1BPMA

Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
484
structure length
481
Chain Sequence
TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase(alpha-aminoacylpeptide)
molecule keywords LEUCINE AMINOPEPTIDASE
publication title Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
total genus 155
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1993-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1bpmA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1bpmA02
4OC4A 3GPGA 2FXKA 3K2KA 4AXVA 3SJEA 2XEGA 3FEEA 1KWMA 2BO9A 2NYQA 3FX6A 4IK2A 4BD9A 3CPXA 1XFOA 2ZEFA 4P10A 1QMUA 5K8MA 1LCPA 4ZY2A 4R76A 4ABLA 3NH5A 3V7ZA 1R43A 2GLFA 2QJ8A 4P4IA 3SIJA 5J1QA 1DE4C 4IHMA 5HVGA 2V8DA 2PJ2A 4OC3A 2DX6A 3PFEA 3NH8A 3IWWA 5F09A 4OC5A 1IGBA 1ZG7A 3IIDA 1M4LA 3EWPA 2O53A 4OIWA 3H8GA 5LRGA 2HB6A 3PB7X 1AMPA 4MMOA 4G1PA 3KQXA 2PJCA 3VATA 4PPZA 3FH4A 1PYTB 3FF3A 2BFRA 1XBUA 1YSJA 4PXEA 2PJ3A 1NSAA 1YW6A 2Q51A 3SIGA 5CMSA 4JYWA 3KI9A 4ZYQA 4MRIA 3PBEA 2PIYA 2NSMA 3LWUA 5THWA 3WT4A 2C1CA 5IB9A 4YWYA 3N5FA 4UIBA 3D66A 4GM5A 2JBJA 4TWEA 3SI0A 1FNOA 1TKFA 1NJRA 2JEWA 4NGRA 4NGQA 2IMOA 1VHUA 3V2BA 4EWTA 4EFDA 4JVVA 3BXMA 1Q7LA 4MHPA 4ZI6A 3S9NA 2AFOA 3EJFA 3KHXA 2WZNA 5FSVA 3JZTA 4OC2A 4PXDA 1Y7EA 1CBXA 2ZEHA 4K0CA 2PIZA 3FMCA 2CTBA 1HDQA 2AFUA 4PXBA 4D86A 5JGFA 2XEFA 1LFWA 4YU9A 3MN8A 3D7FA 4A94A 2C6PA 1CPSA 1TF9A 1LAMA 4X8IA 3CT9A 3EWRA 3ETIA 3TC8A 4KYBA 2ABZA 3HLPA 3KR4A 1BAVA 2ACFA 4DYOA 1VHEA 4MCSA 3GPOA 5LYLA 3KL9A 4F9VA 3B3WA 1VIXA 3RBUA 3PB4X 5K8NA 2RFHA 2PJ9A 2DEAA 3IJ3A 4UIAA 3EWOA 3SIHA 1OBRA 3L2NA 1Z5RA 4CPAA 3BI1A 3IC1A 4TU0A 2GLJA 3GPQA 2XEIA 2RB7A 2V8HA 2Q43A 2IJZA 4X3RA 2AFSA 4ZX8A 5CBMA 1CG2A 4TNUA 2PJ7A 2AFCA 1YLOA 3H8EA 1XJOA 2AFZA 2V8GA 4ONWA 4Q7AA 5LRKA 1ZR5A 2HC9A 1Z8LA 3SJFA 1XMBA 4P44A 5AILA 3SJGA 3SIIA 5JH9A 4EMEA 5CPAA 4UEEA 4NFRA 3LMSA 3B3TA 1ARMA 3BI0A 2PRQA 5HIHA 4P6YA 5FSXA 5FSZA 2LGRA 3WC5A 2CF4A 3B35A 4FWUA 3GQOA 1FT7A 4JZ0A 5DUSA 1ELLP 4FUUA 4NGMA 3VARA 4R6TA 2V8VA 4UEFA 3FECA 3FEDA 3KASA 1CPXA 4OP4A 6CPAA 4J5RA 5DS0A 1Y0RA 2O4HA 3KR5A 3SI1A 4FAIA 3RZAA 2JBKA 1TF8A 4MCQA 1JQGA 4ZY0A 3KHZA 2ZOFA 4MCRA 2ANPA 3DGVA 3IEHA 3K9TA 2G9DA 1RTQA 3PB9X 5CB5A 2OOTA 2EEEA 4P4EA 2EK8A 1CP6A 1ZLIA 3MRUA 5I4MA 1TKJA 1BPNA 3NA6A 3GB0A 3I1UA 4FBEA 2PVWA 1R3NA 4NGNA 3B3CA 3B3SA 1F57A 4ZX9A 1YW4A 3JRUA 3DLJA 4KSIA 2BOAA 5JM6A 5FSYA 4J5QA 4K3NA 3S9MA 2ZENA 3KQZA 3PRTA 1UWYA 7CPAA 4ZY1A 4Z65A 1ZLHA 5HXDA 1BPMA 4P4JA 4UF4A 1HDUA 2OR4A 3IFEA 2PJ1A 3WABA 1SPVA 2CTCA 2C6GA 5HOLA 2F8HA 2GREA 2AFWA 4F8ZA 4ABKA 3IIFA 4GUAA 4ESSA 4J5SA 2CIJA 5D29A 5HVFA 1Z2LA 4NGSA 2PCUA 1CX8A 4P4DA 4ETKA 1VHOA 4OKOA 3Q6ZA 3CDXA 4NJRA 2ZEDA 1LAPA 2F7VA 4OMEA 1LANA 3EKEA 4NJQA 1TKHA 2ZEOA 3GLJA 4R8FA 4MCPA 3HUVA 4F9UA 2FAVA 4PXCA 2FVGA 3PFOA 2Q4ZA 4GVWA 3KZWA 4WWVA 4A38A 3PEIA 3D7HA 2ZEMA 1F2PA 3D68A 5FSUA 5HVHA 3H8FA 2BCOA 2ZEEA 3VFQA 1QQ9A 1F2OA 2PVVA 2L8RA 2VRIA 3NH4A 4J4ZA 3B7IA 3D7DA 1YMEA 2VL1A 3RAMA 2ZEPA 4GVVA 4IQYA 4O23A 3FVLA 2J9AA 2PJ5A 3ISXA 3KGQA 3TX8A 4R7MA 3D7GA 4PQAA 1HJZA 3IO1A 4P45A 4DUKA 2XEJA 4A37A 4W9YA 4B6ZA 5K8PA 4P4FA 2AFXA 3B2YA 4OIDA 4NGTA 4X2TA 2XD7A 2BFQA 2POKA 1DTDA 2PJ8A 3NFZA 4MHYA 4RUHA 1VGYA 5LYIA 5E3BA 5LRJA 1ZG9A 1TXZA 3Q71A 1ARLA 5ELYA 2X47A 2EWBA 2C6CA 1ELMP 3GUXA 4OC1A 3CPAA 5LYFA 1AYEA 4MHNA 1PCAA 2I3CA 4UEZA 2IQ6A 1TXRA 3ISZA 4LQGA 1ZG8A 3EW5A 4WJBA 2PJ4A 3D67A 1EE3P 5K8OA 3PBBA 4IAVA 4NGPA 1XRYA 3B3VA 1IY7A 4JGKA 5CB3A 2QYVA 3PB6X 4UMLA 2GU2A 4JCAA 4ETJA 4P4BA 3S9LA 3V38A 1H8LA 2ZOGA 1YD9A 3BHXA 4JLLA 5LYDA 2ZEGA 4MXUA 4OC0A 3QNVA 3V45A 4DJLA 3SI2A 4A39A 3EWQA 1LOKA 2PE3A 2WYRA 3IIBA 3SJXA 1Y0YA 4MHZA 1GYTA 2ZELA 3FJUA 3WC6A 1CP7A 1HEEA 2FG1A 1TY8A 2PJAA 2V77A 2EK9A 3PB8X 2QVPA 2AFMA 8CPAA 2PJ6A 3T8WA 2PJ0A 1BLLE 3WC7A 3GQEA 5D8NA 1ZR3A 2PJBA 3EJGA 3VH9A 4H2KA 3D4UA
chains in the Genus database with same CATH superfamily
