  2QYV A;  4NGN A;  2ANP A;  3PB9 X;  5JH9 A;  4CPA A;  2VL1 A;  3DGV A;  1DE4 C;  5HOL A;  3NA6 A;  2RFH A;  1ZLH A;  4TU0 A;  4P4D A;  5CB3 A;  2ZOF A;  4FWU A;  1VGY A;  1R3N A;  3NFZ A;  4J4Z A;  2PVW A;  3BI1 A;  3L2N A;  1JQG A;  2O4H A;  4UML A;  4NGP A;  3EJG A;  4A94 A;  3PBE A;  4RUH A;  1YSJ A;  2PJ9 A;  3PB8 X;  2FXK A;  3KI9 A;  2PVV A;  4OC3 A;  4NJQ A;  1GYT A;  4MRI A;  2RB7 A;  2V8H A;  3D68 A;  4R6T A;  2XD7 A;  2AFS A;  2GLJ A;  4OIW A;  3KR4 A;  5IB9 A;  3IJ3 A;  5HIH A;  3SIJ A;  2CIJ A;  4ZI6 A;  2F8H A;  3GLJ A;  3KZW A;  4YWY A;  2ZEP A;  4ZX8 A;  3IO1 A;  4UEE A;  2AFW A;  1BPN A;  4B6Z A;  2AFZ A;  3Q71 A;  3D7D A;  4J5S A;  1ZR5 A;  3FX6 A;  1Z8L A;  3FMC A;  2PJ2 A;  4UF4 A;  3V7Z A;  2QVP A;  3S9M A;  1FNO A;  1DTD A;  2XEI A;  2IMO A;  1HJZ A;  5LYD A;  4MCR A;  2CTB A;  3IEH A;  4A37 A;  3S9L A;  3QNV A;  2PIZ A;  1XBU A;  5LRJ A;  3VH9 A;  4MHP A;  1IGB A;  4OC5 A;  3D66 A;  5CB5 A;  3GPQ A;  3FEC A;  4JGK A;  1IY7 A;  3SII A;  1QQ9 A;  3NH8 A;  4YU9 A;  2ZEN A;  3WC5 A;  1TXR A;  2PJ8 A;  3EJF A;  3N5F A;  7CPA A;  5JGF A; 
#chains in the Genus database with same CATH topology
 1Y7R A;  2AFX A;  4NFR A;  5FSZ A;  4NXY A;  4X3R A;  4QBJ A;  3D2M A;  2ZEG A;  4UIB A;  5D8N A;  2Q51 A;  8CPA A;  5I4M A;  4ZY1 A;  1KUV A;  1IOF A;  5LRK A;  3ETI A;  1I12 A;  3FF3 A;  4MFL A;  1B87 A;  1BO4 A;  4MFQ A;  3NH4 A;  4EVY A;  4M6H A;  2F7V A;  2J8M A;  2ZW5 A;  4Y49 C;  2EK9 A;  4FAI A;  4U5Y A;  1Q7L A;  2GAN A;  5C82 A;  1YRE A;  1IYL A;  4KVO E;  2PJB A;  3C26 A;  2YND A;  2NSM A;  2VI7 A;  1RO5 A;  3R96 A;  4KSA A;  1EE3 P;  4JCA A;  3FH4 A;  2DF5 A;  3FJU A;  3CXS A;  4GM5 A;  4M3S A;  2ACF A;  4UCM A;  4CAE A;  3BJ8 A;  2O53 A;  2Z3N A;  4CAX A;  2REF A;  4F9V A;  4BBH A;  4KSF A;  2JZE A;  1YLO A;  3EWQ A;  4KVX A;  1LAN A;  1IB1 E;  2ZXV A;  3B35 A;  3GB0 A;  4M85 A;  4OAD A;  5CBM A;  1XF8 A;  2BCO A;  1TY8 A;  4JZ0 A;  4J3G A;  4F6A A;  3PFE A;  4ZY2 A;  4ETK A;  3RO0 A;  3BI0 A;  1TKH A;  2G3A A;  3RYO A;  2FS5 A;  1FT7 A;  