2QIRA 5KTDA 1S5KA 2VZYA 2P6FA 4OC4A 3GPGA 2FXKA 3K2KA 3MGDA 4KOVA 3CXQA 1VHSA 2JZEA 4NXYA 4AXVA 4DNCA 3SJEA 2XEGA 2Z10A 1KWMA 3FEEA 3WR7A 4B12A 2OZGA 3W6SA 5HH1A 1MJAA 4OADA 3FRMA 2BO9A 3W91A 2NYQA 3FX6A 4IK2A 4M85A 4JD6A 3CPXA 4BD9A 1XFOA 4CGOA 2PDOA 2ZEFA 4P10A 1QMUA 5K8MA 2Z3NA 4K30A 1LCPA 4ZY2A 1M44A 3G3SA 4KUBA 4R76A 4ABLA 3NH5A 3V7ZA 1R43A 2WCTA 2GLFA 2QJ8A 1B6BA 4P4IA 4CYQA 1QSNA 2KCWA 3SIJA 5I0CA 5J1QA 2R98A 1DE4C 4IHMA 4PK2A 5H86A 2V8DA 3TO7A 4ZGYB 5HVGA 2PJ2A 1A2ZA 1XE4A 4OC3A 2DX6A 3PFEA 2EBJA 3TT2A 3EY5A 3NH8A 3IWWA 5F09A 3T9YA 3F8KA 2CNMA 1MJ9A 4OC5A 1Z8XA 1IGBA 1ZG7A 4YRHA 3IIDA 1M4LA 3R9EA 2R8VA 3EWPA 1S7KA 1QSMA 4FD6A 4AG7A 2O53A 3FBUA 3EXNA 3JVNA 4OIWA 3H8GA 3GY9A 4A30A 1UFHA 2PSWA 5LRGA 2HB6A 4B10A 2Z3LA 2PR1A 3PB7X 1AMPA 4LUAA 4MMOA 4M6IA 1M4IA 5G1ZA 3S6GA 4G1PA 4QC6A 4AVBA 3KQXA 2PJCA 3VATA 2GANA 4PPZA 4A31A 4I49A 4IUSA 3FH4A 1PYTB 4BMHA 4JJXA 3FF3A 2BFRA 1XBUA 1YSJA 5IX3A 4PXEA 2PJ3A 1NSAA 1YW6A 2Q04A 2BSWA 1Q2YA 2Q51A 4OLLA 3SIGA 5CMSA 4JYWA 3DR8A 4RN7A 3KI9A 4ZYQA 3VWDA 3FNCA 1Y9WA 3DSBA 3PBEA 4MRIA 4MBUA 2PIYA 2ZW7A 4YFJA 2NSMA 2BL1A 3LWUA 4NSQA 5THWA 4IF5A 3WT4A 4XNHC 2C1CA 5IB9A 4YGOA 4YWYA 3N5FA 4UIBA 3PP9A 3D66A 3S6FA 1MK4A 4GM5A 2JBJA 3F5BA 4TWEA 3SI0A 4B14A 1FNOA 1TKFA 2D4OA 4FD4A 4CAEA 4CGLA 4CAVA 3TO9A 1B87A 1NJRA 2JEWA 3I9SA 2R7HA 4MJ8A 4NGRA 3KKWA 4NGQA 4UFVA 3TOBA 2IMOA 4KLWA 1S7FA 1VHUA 2FS5A 3V2BA 1Z4RA 4KVXA 4EFDA 4JVVA 3E0KA 4EWTA 3BXMA 5HVHA 1Q7LA 1RO5A 4JXRA 3P2HA 4MHPA 4ZI6A 3S9NA 2AFOA 1S7NA 3EJFA 2GE3A 2PR8A 3KHXA 2WZNA 4JWPA 2QECA 1YX0A 4AVAA 5FSVA 3JZTA 4OC2A 2VI7A 2PC1A 2EO8A 3S6HA 2Q4YA 4B5PA 2QMLA 4PXDA 4KUAA 2C27A 1Y7EA 1CBXA 3ZZIA 1S60A 2ZEHA 4K0CA 2PIZA 3FMCA 3R1KA 1YK3A 2CTBA 4NF1A 1HDQA 3JUWA 2AFUA 3IWGA 4PXBA 4D86A 2RC4A 3A9LA 2FL4A 3P2FA 3EFAA 5JGFA 2XEFA 2G3AA 3N7ZA 4KOXA 4BBHA 3D2PA 1LFWA 3LODA 4YU9A 3MN8A 2DXQA 4J3GA 3D7FA 5AG4A 4A94A 2C6PA 1CPSA 3TOAA 1TF9A 1LAMA 4XPDB 4F6AA 4X8IA 3IGRA 4H89A 3SXOA 3TE4A 2Q0YA 4CAFA 3CT9A 3EWRA 3ETIA 3TC8A 4KYBA 1YVKA 2B4BA 2FIAA 3QB8A 3SXNA 2ABZA 3BJ7A 3HLPA 5F46A 1IB1E 3KR4A 1BAVA 5AGEA 3D8PA 2OZUA 1WK4A 2ACFA 3I3GA 4DYOA 3V8IA 1VHEA 4MCSA 3GPOA 5LYLA 2CNSA 2I00A 3KL9A 4F9VA 4LX9A 3B3WA 1VIXA 1KZFA 3PB4X 3RBUA 5K8NA 2RFHA 2PJ9A 2DEAA 3IJ3A 5FVJA 3QAHA 4JLYA 4UIAA 2HQYA 2YNCC 3EWOA 1Q2DA 3SIHA 2OZHA 1OBRA 4NCZA 3L2NA 3SHPA 1Z5RA 2B4DB 4CPAA 1OZPA 1TIQA 4FD7A 3BI1A 4UFWA 4E8OA 3IC1A 4HNYB 4TU0A 4F0XA 2GLJA 4KVME 4B5PB 3GPQA 3CXSA 2G3TA 1AUGA 1IYKA 2RB7A 2XEIA 2V8HA 4A32A 4QBJA 2DPSA 2Q43A 5C82A 2P6EA 4CYPA 4Y49C 2IJZA 1NE9A 3NE8A 4X3RA 3IWEA 1XF8A 4ZX8A 5CBMA 1CG2A 2AFSA 4JXQA 4CRYB 1CM0A 4TNUA 2PJ7A 4KVOE 2AFCA 1YLOA 3H8EA 2ODFA 2Q7SA 5F48A 2CXAA 4LQ6A 4ZBGA 1YLEA 5H84A 3TO6A 1XJOA 2AFZA 2V8GA 4ONWA 4Q7AA 5LRKA 1ZR5A 2HC9A 4ONUA 1Z8LA 3UY5A 1NMTA 4UWIA 3SJFA 4QVTA 1XMBA 4P44A 5AILA 4AB7A 2OU2A 3SJGA 3SIIA 4AVCA 5ISVA 5JH9A 1YREA 1BO4A 4EMEA 5CPAA 3IU2A 4UEEA 4NFRA 3LMSA 2Z3KA 3B3TA 1ARMA 2H5MA 1ON0A 3BI0A 4NGPA 2PRQA 4RS2A 5HIHA 4P6YA 5FSXA 5FSZA 2LGRA 1KUYA 2CF4A 3B35A 3PGPA 4FWUA 3GQOA 3R95A 1FT7A 4UCNA 2BEIA 1PU9A 4JZ0A 4UCMA 4R57A 1QSRA 5DUSA 1ELLP 4FUUA 2Z3OA 4NGMA 3VARA 2VXKA 4R6TA 2VEZA 1S3ZA 3BLNA 2V8VA 3LD2A 3FECA 1J4JA 4UEFA 3FEDA 4FD5A 3KASA 1CPXA 4OP4A 5F47A 2B5GB 4KSAA 3EC4A 6CPAA 4J5RA 5DS0A 1Y0RA 1Z8WA 1CJWA 4AG9A 4UA3A 2O4HA 3KR5A 3CXPA 4U9ZA 4X5KA 3RZAA 3SI1A 2JBKA 4CS0B 4FAIA 4UBRA 1TF8A 4B11A 2I79A 2Z11A 4MCQA 2JDDA 1JQGA 4ZY0A 4PSWA 3KHZA 2ZOFA 4MFLA 4MCRA 2ANPA 2WPWA 1PUAA 3R9GA 4C68A 3DGVA 4CRZB 3IEHA 3K9TA 1XOVA 2G9DA 1IICA 2FT0A 2R1IA 4KOYA 5KTCA 1RTQA 4CAWA 3PB9X 5CB5A 4H6ZA 2OOTA 3S6KA 2EEEA 4P4EA 5JQ4A 5JPHA 2EK8A 3RNZA 3JTKA 1CP6A 5GCNA 4CGMA 4MFKA 2P0WA 1ZLIA 2YNDA 1KUXA 3MRUA 1VKCA 5I4MA 2P6GA 4PK3A 3FXTA 5G21A 1TKJA 1BPNA 1WWZA 4PV6A 2WPXA 3NA6A 4KLVA 1Z9UA 2Y0MA 1M1DA 4A2ZA 2HUZA 1N71A 3GB0A 3I1UA 4FBEA 4ORFA 5J8FA 2PVWA 4XPLA 1R3NA 2B3VA 4NGNA 3B3CA 3B3SA 5A27A 1F57A 4MI4A 4ZX9A 4OAEA 1YW4A 3JRUA 3DLJA 4M3SA 4R3LA 2Q44A 4UCPA 2JZDA 4KORA 4KSIA 4RI1A 2BOAA 5JM6A 5FSYA 4J5QA 4UFXA 4K3NA 3S9MA 2ZENA 2AE6A 4A33A 3KQZA 5C88A 4UWJA 3PRTA 5EC4A 1UWYA 5G22A 7CPAA 4MY0A 2YGWA 4ZY1A 2OB0A 2REFA 4MHDA 4Z65A 1ZLHA 4F0YA 2VBQA 1U6MA 1BPMA 5HXDA 4QUSA 4P4JA 