2K5T A;  4EFD A;  3KR5 A;  4MCP A;  4PQA A;  3HUV A;  3IIF A;  1VHO A;  4NGS A;  3DLJ A;  1CBX A;  1TKJ A;  3EWP A;  1XOV A;  2J8N A;  4KLW A;  4MBU A;  3W6X A;  2GU2 A;  4Q7A A;  4R3K A;  3R9F A;  2C6C A;  2R98 A;  2PJ7 A;  2R7H A;  2WZN A;  4UEZ A;  4F0X A;  2PCU A;  2GRE A;  3IIB A;  3HLP A;  3G8W A;  3IC1 A;  1WK4 A;  2XEG A;  2EEE A;  1A2Z A;  2OH1 A;  2AFO A;  4UBR A;  2LGR A;  3LMS A;  5FSY A;  2QML A;  2V77 A;  5H86 A;  1UWY A;  2C6P A;  2WUU A;  3K9T A;  1BLL E;  3DDD A;  2I3C A;  2PRB A;  3DR8 A;  3TC8 A;  4CGL A;  5LYL A;  1S3Z A;  4ABL A;  4UWJ A;  1M4G A;  2PQ8 A;  3GYA A;  5DUS A;  5ELY A;  4BD9 A;  2V8V A;  3VAR A;  3JVN A;  4C7I A;  3WAB A;  4KUB A;  1IIC A;  2BFQ A;  3VFQ A;  1SQH A;  2DX6 A;  4PSW A;  3WC6 A;  2Z3M A;  3SJF A;  4KYB A;  2NMT A;  3EXN A;  2C1C A;  5AIL A;  3JUW A;  2B3U A;  3F0A A;  3B3W A;  3FB3 A;  3QAY A;  4H89 A;  4MFJ A;  5D29 A;  2C27 A;  5JM6 A;  3KQX A;  2R8V A;  5IB0 A;  3T90 A;  2KQV A;  4NGT A;  1HDQ A;  5J1Q A;  2EWB A;  1Y7E A;  1IYK A;  4ZY0 A;  1KZF A;  1ZG8 A;  1S60 A;  3GPG A;  2VQY A;  3SIH A;  3SXO A;  2PR8 A;  4KOU A;  1M4L A;  2FL4 A;  2P6G A;  4RN7 A;  3WR7 A;  1F2O A;  3K2K A;  2JBK A;  4C2Y A;  4TWE A;  1Q2D A;  4AXV A;  1LCP A;  4MHN A;  4P10 A;  4C7H A;  3H8E A;  4FD7 A;  5A28 A;  2ZW6 A;  2Q4Y A;  2WSA A;  3W6S A;  3RNZ A;  3RZA A;  2IL4 A;  4PK2 A;  1LAP A;  2Z10 A;  4OAE A;  1J4J A;  4PXC A;  4JLL A;  5LRG A;  4JLY A;  1XJO A;  3LWU A;  3SJX A;  2C6G A;  2B3V A;  2BL1 A;  2ZEL A;  3D8P A;  1CG2 A;  4UCN A;  2JDC A;  4P4J A;  5EBV A;  2PDO A;  1TF9 A;  2JLM A;  1RTQ A;  4P4F A;  1XFO A;  3ISX A;  1YW4 A;  4NCZ A;  1LFW A;  1SPV A;  1Z8T A;  3GKR A;  2D4O A;  3PZJ A;  2FXF A;  5AG7 A;  3D7H A;  1VHU A;  2HB6 A;  4L8A A;  3DR6 A;  2PE3 A;  2CNT A;  3EW5 A;  1QSN A;  4LUA A;  4NGM A;  2YNC A;  4K30 A;  2POK A;  3VAT A;  2AJ6 A;  2O28 A;  3GIU A;  4DYO A;  4R87 A;  3CPX A;  1ZR3 A;  1KUX A;  2DPS A;  4PXE A;  1KWM A;  1Z8W A;  2JZD A;  1Z4E A;  4GVV A;  1MJB A;  4MHD A;  5FSU A;  3D2P A;  4AG9 A;  5DS0 A;  1CJW A;  4KUA A;  3E0K A;  3KHZ A;  4MHY A;  1X12 A;  4ZBG A;  3I1U A;  2HQY A;  3PB7 X;  3W91 A;  5AG5 A;  2WPW A;  2FIA A;  1XMT A;  1Y9W A;  4RI1 A;  3SJG A;  1RXT A;  4WJB A;  3WT4 A;  3MGD A;  4JWP A;  3P2F A;  2P0W A;  1BOB A;  3B7I A;  4ZX9 A;  4YRH A;  1TKF A;  2CNS A;  2PJ6 A;  2EK8 A;  1NSA A;  5IX3 A;  1PU9 A;  1ELL P;  2DEA A;  1P0H A;  3D67 A;  1CX8 A;  4MCQ A;  1OZP A;  2Q4V A;  4J5R A;  1ARM A;  3PGP A;  4MCS A;  3V8I A;  5FSV A;  4OLL A;  2PJA A;  4W9Y A;  4OID A;  2JEV A;  6CPA A;  2PR1 A;  1ZO0 A;  3T8W A;  3I9S A;  1PYT B;  2HC9 A;  2Q0Y A;  3SI0 A;  2FSR A;  2ATR A;  5DWN A;  1I21 A;  4QB9 A;  4MY0 A;  1AYE A;  2WYR A;  4X2T A;  2QJ8 A;  4MY3 A;  1GHE A;  2EO8 A;  3H8G A;  1F57 A;  3FED A;  3H8F A;  2G9D A;  3MRU A;  1OBR A;  3P2H A;  3TOA A;  2PJC A;  3B3S A;  3PB6 X;  3NE7 A;  2H5M A;  5GCN A;  2B4B A;  1XIX A;  2EVN A;  3BXM A;  3R95 A;  4IF5 A;  3V38 A;  4A31 A;  4KSI A;  2J9A A;  3NE8 A;  1S7L A;  3ZJ0 A;  4K0C A;  2HV2 A;  4NF1 A;  1Y0Y A;  4MFZ A;  3FBU A;  4XPK A;  4DUK A;  2XEF A;  1R43 A;  4KVM E;  2WPX A;  4FUU A;  4JXQ A;  4TNU A;  3BLN A;  1ZG9 A;  3S6G A;  3B2Y A;  3TO7 A;  3D4U A;  5K8N A;  2GIV A;  4IUS A;  3H4Q A;  5KTA A;  5CPA A;  5G1Z A;  1AUG A;  4E2A A;  1Y0R A;  2X47 A;  3BJ7 A;  4XNH C;  2B5G A;  1YQE A;  2FVG A;  2A4N A;  2ZED A;  3PB4 X;  4LQ6 A;  4P4B A;  2AFC A;  3IWE A;  3RBU A;  4DJL A;  5AG4 A;  3PFO A;  1YVK A;  2ZEO A;  3S6F A;  1CM0 A;  1JWQ A;  2DPT A;  2OOT A;  3B3V A;  3EWR A;  3R9G A;  4MXU A;  4ZGY B;  4R76 A;  3T9Y A;  2BOA A;  4PPZ A;  1VIX A;  2BEI A;  3NH5 A;  4MFP A;  4B13 A;  4CS0 B;  4YFJ A;  4A2Z A;  2ZW4 A;  3OWC A;  1YW6 A;  2ZEF A;  4K3N A;  1BAV A;  4ABK A;  2P6E A;  2XEJ A;  3KHX A;  4AB7 A;  3EWO A;  2V8G A;  4GVW A;  1CPS A;  1S7K A;  4J5Q A;  4E8O A;  4F9U A;  4O23 A;  1P4N A;  2ABZ A;  4UCP A;  1XRY A;  1IOI A;  4MI4 A;  3TX8 A;  1WWZ A;  3VWD A;  5FVJ A;  3K9U A;  2OU2 A;  4G1P A;  1Z2L A;  2AFU A;  4IAV A;  5H84 A;  4P6Y A;  3RAM A;  2BFR A;  3TOB A;  4B12 A;  1QMU A;  