4UF4A 1HDUA 2OR4A 3IFEA 3VWEA 2GIVA 2PJ1A 4U9YA 4Y49B 3R9FA 3WABA 5J8CA 1SPVA 1P4NA 2IL4A 3F0AA 2CTCA 3T90A 4MY3A 2C6GA 2J8NA 2VQYA 5HOLA 2O28A 1R57A 2F8HA 2GREA 5EMIA 2BUEA 5AG5A 2AFWA 3K9UA 2Q4VA 4F8ZA 4ABKA 3IIFA 4GUAA 3CZXA 4XPKA 4ESSA 4J5SA 2CIJA 5D29A 2OH1A 5HVFA 1Z2LA 4NGSA 1L0CA 2JEVA 2PCUA 2ZW4A 3GYAA 4HNXB 3TCVA 1CX8A 5DWNA 1YVOA 1XEBA 2A4NA 1MJBA 2FCKA 2FE7A 4L89A 4P4DA 4C2YA 2DF5A 1GHEA 4ETKA 1SQHA 1VHOA 4OKOA 5F49A 1XIXA 3Q6ZA 1LRZA 4PSXA 2K5TA 5KTAA 1YR0A 3CDXA 4NJRA 2ZEDA 1LAPA 1X12A 5IV0A 2F7VA 2JDCA 1K4JA 4OMEA 1LANA 3EKEA 4NJQA 2KQVA 4E2AA 1TKHA 2ZEOA 3FIXA 3GLJA 4KSFA 4R8FA 4MCPA 2J8RA 3HUVA 4MFZA 4F9UA 2FAVA 3FB3A 4PXCA 2FVGA 2W2GA 3PFOA 5G20A 2Q4ZA 5IB0A 4XPDC 1QSTA 2D4PA 4GVWA 3KZWA 4GXHA 4WWVA 2WUUA 4A38A 1NSLA 3PEIA 3D7HA 2ZEMA 2RNKA 1F2PA 5FSUA 2AJ6A 3D68A 4XNHB 2WSAA 1I1DA 3H8FA 3WC5A 2Z3MA 3TTHA 2BCOA 2FXFA 2ZEEA 4M6GA 4CGPA 5BWAB 3VFQA 2FIWA 1QQ9A 3DR6A 4H6UA 1F2OA 2HV2A 2G0BA 2PVVA 2B4DA 2L8RA 1FY7A 1M4GA 2VRIA 3EO4A 3R96A 3NH4A 4U5YA 3C26A 4J4ZA 2ARHA 2EUIA 4II9A 2PQ8A 3TFYA 3B7IA 3D7DA 2ZPAA 1YMEA 2VL1A 3RAMA 2ZEPA 4KZTA 1P0HA 2X7BA 4GVVA 3PZJA 4HKFA 5CNPA 4IQYA 4O23A 3FVLA 2J9AA 1Z8TA 2PJ5A 3ISXA 3KGQA 3TX8A 4R7MA 2REEA 3D7GA 4KS9A 2JZFA 4PQAA 1HJZA 2YNEA 3IO1A 2B3UA 4P45A 4DUKA 2XEJA 1I12A 1Y9KA 4A37A 4W9YA 4B6ZA 4L8AA 4MFPA 4P4FA 5AG6A 5K8PA 2Z3PA 2AFXA 3B2YA 4CAXA 2ZXVA 4OIDA 5A28A 4KOSA 4NGTA 4X2TA 2XD7A 4QB9A 3D3SA 2BFQA 2POKA 1IU8A 3GIUA 1DTDA 4Q38A 2PJ8A 4KOUA 3DDDA 3NFZA 4MHYA 5DWMA 4RUHA 4Q36A 3OWCA 1VGYA 5LYIA 5E3BA 5HMNA 5LRJA 1ZG9A 1TXZA 3Q71A 4C2XA 1ARLA 1X10A 1I21A 5ELYA 3RYOA 1V0CA 2X47A 3B8GA 3RO0A 2EWBA 2GFQA 2C6CA 1ELMP 1KUVA 4NEXA 2ATRA 4CYNA 3GUXA 4OC1A 4CYOA 1YGHA 3CPAA 5LYFA 1AYEA 4E0AA 4KOWA 4MHNA 1PCAA 2I3CA 1IOIA 4C7HA 2EVNA 5E96A 4R3KA 4UEZA 1QSOA 2IQ6A 1TXRA 4MFJA 3ISZA 5AG7A 4LQGA 1ZG8A 2ZW6A 3EW5A 4WJBA 2PJ4A 3D67A 2Q7BA 4EVYA 1EE3P 2B5GA 3BJ8A 5K8OA 1ZO0A 3LACA 3PBBA 1XRYA 4HNWB 3B3VA 1IY7A 1JWQA 4IAVA 4JGKA 3QAYA 4HPSA 5CB3A 2QYVA 3PB6X 4UMLA 1S7LA 3GKRA 2GU2A 3G8WA 4MFQA 4R9MA 4JCAA 4ETJA 4P4BA 3S9LA 3V38A 1H8LA 4C2ZA 2ZOGA 1YD9A 3BHXA 2CNTA 4JLLA 3DNSA 2NMTA 5LYDA 2ZEGA 1M4DA 1BOBA 2Z0ZA 1YQEA 2VZZA 4MXUA 2FSRA 1XMTA 4OC0A 2CY2A 3QNVA 1IOFA 3V45A 4DJLA 3SI2A 4R87A 4A39A 3EWQA 2DPTA 2JLMA 3D2MA 4GS4A 3ZJ0A 1LOKA 2PE3A 2WYRA 4CGNA 3IIBA 1Z4EA 3W6XA 3H5ZA 3SJXA 1Y0YA 4MHZA 1GYTA 2B58A 2ZELA 3FJUA 3WC6A 1CP7A 1HEEA 2FG1A 1TY8A 2PRBA 4A95A 4KOTA 2PJAA 2V77A 1IYLA 2EK9A 3NE7A 3PB8X 2F5IA 2QVPA 2AFMA 8CPAA 2PJ6A 3T8WA 2PJ0A 4B5OA 1BLLE 2J8MA 3WC7A 3GQEA 5D8NA 1ZR3A 4BINA 1Q2CA 2PJBA 1Y7RA 1RXTA 3EJGA 5EBVA 3VH9A 4M6HA 1IIDA 3IU1A 3H4QA 4H2KA 4C7IA 2YNCA 4B13A 3FYNA 2ZW5A 3D4UA
chains in the Genus database with same CATH topology
4OC4A 3GPGA 2FXKA 3K2KA 4AXVA 3SJEA 2XEGA 3FEEA 1KWMA 2BO9A 2NYQA 3FX6A 4IK2A 4BD9A 3CPXA 1XFOA 2ZEFA 4P10A 1QMUA 5K8MA 1LCPA 4ZY2A 4R76A 4ABLA 3NH5A 3V7ZA 1R43A 2GLFA 2QJ8A 4P4IA 3SIJA 5J1QA 1DE4C 4IHMA 5HVGA 2V8DA 2PJ2A 4OC3A 2DX6A 3PFEA 3NH8A 3IWWA 5F09A 4OC5A 1IGBA 1ZG7A 3IIDA 1M4LA 3EWPA 2O53A 4OIWA 3H8GA 5LRGA 2HB6A 3PB7X 1AMPA 4MMOA 4G1PA 3KQXA 2PJCA 3VATA 4PPZA 3FH4A 1PYTB 3FF3A 2BFRA 1XBUA 1YSJA 4PXEA 2PJ3A 1NSAA 1YW6A 2Q51A 3SIGA 5CMSA 4JYWA 3KI9A 4ZYQA 4MRIA 3PBEA 2PIYA 2NSMA 3LWUA 5THWA 3WT4A 2C1CA 5IB9A 4YWYA 3N5FA 4UIBA 3D66A 4GM5A 2JBJA 4TWEA 3SI0A 1FNOA 1TKFA 1NJRA 2JEWA 4NGRA 4NGQA 2IMOA 1VHUA 3V2BA 4EWTA 4EFDA 4JVVA 3BXMA 1Q7LA 4MHPA 4ZI6A 3S9NA 2AFOA 3EJFA 3KHXA 2WZNA 5FSVA 3JZTA 4OC2A 4PXDA 1Y7EA 1CBXA 2ZEHA 4K0CA 2PIZA 3FMCA 2CTBA 1HDQA 2AFUA 4PXBA 4D86A 5JGFA 2XEFA 1LFWA 4YU9A 3MN8A 3D7FA 4A94A 2C6PA 1CPSA 1TF9A 1LAMA 4X8IA 3CT9A 3EWRA 3ETIA 3TC8A 4KYBA 2ABZA 3HLPA 3KR4A 1BAVA 2ACFA 4DYOA 1VHEA 4MCSA 3GPOA 5LYLA 3KL9A 4F9VA 3B3WA 1VIXA 3RBUA 3PB4X 5K8NA 2RFHA 2PJ9A 2DEAA 3IJ3A 4UIAA 3EWOA 3SIHA 1OBRA 3L2NA 1Z5RA 4CPAA 3BI1A 3IC1A 4TU0A 2GLJA 3GPQA 2XEIA 2RB7A 2V8HA 2Q43A 2IJZA 4X3RA 2AFSA 4ZX8A 5CBMA 1CG2A 4TNUA 2PJ7A 2AFCA 1YLOA 3H8EA 1XJOA 2AFZA 2V8GA 4ONWA 4Q7AA 5LRKA 1ZR5A 2HC9A 1Z8LA 3SJFA 1XMBA 4P44A 