2Y0M A;  4C68 A;  4GUA A;  2YGW A;  3N7Z A;  5K8M A;  2IJZ A;  4MJ8 A;  4X8I A;  2Q7S A;  1N71 A;  4R8F A;  1MJA A;  5J8C A;  1ARL A;  1M4D A;  1CP6 A;  1B6B A;  1LOK A;  1YX0 A;  3FYN A;  4CGO A;  4H2K A;  3SI2 A;  2CF4 A;  1NJR A;  3TTH A;  2VRI A;  2PJ4 A;  4KOY A;  4FD5 A;  2QIR A;  3IU1 A;  4B5O A;  5CNP A;  1F2P A;  4R57 A;  4D86 A;  3DSB A;  3S9N A;  3SHP A;  3B3T A;  5DWM A;  3PBB A;  5CMS A;  4X5K A;  4UWI A;  5C88 A;  1M4I A;  5J8F A;  2V8D A;  4ORF A;  2ARH A;  3GPO A;  3EC4 A;  3IGR A;  4L89 A;  4Z65 A;  4CGN A;  4ZYQ A;  1ZLI A;  5LYI A;  5K8P A;  2PRQ A;  3IU2 A;  2YNC C;  3WC7 A;  4GXH A;  1CP7 A;  2AE6 A;  4UIA A;  2PJ5 A;  3F5B A;  3GUX A;  2ZW7 A;  2Z11 A;  4R7M A;  4P44 A;  3CPA A;  2ZEH A;  3JZT A;  1ZG7 A;  4M6I A;  4ETJ A;  1L0C A;  3KAS A;  1ELM P;  3KGQ A;  3S6H A;  4JVV A;  3IFE A;  1S7F A;  4GS4 A;  1U6M A;  5IV0 A;  3QB8 A;  3JRU A;  3GQO A;  5HVF A;  4U9Y A;  1LRZ A;  1H8L A;  2PJ1 A;  4Q36 A;  4AG7 A;  4CAW A;  4A95 A;  4F0Y A;  2P6F A;  1Z5R A;  4P45 A;  4F8Z A;  1YD9 A;  4IQY A;  2B4D B;  1KUY A;  3IWW A;  4AVC A;  4AVB A;  2PJ3 A;  3KL9 A;  1Z4R A;  2GE3 A;  2CY2 A;  4JXR A;  1MJ9 A;  4FD4 A;  3TO6 A;  2NYQ A;  3A9L A;  3FXT A;  4KOT A;  4OME A;  1LAM A;  2BO9 A;  2PSW A;  3V45 A;  2Q04 A;  2R1I A;  3PP9 A;  3EKE A;  1Z9U A;  2QEC A;  5E96 A;  1YLE A;  2JBJ A;  3GY9 A;  1NSL A;  3FVL A;  2Z3P A;  3CDX A;  4IK2 A;  3D7F A;  3QAH A;  1BPM A;  3V2B A;  4WWV A;  4EME A;  3SXN A;  3EO4 A;  2GLF A;  2CXA A;  2I00 A;  2F5I A;  4I49 A;  4PXD A;  5HH1 A;  2ZPA A;  4UFX A;  4LQG A;  4AVA A;  3TCV A;  4CRZ B;  2W2G A;  4NJR A;  4E0A A;  1QSO A;  5THW A;  4A38 A;  2Q7B A;  3PEI A;  3SIG A;  2Q4Z A;  3LOD A;  4IHM A;  4EWT A;  3CT9 A;  1S7N A;  4A39 A;  3FEE A;  4JYW A;  5LYF A;  1TXZ A;  1YR0 A;  2ZOG A;  2CTC A;  3CXQ A;  4KOS A;  2B58 A;  4B5P B;  1YK3 A;  3IWG A;  1XMB A;  2G0B A;  1Z8X A;  2B5G B;  2FG1 A;  4LX9 A;  4OC0 A;  4R3L A;  5HVG A;  2Q44 A;  4KOV A;  4UFV A;  5G21 A;  4A33 A;  1K4J A;  2Z3O A;  2Q43 A;  3BHX A;  3MN8 A;  5JPH A;  4KLV A;  4MHZ A;  4PXB A;  2HUZ A;  4XPL A;  5HXD A;  1TF8 A;  3FRM A;  4QVT A;  4OC4 A;  4CRY B;  1HEE A;  4QC6 A;  5F48 A;  4NGR A;  3DNS A;  4NGQ A;  1Q2Y A;  4ONW A;  2JEW A;  3TO9 A;  4YU9 A;  3IID A;  2X7B A;  5HVH A;  4XPD B;  2AFM A;  3Q6Z A;  3PRT A;  2Z3K A;  2OZU A;  3KKW A;  4CYP A;  5K8O A;  2OB0 A;  5EC4 A;  1IID A;  2Z0Z A;  4ESS A;  3B8G A;  3I3G A;  3ISZ A;  4P4E A;  4C2Z A;  3TFY A;  5FSX A;  1AMP A;  3EFA A;  3LAC A;  1VHE A;  1HDU A;  1PCA A;  2WCT A;  1YME A;  4OC1 A;  4CAF A;  4DNC A;  4PSX A;  5F47 A;  4OC2 A;  2ZEM A;  3G3S A;  4MFK A;  5HMN A;  4H6U A;  4P4I A;  3FIX A;  5EMI A;  2ZEE A;  4OKO A;  2FIW A;  5BWA B;  2PIY A;  2OR4 A;  3F8K A;  5F09 A;  3B3C A;  4OP4 A;  2BUE A;  2FAV A;  4KZT A;  3GQE A;  1YVO A;  4MMO A;  2PJ0 A;  5E3B A;  4A32 A;  3KQZ A;  3SI1 A;  3CXP A;  2IQ6 A;  1CPX A;  2FE7 A;  3EY5 A;  3D7G A;  3SJE A;  2L8R A;  4FBE A;  2JZF A;  2VZZ A;  4UEF A;  2QYV A;  2FT0 A;  4CAV A;  4NGN A;  2ANP A;  3PB9 X;  4PV6 A;  4CYO A;  5JH9 A;  5KTD A;  4CPA A;  2VL1 A;  3DGV A;  1DE4 C;  1ON0 A;  4B5P A;  2KCW A;  1R57 A;  2B4D A;  5HOL A;  2OZH A;  5AG6 A;  3NA6 A;  2OZG A;  1QSR A;  2RFH A;  4UFW A;  2BSW A;  1ZLH A;  4TU0 A;  4M6G A;  5G20 A;  1XEB A;  4QUS A;  4P4D A;  4BMH A;  2ODF A;  5CB3 A;  2I79 A;  4KOW A;  2ZOF A;  4FWU A;  1FY7 A;  1VGY A;  1VKC A;  1MK4 A;  4CGM A;  1R3N A;  3H5Z A;  4UA3 A;  3NFZ A;  5KTC A;  4J4Z A;  2PVW A;  3BI1 A;  3L2N A;  1V0C A;  4BIN A;  4HNW B;  4JD6 A;  1JQG A;  2O4H A;  4UML A;  4NGP A;  3EJG A;  4B14 A;  4A94 A;  3PBE A;  4RUH A;  1I1D A;  1M44 A;  2Z3L A;  3CZX A;  1YSJ A;  4B11 A;  2PJ9 A;  3PB8 X;  2FXK A;  3ZZI A;  3KI9 A;  1PUA A;  1Y9K A;  2PVV A;  1QST A;  4OC3 A;  4NJQ A;  1XE4 A;  2YNE A;  1GYT A;  5AGE A;  4MRI A;  3TE4 A;  2RB7 A;  2V8H A;  3D68 A;  4R6T A;  2VEZ A;  1M1D A;  2XD7 A;  4KOX A;  2AFS A;  2GLJ A;  4CGP A;  4OIW A;  3KR4 A;  5IB9 A;  1X10 A;  4CYQ A;  2D4P A;  1VHS A;  3IJ3 A;  5HIH A;  3SIJ A;  4H6Z A;  5G22 A;  2CIJ A;  2DXQ A;  4ZI6 A;  3S6K A;  2F8H