5AILA 3SJGA 3SIIA 5JH9A 4EMEA 5CPAA 4UEEA 4NFRA 3LMSA 3B3TA 1ARMA 3BI0A 2PRQA 5HIHA 4P6YA 5FSXA 5FSZA 2LGRA 3WC5A 2CF4A 3B35A 4FWUA 3GQOA 1FT7A 4JZ0A 5DUSA 1ELLP 4FUUA 4NGMA 3VARA 4R6TA 2V8VA 4UEFA 3FECA 3FEDA 3KASA 1CPXA 4OP4A 6CPAA 4J5RA 5DS0A 1Y0RA 2O4HA 3KR5A 3SI1A 4FAIA 3RZAA 2JBKA 1TF8A 4MCQA 1JQGA 4ZY0A 3KHZA 2ZOFA 4MCRA 2ANPA 3DGVA 3IEHA 3K9TA 2G9DA 1RTQA 3PB9X 5CB5A 2OOTA 2EEEA 4P4EA 2EK8A 1CP6A 1ZLIA 3MRUA 5I4MA 1TKJA 1BPNA 3NA6A 3GB0A 3I1UA 4FBEA 2PVWA 1R3NA 4NGNA 3B3CA 3B3SA 1F57A 4ZX9A 1YW4A 3JRUA 3DLJA 4KSIA 2BOAA 5JM6A 5FSYA 4J5QA 4K3NA 3S9MA 2ZENA 3KQZA 3PRTA 1UWYA 7CPAA 4ZY1A 4Z65A 1ZLHA 5HXDA 1BPMA 4P4JA 4UF4A 1HDUA 2OR4A 3IFEA 2PJ1A 3WABA 1SPVA 2CTCA 2C6GA 5HOLA 2F8HA 2GREA 2AFWA 4F8ZA 4ABKA 3IIFA 4GUAA 4ESSA 4J5SA 2CIJA 5D29A 5HVFA 1Z2LA 4NGSA 2PCUA 1CX8A 4P4DA 4ETKA 1VHOA 4OKOA 3Q6ZA 3CDXA 4NJRA 2ZEDA 1LAPA 2F7VA 4OMEA 1LANA 3EKEA 4NJQA 1TKHA 2ZEOA 3GLJA 4R8FA 4MCPA 3HUVA 4F9UA 2FAVA 4PXCA 2FVGA 3PFOA 2Q4ZA 4GVWA 3KZWA 4WWVA 4A38A 3PEIA 3D7HA 2ZEMA 1F2PA 3D68A 5FSUA 5HVHA 3H8FA 2BCOA 2ZEEA 3VFQA 1QQ9A 1F2OA 2PVVA 2L8RA 2VRIA 3NH4A 4J4ZA 3B7IA 3D7DA 1YMEA 2VL1A 3RAMA 2ZEPA 4GVVA 4IQYA 4O23A 3FVLA 2J9AA 2PJ5A 3ISXA 3KGQA 3TX8A 4R7MA 3D7GA 4PQAA 1HJZA 3IO1A 4P45A 4DUKA 2XEJA 4A37A 4W9YA 4B6ZA 5K8PA 4P4FA 2AFXA 3B2YA 4OIDA 4NGTA 4X2TA 2XD7A 2BFQA 2POKA 1DTDA 2PJ8A 3NFZA 4MHYA 4RUHA 1VGYA 5LYIA 5E3BA 5LRJA 1ZG9A 1TXZA 3Q71A 1ARLA 5ELYA 2X47A 2EWBA 2C6CA 1ELMP 3GUXA 4OC1A 3CPAA 5LYFA 1AYEA 4MHNA 1PCAA 2I3CA 4UEZA 2IQ6A 1TXRA 3ISZA 4LQGA 1ZG8A 3EW5A 4WJBA 2PJ4A 3D67A 1EE3P 5K8OA 3PBBA 4IAVA 4NGPA 1XRYA 3B3VA 1IY7A 4JGKA 5CB3A 2QYVA 3PB6X 4UMLA 2GU2A 4JCAA 4ETJA 4P4BA 3S9LA 3V38A 1H8LA 2ZOGA 1YD9A 3BHXA 4JLLA 5LYDA 2ZEGA 4MXUA 4OC0A 3QNVA 3V45A 4DJLA 3SI2A 4A39A 3EWQA 1LOKA 2PE3A 2WYRA 3IIBA 3SJXA 1Y0YA 4MHZA 1GYTA 2ZELA 3FJUA 3WC6A 1CP7A 1HEEA 2FG1A 1TY8A 2PJAA 2V77A 2EK9A 3PB8X 2QVPA 2AFMA 8CPAA 2PJ6A 3T8WA 2PJ0A 1BLLE 3WC7A 3GQEA 5D8NA 1ZR3A 2PJBA 3EJGA 3VH9A 4H2KA 3D4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC4 A;  3GPG A;  2FXK A;  3K2K A;  4AXV A;  3SJE A;  2XEG A;  3FEE A;  1KWM A;  2BO9 A;  2NYQ A;  3FX6 A;  4IK2 A;  4BD9 A;  3CPX A;  1XFO A;  2ZEF A;  4P10 A;  1QMU A;  5K8M A;  1LCP A;  4ZY2 A;  4R76 A;  4ABL A;  3NH5 A;  3V7Z A;  1R43 A;  2GLF A;  2QJ8 A;  4P4I A;  3SIJ A;  5J1Q A;  1DE4 C;  4IHM A;  5HVG A;  2V8D A;  2PJ2 A;  4OC3 A;  2DX6 A;  3PFE A;  3NH8 A;  3IWW A;  5F09 A;  4OC5 A;  1IGB A;  1ZG7 A;  3IID A;  1M4L A;  3EWP A;  2O53 A;  4OIW A;  3H8G A;  5LRG A;  2HB6 A;  3PB7 X;  1AMP A;  4MMO A;  4G1P A;  3KQX A;  2PJC A;  3VAT A;  4PPZ A;  3FH4 A;  1PYT B;  3FF3 A;  2BFR A;  1XBU A;  1YSJ A;  4PXE A;  2PJ3 A;  1NSA A;  1YW6 A;  2Q51 A;  3SIG A;  5CMS A;  4JYW A;  3KI9 A;  4ZYQ A;  4MRI A;  3PBE A;  2PIY A;  2NSM A;  3LWU A;  5THW A;  3WT4 A;  2C1C A;  5IB9 A;  4YWY A;  3N5F A;  4UIB A;  3D66 A;  4GM5 A;  2JBJ A;  4TWE A;  3SI0 A;  1FNO A;  1TKF A;  1NJR A;  2JEW A;  4NGR A;  4NGQ A;  2IMO A;  1VHU A;  3V2B A;  4EWT A;  4EFD A;  4JVV A;  3BXM A;  1Q7L A;  4MHP A;  4ZI6 A;  3S9N A;  2AFO A;  3EJF A;  3KHX A;  2WZN A;  5FSV A;  3JZT A;  4OC2 A;  4PXD A;  1Y7E A;  1CBX A;  2ZEH A;  4K0C A;  2PIZ A;  3FMC A;  2CTB A;  1HDQ A;  2AFU A;  4PXB A;  4D86 A;  5JGF A;  2XEF A;  1LFW A;  4YU9 A;  3MN8 A;  3D7F A;  4A94 A;  2C6P A;  1CPS A;  1TF9 A;  1LAM A;  4X8I A;  3CT9 A;  3EWR A;  3ETI A;  3TC8 A;  4KYB A;  2ABZ A;  3HLP A;  3KR4 A;  1BAV A;  2ACF A;  4DYO A;  1VHE A;  4MCS A;  3GPO A;  5LYL A;  3KL9 A;  4F9V A;  3B3W A;  1VIX A;  3RBU A;  3PB4 X;  5K8N A;  2RFH A;  2PJ9 A;  2DEA A;  3IJ3 A;  4UIA A;  3EWO A;  3SIH A;  1OBR A;  3L2N A;  1Z5R A;  4CPA A;  3BI1 A;  3IC1 A;  4TU0 A;  2GLJ A;  3GPQ A;  2XEI A;  2RB7 A;  2V8H A;  2Q43 A;  2IJZ A;  4X3R A;  2AFS A;  4ZX8 A;  5CBM A;  1CG2 A;  4TNU A;  2PJ7 A;  2AFC A;  1YLO A;  3H8E A;  1XJO A;  2AFZ A;  2V8G A;  4ONW A;  4Q7A A;  5LRK A;  1ZR5 A;  2HC9 A;  1Z8L A;  3SJF A;  1XMB A;  4P44 A;  5AIL A;  3SJG A;  3SII A;  5JH9 A;  4EME A;  5CPA A;  4UEE A;  4NFR A;  3LMS A;  3B3T A;  1ARM A;  3BI0 A;  2PRQ A;  5HIH A;  4P6Y A;  5FSX A;  5FSZ A;  2LGR A;  3WC5 A;  2CF4 A;  3B35 A;  4FWU A;  3GQO A;  1FT7 A;  4JZ0 A;  5DUS A;  1ELL P;  4FUU A;  4NGM A;  3VAR A;  4R6T A;  2V8V A;  4UEF A;  3FEC A;  3FED A;  3KAS A;  1CPX A;  4OP4 A;  6CPA A;  4J5R A;  5DS0 A;  1Y0R A;  2O4H A;  3KR5 A;  3SI1 A;  4FAI A;  3RZA A;  2JBK A;  1TF8 A;  4MCQ A;  1JQG A;  4ZY0 A;  3KHZ A;  2ZOF A;  4MCR A;  2ANP A;  3DGV A;  3IEH A;  3K9T A;  2G9D A;  1RTQ A;  3PB9 X;  5CB5 A;  2OOT A;  2EEE A;  4P4E A;  2EK8 A;  1CP6 A;  1ZLI A;  3MRU A;  5I4M A;  1TKJ A;  1BPN A;  3NA6 A;  3GB0 A;  3I1U A;  4FBE A;  2PVW A;  1R3N A;  4NGN A;  3B3C A;  3B3S A;  1F57 A;  4ZX9 A;  1YW4 A;  3JRU A;  3DLJ A;  4KSI A;  2BOA A;  5JM6 A;  5FSY A;  4J5Q A;  4K3N A;  3S9M A;  2ZEN A;  3KQZ A;  3PRT A;  1UWY A;  7CPA A;  4ZY1 A;  4Z65 A;  1ZLH A;  5HXD A;  1BPM A;  4P4J A;  4UF4 A;  1HDU A;  2OR4 A;  3IFE A;  2PJ1 A;  3WAB A;  1SPV A;  2CTC A;  2C6G A;  5HOL A;  2F8H A;  2GRE A;  2AFW A;  4F8Z A;  4ABK A;  3IIF A;  4GUA A;  4ESS A;  4J5S A;  2CIJ A;  5D29 A;  5HVF A;  1Z2L A;  4NGS A;  2PCU A;  1CX8 A;  4P4D A;  4ETK A;  1VHO A;  4OKO A;  3Q6Z A;  3CDX A;  4NJR A;  2ZED A;  1LAP A;  2F7V A;  4OME A;  1LAN A;  3EKE A;  4NJQ A;  1TKH A;  2ZEO A;  3GLJ A;  4R8F A;  4MCP A;  3HUV A;  4F9U A;  2FAV A;  4PXC A;  2FVG A;  3PFO A;  2Q4Z A;  4GVW A;  3KZW A;  4WWV A;  4A38 A;  3PEI A;  3D7H A;  2ZEM A;  1F2P A;  3D68 A;  5FSU A;  5HVH A;  3H8F A;  2BCO A;  2ZEE A;  3VFQ A;  1QQ9 A;  1F2O A;  2PVV A;  2L8R A;  2VRI A;  3NH4 A;  4J4Z A;  3B7I A;  3D7D A;  1YME A;  2VL1 A;  3RAM A;  2ZEP A;  4GVV A;  4IQY A;  4O23 A;  3FVL A;  2J9A A;  2PJ5 A;  3ISX A;  3KGQ A;  3TX8 A;  4R7M A;  3D7G A;  4PQA A;  1HJZ A;  3IO1 A;  4P45 A;  4DUK A;  2XEJ A;  4A37 A;  4W9Y A;  4B6Z A;  5K8P A;  4P4F A;  2AFX A;  3B2Y A;  4OID A;  4NGT A;  4X2T A;  2XD7 A;  2BFQ A;  2POK A;  1DTD A;  2PJ8 A;  3NFZ A;  4MHY A;  4RUH A;  1VGY A;  5LYI A;  5E3B A;  5LRJ A;  1ZG9 A;  1TXZ A;  3Q71 A;  1ARL A;  5ELY A;  2X47 A;  2EWB A;  2C6C A;  1ELM P;  3GUX A;  4OC1 A;  3CPA A;  5LYF A;  1AYE A;  4MHN A;  1PCA A;  2I3C A;  4UEZ A;  2IQ6 A;  1TXR A;  3ISZ A;  4LQG A;  1ZG8 A;  3EW5 A;  4WJB A;  2PJ4 A;  3D67 A;  1EE3 P;  5K8O A;  3PBB A;  4IAV A;  4NGP A;  1XRY A;  3B3V A;  1IY7 A;  4JGK A;  5CB3 A;  2QYV A;  3PB6 X;  4UML A;  2GU2 A;  4JCA A;  4ETJ A;  4P4B A;  3S9L A;  3V38 A;  1H8L A;  2ZOG A;  1YD9 A;  3BHX A;  4JLL A;  5LYD A;  2ZEG A;  4MXU A;  4OC0 A;  3QNV A;  3V45 A;  4DJL A;  3SI2 A;  4A39 A;  3EWQ A;  1LOK A;  2PE3 A;  2WYR A;  3IIB A;  3SJX A;  1Y0Y A;  4MHZ A;  1GYT A;  2ZEL A;  3FJU A;  3WC6 A;  1CP7 A;  1HEE A;  2FG1 A;  1TY8 A;  2PJA A;  2V77 A;  2EK9 A;  3PB8 X;  2QVP A;  2AFM A;  8CPA A;  2PJ6 A;  3T8W A;  2PJ0 A;  1BLL E;  3WC7 A;  3GQE A;  5D8N A;  1ZR3 A;  2PJB A;  3EJG A;  3VH9 A;  4H2K A;  3D4U A; 
#chains in the Genus database with same CATH topology
 2QIR A;  5KTD A;  1S5K A;  2VZY A;  2P6F A;  4OC4 A;  3GPG A;  2FXK A;  3K2K A;  3MGD A;  4KOV A;  3CXQ A;  1VHS A;  2JZE A;  4NXY A;  4AXV A;  4DNC A;  3SJE A;  2XEG A;  2Z10 A;  1KWM A;  3FEE A;  3WR7 A;  4B12 A;  2OZG A;  3W6S A;  5HH1 A;  1MJA A;  4OAD A;  3FRM A;  2BO9 A;  3W91 A;  2NYQ A;  3FX6 A;  4IK2 A;  4M85 A;  4JD6 A;  3CPX A;  4BD9 A;  1XFO A;  4CGO A;  2PDO A;  2ZEF A;  4P10 A;  1QMU A;  5K8M A;  2Z3N A;  4K30 A;  1LCP A;  4ZY2 A;  1M44 A;  3G3S A;  4KUB A;  4R76 A;  4ABL A;  3NH5 A;  3V7Z A;  1R43 A;  2WCT A;  2GLF A;  2QJ8 A;  1B6B A;  4P4I A;  4CYQ A;  1QSN A;  2KCW A;  3SIJ A;  5I0C A;  5J1Q A;  2R98 A;  1DE4 C;  4IHM A;  4PK2 A;  5H86 A;  2V8D A;  3TO7 A;  4ZGY B;  5HVG A;  2PJ2 A;  1A2Z A;  1XE4 A;  4OC3 A;  2DX6 A;  3PFE A;  2EBJ A;  3TT2 A;  3EY5 A;  3NH8 A;  3IWW A;  5F09 A;  3T9Y A;  3F8K A;  2CNM A;  1MJ9 A;  4OC5 A;  1Z8X A;  1IGB A;  1ZG7 A;  4YRH A;  3IID A;  1M4L A;  3R9E A;  2R8V A;  3EWP A;  1S7K A;  1QSM A;  4FD6 A;  4AG7 A;  2O53 A;  3FBU