A;  3GLJ A;  3KZW A;  2G3T A;  4YWY A;  2ZEP A;  3JTK A;  2VZY A;  4ZX8 A;  3IO1 A;  4NEX A;  4RS2 A;  3LD2 A;  4UEE A;  2AFW A;  1BPN A;  2RNK A;  1Q2C A;  4C2X A;  2VBQ A;  3TT2 A;  4B6Z A;  2AFZ A;  3Q71 A;  4KS9 A;  3D7D A;  3UY5 A;  4J5S A;  1Z8L A;  1ZR5 A;  2CNM A;  2PJ2 A;  3FMC A;  3FX6 A;  4KOR A;  4PK3 A;  4HPS A;  4UF4 A;  4XNH B;  2QVP A;  4YGO A;  3S9M A;  3V7Z A;  1FNO A;  3FNC A;  1DTD A;  4B10 A;  4II9 A;  2XEI A;  5JQ4 A;  5I0C A;  2IMO A;  4HNX B;  4HNY B;  4NSQ A;  3VWE A;  4R9M A;  1HJZ A;  4ONU A;  5LYD A;  4MCR A;  2GFQ A;  2VXK A;  4JJX A;  5A27 A;  2PC1 A;  2CTB A;  3IEH A;  1YGH A;  4A37 A;  3R1K A;  3S9L A;  2RC4 A;  4Y49 B;  3QNV A;  2PIZ A;  1XBU A;  2FCK A;  4HKF A;  4MHP A;  1IGB A;  1NMT A;  2EBJ A;  4OC5 A;  3D66 A;  5LRJ A;  3VH9 A;  2J8R A;  5CB5 A;  3GPQ A;  4XPD C;  3R9E A;  3D3S A;  5ISV A;  1TIQ A;  3FEC A;  1UFH A;  4JGK A;  1IY7 A;  3SII A;  1NE9 A;  1QQ9 A;  1QSM A;  2JDD A;  2REE A;  2ZEN A;  3NH8 A;  4FD6 A;  5F49 A;  3WC5 A;  4A30 A;  1IU8 A;  1TXR A;  2PJ8 A;  1S5K A;  5F46 A;  4U9Z A;  3EJF A;  2EUI A;  4Q38 A;  4CYN A;  3N5F A;  7CPA A;  5JGF A; 
#chains in the Genus database with same CATH homology
 2AFX A;  4NFR A;  5FSZ A;  4X3R A;  4UIB A;  2ZEG A;  5D8N A;  2Q51 A;  8CPA A;  5I4M A;  4ZY1 A;  5LRK A;  3ETI A;  3FF3 A;  3NH4 A;  2F7V A;  2EK9 A;  4FAI A;  1Q7L A;  2PJB A;  2NSM A;  1EE3 P;  4JCA A;  3FH4 A;  3FJU A;  4GM5 A;  2ACF A;  2O53 A;  4F9V A;  1YLO A;  3EWQ A;  1LAN A;  3B35 A;  3GB0 A;  5CBM A;  2BCO A;  1TY8 A;  4JZ0 A;  3PFE A;  4ZY2 A;  4ETK A;  3BI0 A;  1TKH A;  1FT7 A;  4EFD A;  3KR5 A;  4MCP A;  4PQA A;  3HUV A;  3IIF A;  1VHO A;  4NGS A;  3DLJ A;  1CBX A;  1TKJ A;  3EWP A;  2GU2 A;  4Q7A A;  2C6C A;  2PJ7 A;  2WZN A;  4UEZ A;  2PCU A;  2GRE A;  3IIB A;  3HLP A;  3IC1 A;  2XEG A;  2EEE A;  2AFO A;  2LGR A;  3LMS A;  5FSY A;  2V77 A;  1UWY A;  2C6P A;  3K9T A;  1BLL E;  2I3C A;  3TC8 A;  5LYL A;  4ABL A;  5DUS A;  5ELY A;  4BD9 A;  2V8V A;  3VAR A;  3WAB A;  2BFQ A;  3VFQ A;  2DX6 A;  3WC6 