A;  3EXN A;  3JVN A;  4OIW A;  3H8G A;  3GY9 A;  4A30 A;  1UFH A;  2PSW A;  5LRG A;  2HB6 A;  4B10 A;  2Z3L A;  2PR1 A;  3PB7 X;  1AMP A;  4LUA A;  4MMO A;  4M6I A;  1M4I A;  5G1Z A;  3S6G A;  4G1P A;  4QC6 A;  4AVB A;  3KQX A;  2PJC A;  3VAT A;  2GAN A;  4PPZ A;  4A31 A;  4I49 A;  4IUS A;  3FH4 A;  1PYT B;  4BMH A;  4JJX A;  3FF3 A;  2BFR A;  1XBU A;  1YSJ A;  5IX3 A;  4PXE A;  2PJ3 A;  1NSA A;  1YW6 A;  2Q04 A;  2BSW A;  1Q2Y A;  2Q51 A;  4OLL A;  3SIG A;  5CMS A;  4JYW A;  3DR8 A;  4RN7 A;  3KI9 A;  4ZYQ A;  3VWD A;  3FNC A;  1Y9W A;  3DSB A;  3PBE A;  4MRI A;  4MBU A;  2PIY A;  2ZW7 A;  4YFJ A;  2NSM A;  2BL1 A;  3LWU A;  4NSQ A;  5THW A;  4IF5 A;  3WT4 A;  4XNH C;  2C1C A;  5IB9 A;  4YGO A;  4YWY A;  3N5F A;  4UIB A;  3PP9 A;  3D66 A;  3S6F A;  1MK4 A;  4GM5 A;  2JBJ A;  3F5B A;  4TWE A;  3SI0 A;  4B14 A;  1FNO A;  1TKF A;  2D4O A;  4FD4 A;  4CAE A;  4CGL A;  4CAV A;  3TO9 A;  1B87 A;  1NJR A;  2JEW A;  3I9S A;  2R7H A;  4MJ8 A;  4NGR A;  3KKW A;  4NGQ A;  4UFV A;  3TOB A;  2IMO A;  4KLW A;  1S7F A;  1VHU A;  2FS5 A;  3V2B A;  1Z4R A;  4KVX A;  4EFD A;  4JVV A;  3E0K A;  4EWT A;  3BXM A;  5HVH A;  1Q7L A;  1RO5 A;  4JXR A;  3P2H A;  4MHP A;  4ZI6 A;  3S9N A;  2AFO A;  1S7N A;  3EJF A;  2GE3 A;  2PR8 A;  3KHX A;  2WZN A;  4JWP A;  2QEC A;  1YX0 A;  4AVA A;  5FSV A;  3JZT A;  4OC2 A;  2VI7 A;  2PC1 A;  2EO8 A;  3S6H A;  2Q4Y A;  4B5P A;  2QML A;  4PXD A;  4KUA A;  2C27 A;  1Y7E A;  1CBX A;  3ZZI A;  1S60 A;  2ZEH A;  4K0C A;  2PIZ A;  3FMC A;  3R1K A;  1YK3 A;  2CTB A;  4NF1 A;  1HDQ A;  3JUW A;  2AFU A;  3IWG A;  4PXB A;  4D86 A;  2RC4 A;  3A9L A;  2FL4 A;  3P2F A;  3EFA A;  5JGF A;  2XEF A;  2G3A A;  3N7Z A;  4KOX A;  4BBH A;  3D2P A;  1LFW A;  3LOD A;  4YU9 A;  3MN8 A;  2DXQ A;  4J3G A;  3D7F A;  5AG4 A;  4A94 A;  2C6P A;  1CPS A;  3TOA A;  1TF9 A;  1LAM A;  4XPD B;  4F6A A;  4X8I A;  3IGR A;  4H89 A;  3SXO A;  3TE4 A;  2Q0Y A;  4CAF A;  3CT9 A;  3EWR A;  3ETI A;  3TC8 A;  4KYB A;  1YVK A;  2B4B A;  2FIA A;  3QB8 A;  3SXN A;  2ABZ A;  3BJ7 A;  3HLP A;  5F46 A;  1IB1 E;  3KR4 A;  1BAV A;  5AGE A;  3D8P A;  2OZU A;  1WK4 A;  2ACF A;  3I3G A;  4DYO A;  3V8I A;  1VHE A;  4MCS A;  3GPO A;  5LYL A;  2CNS A;  2I00 A;  3KL9 A;  4F9V A;  4LX9 A;  3B3W A;  1VIX A;  1KZF A;  3PB4 X;  3RBU A;  5K8N A;  2RFH A;  2PJ9 A;  2DEA A;  3IJ3 A;  5FVJ A;  3QAH A;  4JLY A;  4UIA A;  2HQY A;  2YNC C;  3EWO A;  1Q2D A;  3SIH A;  2OZH A;  1OBR A;  4NCZ A;  3L2N A;  3SHP A;  1Z5R A;  2B4D B;  4CPA A;  1OZP A;  1TIQ A;  4FD7 A;  3BI1 A;  4UFW A;  4E8O A;  3IC1 A;  4HNY B;  4TU0 A;  4F0X A;  2GLJ A;  4KVM E;  4B5P B;  3GPQ A;  3CXS A;  2G3T A;  1AUG A;  1IYK A;  2RB7 A;  2XEI A;  2V8H A;  4A32 A;  4QBJ A;  2DPS A;  2Q43 A;  5C82 A;  2P6E A;  4CYP A;  4Y49 C;  2IJZ A;  1NE9 A;  3NE8 A;  4X3R A;  3IWE A;  1XF8 A;  4ZX8 A;  5CBM A;  1CG2 A;  2AFS A;  4JXQ A;  4CRY B;  1CM0 A;  4TNU A;  2PJ7 A;  4KVO E;  2AFC A;  1YLO A;  3H8E A;  2ODF A;  2Q7S A;  5F48 A;  2CXA A;  4LQ6 A;  4ZBG A;  1YLE A;  5H84 A;  3TO6 A;  1XJO A;  2AFZ A;  2V8G A;  4ONW A;  4Q7A A;  5LRK A;  1ZR5 A;  2HC9 A;  4ONU A;  1Z8L A;  3UY5 A;  1NMT A;  4UWI A;  3SJF A;  4QVT A;  1XMB A;  4P44 A;  5AIL A;  4AB7 A;  2OU2 A;  3SJG A;  3SII A;  4AVC A;  5ISV A;  5JH9 A;  1YRE A;  1BO4 A;  4EME A;  5CPA A;  3IU2 A;  4UEE A;  4NFR A;  3LMS A;  2Z3K A;  3B3T A;  1ARM A;  2H5M A;  1ON0 A;  3BI0 A;  4NGP A;  2PRQ A;  4RS2 A;  5HIH A;  4P6Y A;  5FSX A;  5FSZ A;  2LGR A;  1KUY A;  2CF4 A;  3B35 A;  3PGP A;  4FWU A;  3GQO A;  3R95 A;  1FT7 A;  4UCN A;  2BEI A;  1PU9 A;  4JZ0 A;  4UCM A;  4R57 A;  1QSR A;  5DUS A;  1ELL P;  4FUU A;  2Z3O A;  4NGM A;  3VAR A;  2VXK A;  4R6T A;  2VEZ A;  1S3Z A;  3BLN A;  2V8V A;  3LD2 A;  3FEC A;  1J4J A;  4UEF A;  3FED A;  4FD5 A;  3KAS A;  1CPX A;  4OP4 A;  5F47 A;  2B5G B;  4KSA A;  3EC4 A;  6CPA A;  4J5R A;  5DS0 A;  1Y0R A;  1Z8W A;  1CJW A;  4AG9 A;  4UA3 A;  2O4H A;  3KR5 A;  3CXP A;  4U9Z A;  4X5K A;  3RZA A;  3SI1 A;  2JBK A;  4CS0 B;  4FAI