A;  3SJF A;  4KYB A;  2C1C A;  5AIL A;  3B3W A;  5D29 A;  5JM6 A;  3KQX A;  5J1Q A;  4NGT A;  1HDQ A;  2EWB A;  1Y7E A;  4ZY0 A;  1ZG8 A;  3GPG A;  3SIH A;  1M4L A;  1F2O A;  3K2K A;  2JBK A;  4TWE A;  4AXV A;  1LCP A;  4MHN A;  4P10 A;  3H8E A;  3RZA A;  1LAP A;  4PXC A;  4JLL A;  5LRG A;  1XJO A;  3LWU A;  3SJX A;  2C6G A;  2ZEL A;  1CG2 A;  4P4J A;  1TF9 A;  4P4F A;  1RTQ A;  1XFO A;  3ISX A;  1YW4 A;  1LFW A;  1SPV A;  3D7H A;  1VHU A;  2HB6 A;  2PE3 A;  3EW5 A;  4NGM A;  2POK A;  3VAT A;  4DYO A;  3CPX A;  1ZR3 A;  4PXE A;  1KWM A;  4GVV A;  5FSU A;  5DS0 A;  3KHZ A;  4MHY A;  3I1U A;  3PB7 X;  3SJG A;  4WJB A;  3WT4 A;  3B7I A;  4ZX9 A;  1TKF A;  2PJ6 A;  2EK8 A;  1NSA A;  1ELL P;  2DEA A;  3D67 A;  1CX8 A;  4MCQ A;  4J5R A;  1ARM A;  4MCS A;  5FSV A;  4W9Y A;  2PJA A;  4OID A;  6CPA A;  3T8W A;  1PYT B;  2HC9 A;  3SI0 A;  1AYE A;  2WYR A;  4X2T A;  2QJ8 A;  3FED A;  3H8G A;  1F57 A;  3H8F A;  2G9D A;  3MRU A;  1OBR A;  2PJC A;  3B3S A;  3PB6 X;  3BXM A;  3V38 A;  4KSI A;  2J9A A;  4K0C A;  1Y0Y A;  4DUK A;  2XEF A;  1R43 A;  4FUU A;  4TNU A;  1ZG9 A;  3B2Y A;  3D4U A;  5K8N A;  5CPA A;  1Y0R A;  2X47 A;  2FVG A;  2ZED A;  3PB4 X;  4DJL A;  4P4B A;  2AFC A;  3RBU A;  3PFO A;  2ZEO A;  2OOT A;  3B3V A;  3EWR A;  4MXU A;  4R76 A;  2BOA A;  4PPZ A;  1VIX A;  3NH5 A;  1YW6 A;  2ZEF A;  4K3N A;  1BAV A;  4ABK A;  2XEJ A;  3KHX A;  3EWO A;  2V8G A;  4GVW A;  1CPS A;  4F9U A;  4J5Q A;  4O23 A;  2ABZ A;  1XRY A;  3TX8 A;  4G1P A;  1Z2L A;  2AFU A;  4IAV A;  4P6Y A;  3RAM A;  2BFR A;  1QMU A;  4GUA A;  5K8M A;  2IJZ A;  4X8I A;  4R8F A;  1ARL A;  1CP6 A;  1LOK A;  4H2K A;  3SI2 A;  2CF4 A;  1NJR A;  2VRI A;  2PJ4 A;  1F2P A;  4D86 A;  3S9N A;  3B3T A;  3PBB A;  5CMS A;  2V8D A;  3GPO A;  4Z65 A;  5K8P A;  4ZYQ A;  1ZLI A;  5LYI A;  2PRQ A;  3WC7 A;  1CP7 A;  4UIA A;  2PJ5 A;  3GUX A;  4R7M A;  4P44 A;  3CPA A;  2ZEH A;  3JZT A;  1ZG7 A;  4ETJ A;  3KAS A;  1ELM P;  3KGQ A;  4JVV A;  3IFE A;  3JRU A;  3GQO A;  5HVF A;  2PJ1 A;  1H8L A;  4F8Z A;  1Z5R A;  4P45 