A;  4UBR A;  1TF8 A;  4B11 A;  2I79 A;  2Z11 A;  4MCQ A;  2JDD A;  1JQG A;  4ZY0 A;  4PSW A;  3KHZ A;  2ZOF A;  4MFL A;  4MCR A;  2ANP A;  2WPW A;  1PUA A;  3R9G A;  4C68 A;  3DGV A;  4CRZ B;  3IEH A;  3K9T A;  1XOV A;  2G9D A;  1IIC A;  2FT0 A;  2R1I A;  4KOY A;  5KTC A;  1RTQ A;  4CAW A;  3PB9 X;  5CB5 A;  4H6Z A;  2OOT A;  3S6K A;  2EEE A;  4P4E A;  5JQ4 A;  5JPH A;  2EK8 A;  3RNZ A;  3JTK A;  1CP6 A;  5GCN A;  4CGM A;  4MFK A;  2P0W A;  1ZLI A;  2YND A;  1KUX A;  3MRU A;  1VKC A;  5I4M A;  2P6G A;  4PK3 A;  3FXT A;  5G21 A;  1TKJ A;  1BPN A;  1WWZ A;  4PV6 A;  2WPX A;  3NA6 A;  4KLV A;  1Z9U A;  2Y0M A;  1M1D A;  4A2Z A;  2HUZ A;  1N71 A;  3GB0 A;  3I1U A;  4FBE A;  4ORF A;  5J8F A;  2PVW A;  4XPL A;  1R3N A;  2B3V A;  4NGN A;  3B3C A;  3B3S A;  5A27 A;  1F57 A;  4MI4 A;  4ZX9 A;  4OAE A;  1YW4 A;  3JRU A;  3DLJ A;  4M3S A;  4R3L A;  2Q44 A;  4UCP A;  2JZD A;  4KOR A;  4KSI A;  4RI1 A;  2BOA A;  5JM6 A;  5FSY A;  4J5Q A;  4UFX A;  4K3N A;  3S9M A;  2ZEN A;  2AE6 A;  4A33 A;  3KQZ A;  5C88 A;  4UWJ A;  3PRT A;  5EC4 A;  1UWY A;  5G22 A;  7CPA A;  4MY0 A;  2YGW A;  4ZY1 A;  2OB0 A;  2REF A;  4MHD A;  4Z65 A;  1ZLH A;  4F0Y A;  2VBQ A;  1U6M A;  1BPM A;  5HXD A;  4QUS A;  4P4J A;  4UF4 A;  1HDU A;  2OR4 A;  3IFE A;  3VWE A;  2GIV A;  2PJ1 A;  4U9Y A;  4Y49 B;  3R9F A;  3WAB A;  5J8C A;  1SPV A;  1P4N A;  2IL4 A;  3F0A A;  2CTC A;  3T90 A;  4MY3 A;  2C6G A;  2J8N A;  2VQY A;  5HOL A;  2O28 A;  1R57 A;  2F8H A;  2GRE A;  5EMI A;  2BUE A;  5AG5 A;  2AFW A;  3K9U A;  2Q4V A;  4F8Z A;  4ABK A;  3IIF A;  4GUA A;  3CZX A;  4XPK A;  4ESS A;  4J5S A;  2CIJ A;  5D29 A;  2OH1 A;  5HVF A;  1Z2L A;  4NGS A;  1L0C A;  2JEV A;  2PCU A;  2ZW4 A;  3GYA A;  4HNX B;  3TCV A;  1CX8 A;  5DWN A;  1YVO A;  1XEB A;  2A4N A;  1MJB A;  2FCK A;  2FE7 A;  4L89 A;  4P4D A;  4C2Y A;  2DF5 A;  1GHE A;  4ETK A;  1SQH A;  1VHO A;  4OKO A;  5F49 A;  1XIX A;  3Q6Z A;  1LRZ A;  4PSX A;  2K5T A;  5KTA A;  1YR0 A;  3CDX A;  4NJR A;  2ZED A;  1LAP A;  1X12 A;  5IV0 A;  2F7V A;  2JDC A;  1K4J A;  4OME A;  1LAN A;  3EKE A;  4NJQ A;  2KQV A;  4E2A A;  1TKH A;  2ZEO A;  3FIX A;  3GLJ A;  4KSF A;  4R8F A;  4MCP A;  2J8R A;  3HUV A;  4MFZ A;  4F9U A;  2FAV A;  3FB3 A;  4PXC A;  2FVG A;  2W2G A;  3PFO A;  5G20 A;  2Q4Z A;  5IB0 A;  4XPD C;  1QST A;  2D4P A;  4GVW A;  3KZW A;  4GXH A;  4WWV A;  2WUU A;  4A38 A;  1NSL A;  3PEI A;  3D7H A;  2ZEM A;  2RNK A;  1F2P A;  5FSU A;  2AJ6 A;  3D68 A;  4XNH B;  2WSA A;  1I1D A;  3H8F A;  3WC5 A;  2Z3M A;  3TTH A;  2BCO A;  2FXF A;  2ZEE A;  4M6G A;  4CGP A;  5BWA B;  3VFQ A;  2FIW A;  1QQ9 A;  3DR6 A;  4H6U A;  1F2O A;  2HV2 A;  2G0B A;  2PVV A;  2B4D A;  2L8R A;  1FY7 A;  1M4G A;  2VRI A;  3EO4 A;  3R96 A;  3NH4 A;  4U5Y A;  3C26 A;  4J4Z A;  2ARH A;  2EUI A;  4II9 A;  2PQ8 A;  3TFY A;  3B7I A;  3D7D A;  2ZPA A;  1YME A;  2VL1 A;  3RAM A;  2ZEP A;  4KZT A;  1P0H A;  2X7B A;  4GVV A;  3PZJ A;  4HKF A;  5CNP A;  4IQY A;  4O23 A;  3FVL A;  2J9A A;  1Z8T A;  2PJ5 A;  3ISX A;  3KGQ A;  3TX8 A;  4R7M A;  2REE A;  3D7G A;  4KS9 A;  2JZF A;  4PQA A;  1HJZ A;  2YNE A;  3IO1 A;  2B3U A;  4P45 A;  4DUK A;  2XEJ A;  1I12 A;  1Y9K A;  4A37 A;  4W9Y A;  4B6Z A;  4L8A A;  4MFP A;  4P4F A;  5AG6 A;  5K8P A;  2Z3P A;  2AFX A;  3B2Y A;  4CAX A;  2ZXV A;  4OID A;  5A28 A;  4KOS A;  4NGT A;  4X2T A;  2XD7 A;  4QB9 A;  3D3S A;  2BFQ A;  2POK A;  1IU8 A;  3GIU A;  1DTD A;  4Q38 A;  2PJ8 A;  4KOU A;  3DDD A;  3NFZ A;  4MHY A;  5DWM A;  4RUH A;  4Q36 A;  3OWC A;  1VGY A;  5LYI A;  5E3B A;  5HMN A;  5LRJ A;  1ZG9 A;  1TXZ A;  3Q71 A;  4C2X A;  1ARL A;  1X10 A;  1I21 A;  5ELY A;  3RYO A;  1V0C A;  2X47 A;  3B8G A;  3RO0 A;  2EWB A;  2GFQ A;  2C6C A;  1ELM P;  1KUV A;  4NEX A;  2ATR A;  4CYN A;  3GUX A;  4OC1 A;  4CYO A;  1YGH A;  3CPA A;  5LYF A;  1AYE A;  4E0A A;  4KOW A;  4MHN A;  1PCA A;  2I3C A;  1IOI A;  4C7H A;  2EVN A;  5E96 A;  4R3K A;  4UEZ A;  1QSO A;  2IQ6 A;  1TXR A;  4MFJ A;  3ISZ A;  5AG7 A;  4LQG A;  1ZG8 A;  2ZW6 A;  3EW5 