A;  1YD9 A;  4IQY A;  3IWW A;  2PJ3 A;  3KL9 A;  2NYQ A;  4OME A;  1LAM A;  2BO9 A;  3V45 A;  3EKE A;  2JBJ A;  3FVL A;  3CDX A;  4IK2 A;  3D7F A;  1BPM A;  3V2B A;  4WWV A;  4EME A;  2GLF A;  4PXD A;  4LQG A;  4NJR A;  4A38 A;  5THW A;  3PEI A;  3SIG A;  2Q4Z A;  4IHM A;  4EWT A;  3CT9 A;  4A39 A;  3FEE A;  4JYW A;  5LYF A;  1TXZ A;  2ZOG A;  2CTC A;  1XMB A;  2FG1 A;  4OC0 A;  5HVG A;  2Q43 A;  3BHX A;  3MN8 A;  4MHZ A;  4PXB A;  5HXD A;  1TF8 A;  4OC4 A;  1HEE A;  4NGR A;  4ONW A;  4NGQ A;  2JEW A;  3IID A;  5HVH A;  2AFM A;  3Q6Z A;  3PRT A;  5K8O A;  4ESS A;  4P4E A;  3ISZ A;  5FSX A;  1AMP A;  1VHE A;  1HDU A;  1PCA A;  1YME A;  4OC1 A;  4OC2 A;  2ZEM A;  4P4I A;  2ZEE A;  4OKO A;  2PIY A;  2OR4 A;  5F09 A;  3B3C A;  4OP4 A;  2FAV A;  3GQE A;  4MMO A;  2PJ0 A;  5E3B A;  3KQZ A;  3SI1 A;  2IQ6 A;  1CPX A;  3D7G A;  3SJE A;  2L8R A;  4FBE A;  4UEF A;  2QYV A;  4NGN A;  2ANP A;  3PB9 X;  5JH9 A;  4CPA A;  2VL1 A;  3DGV A;  1DE4 C;  5HOL A;  3NA6 A;  2RFH A;  1ZLH A;  4TU0 A;  4P4D A;  5CB3 A;  2ZOF A;  4FWU A;  1VGY A;  1R3N A;  3NFZ A;  4J4Z A;  2PVW A;  3BI1 A;  3L2N A;  1JQG A;  2O4H A;  4UML A;  4NGP A;  3EJG A;  4A94 A;  3PBE A;  4RUH A;  1YSJ A;  2PJ9 A;  3PB8 X;  2FXK A;  3KI9 A;  2PVV A;  4OC3 A;  4NJQ A;  1GYT A;  4MRI A;  2RB7 A;  2V8H A;  3D68 A;  4R6T A;  2XD7 A;  2AFS A;  2GLJ A;  4OIW A;  3KR4 A;  5IB9 A;  3IJ3 A;  5HIH A;  3SIJ A;  2CIJ A;  4ZI6 A;  2F8H A;  3GLJ A;  3KZW A;  4YWY A;  2ZEP A;  4ZX8 A;  3IO1 A;  4UEE A;  2AFW A;  1BPN A;  4B6Z A;  2AFZ A;  3Q71 A;  3D7D A;  4J5S A;  1ZR5 A;  3FX6 A;  1Z8L A;  3FMC A;  2PJ2 A;  4UF4 A;  3V7Z A;  2QVP A;  3S9M A;  1FNO A;  1DTD A;  2XEI A;  2IMO A;  1HJZ A;  5LYD A;  4MCR A;  2CTB A;  3IEH A;  4A37 A;  3S9L A;  3QNV A;  2PIZ A;  1XBU A;  5LRJ A;  3VH9 A;  4MHP A;  1IGB A;  4OC5 A;  3D66 A;  5CB5 A;  3GPQ A;  3FEC A;  4JGK A;  1IY7 A;  3SII A;  1QQ9 A;  3NH8 A;  4YU9 A;  2ZEN A;  3WC5 A;  1TXR A;  2PJ8 A;  3EJF A;  3N5F A;  7CPA A;  5JGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...