A;  4WJB A;  2PJ4 A;  3D67 A;  2Q7B A;  4EVY A;  1EE3 P;  2B5G A;  3BJ8 A;  5K8O A;  1ZO0 A;  3LAC A;  3PBB A;  1XRY A;  4HNW B;  3B3V A;  1IY7 A;  1JWQ A;  4IAV A;  4JGK A;  3QAY A;  4HPS A;  5CB3 A;  2QYV A;  3PB6 X;  4UML A;  1S7L A;  3GKR A;  2GU2 A;  3G8W A;  4MFQ A;  4R9M A;  4JCA A;  4ETJ A;  4P4B A;  3S9L A;  3V38 A;  1H8L A;  4C2Z A;  2ZOG A;  1YD9 A;  3BHX A;  2CNT A;  4JLL A;  3DNS A;  2NMT A;  5LYD A;  2ZEG A;  1M4D A;  1BOB A;  2Z0Z A;  1YQE A;  2VZZ A;  4MXU A;  2FSR A;  1XMT A;  4OC0 A;  2CY2 A;  3QNV A;  1IOF A;  3V45 A;  4DJL A;  3SI2 A;  4R87 A;  4A39 A;  3EWQ A;  2DPT A;  2JLM A;  3D2M A;  4GS4 A;  3ZJ0 A;  1LOK A;  2PE3 A;  2WYR A;  4CGN A;  3IIB A;  1Z4E A;  3W6X A;  3H5Z A;  3SJX A;  1Y0Y A;  4MHZ A;  1GYT A;  2B58 A;  2ZEL A;  3FJU A;  3WC6 A;  1CP7 A;  1HEE A;  2FG1 A;  1TY8 A;  2PRB A;  4A95 A;  4KOT A;  2PJA A;  2V77 A;  1IYL A;  2EK9 A;  3NE7 A;  3PB8 X;  2F5I A;  2QVP A;  2AFM A;  8CPA A;  2PJ6 A;  3T8W A;  2PJ0 A;  4B5O A;  1BLL E;  2J8M A;  3WC7 A;  3GQE A;  5D8N A;  1ZR3 A;  4BIN A;  1Q2C A;  2PJB A;  1Y7R A;  1RXT A;  3EJG A;  5EBV A;  3VH9 A;  4M6H A;  1IID A;  3IU1 A;  3H4Q A;  4H2K A;  4C7I A;  2YNC A;  4B13 A;  3FYN A;  2ZW5 A;  3D4U A; 
#chains in the Genus database with same CATH homology
 4OC4 A;  3GPG A;  2FXK A;  3K2K A;  4AXV A;  3SJE A;  2XEG A;  3FEE A;  1KWM A;  2BO9 A;  2NYQ A;  3FX6 A;  4IK2 A;  4BD9 A;  3CPX A;  1XFO A;  2ZEF A;  4P10 A;  1QMU A;  5K8M A;  1LCP A;  4ZY2 A;  4R76 A;  4ABL A;  3NH5 A;  3V7Z A;  1R43 A;  2GLF A;  2QJ8 A;  4P4I A;  3SIJ A;  5J1Q A;  1DE4 C;  4IHM A;  5HVG A;  2V8D A;  2PJ2 A;  4OC3 A;  2DX6 A;  3PFE A;  3NH8 A;  3IWW A;  5F09 A;  4OC5 A;  1IGB A;  1ZG7 A;  3IID A;  1M4L A;  3EWP A;  2O53 A;  4OIW A;  3H8G A;  5LRG A;  2HB6 A;  3PB7 X;  1AMP A;  4MMO A;  4G1P A;  3KQX A;  2PJC A;  3VAT A;  4PPZ A;  3FH4 A;  1PYT B;  3FF3 A;  2BFR A;  1XBU A;  1YSJ A;  4PXE A;  2PJ3 A;  1NSA A;  1YW6 A;  2Q51 A;  3SIG A;  5CMS A;  4JYW A;  3KI9 A;  4ZYQ A;  4MRI A;  3PBE A;  2PIY A;  2NSM A;  3LWU A;  5THW A;  3WT4 A;  2C1C A;  5IB9 A;  4YWY A;  3N5F A;  4UIB A;  3D66 A;  4GM5 A;  2JBJ A;  4TWE A;  3SI0 A;  1FNO A;  1TKF A;  1NJR A;  2JEW A;  4NGR A;  4NGQ A;  2IMO A;  1VHU A;  3V2B A;  4EWT A;  4EFD A;  4JVV A;  3BXM A;  1Q7L A;  4MHP A;  4ZI6 A;  3S9N A;  2AFO A;  3EJF A;  3KHX A;  2WZN A;  5FSV A;  3JZT A;  4OC2 A;  4PXD A;  1Y7E A;  1CBX A;  2ZEH A;  4K0C A;  2PIZ A;  3FMC A;  2CTB A;  1HDQ A;  2AFU A;  4PXB A;  4D86 A;  5JGF A;  2XEF A;  1LFW A;  4YU9 A;  3MN8 A;  3D7F A;  4A94 A;  2C6P A;  1CPS A;  1TF9 A;  1LAM A;  4X8I A;  3CT9 A;  3EWR A;  3ETI A;  3TC8 A;  4KYB A;  2ABZ A;  3HLP A;  3KR4 A;  1BAV A;  2ACF A;  4DYO A;  1VHE A;  4MCS A;  3GPO A;  5LYL A;  3KL9 A;  4F9V A;  3B3W A;  1VIX A;  3RBU A;  3PB4 X;  5K8N A;  2RFH A;  2PJ9 A;  2DEA A;  3IJ3 A;  4UIA A;  3EWO A;  3SIH A;  1OBR A;  3L2N A;  1Z5R A;  4CPA A;  3BI1 A;  3IC1 A;  4TU0 A;  2GLJ A;  3GPQ A;  2XEI A;  2RB7 A;  2V8H A;  2Q43 A;  2IJZ A;  4X3R A;  2AFS A;  4ZX8 A;  5CBM A;  1CG2 A;  4TNU A;  2PJ7 A;  2AFC A;  1YLO A;  3H8E A;  1XJO A;  2AFZ A;  2V8G A;  4ONW A;  4Q7A A;  5LRK A;  1ZR5 A;  2HC9 A;  1Z8L A;  3SJF A;  1XMB A;  4P44 A;  5AIL A;  3SJG A;  3SII A;  5JH9 A;  4EME A;  5CPA A;  4UEE A;  4NFR A;  3LMS A;  3B3T A;  1ARM A;  3BI0 A;  2PRQ A;  5HIH A;  4P6Y A;  5FSX A;  5FSZ A;  2LGR A;  3WC5 A;  2CF4 A;  3B35 A;  4FWU A;  3GQO A;  1FT7 A;  4JZ0 A;  5DUS A;  1ELL P;  4FUU A;  4NGM A;  3VAR A;  4R6T A;  2V8V A;  4UEF A;  3FEC A;  3FED A;  3KAS A;  1CPX A;  4OP4 A;  6CPA A;  4J5R A;  5DS0 A;  1Y0R A;  2O4H A;  3KR5 A;  3SI1 A;  4FAI A;  3RZA A;  2JBK A;  1TF8 A;  4MCQ A;  1JQG A;  4ZY0 A;  3KHZ A;  2ZOF A;  4MCR A;  2ANP A;  3DGV A;  3IEH A;  3K9T A;  2G9D A;  1RTQ A;  3PB9 X;  5CB5 A;  2OOT A;  2EEE A;  4P4E A;  2EK8 A;  1CP6 A;  1ZLI A;  3MRU A;  5I4M A;  1TKJ A;  1BPN A;  3NA6 A;  3GB0 A;  3I1U A;  4FBE A;  2PVW A;  1R3N A;  4NGN A;  3B3C A;  3B3S A;  1F57 A;  4ZX9 A;  1YW4 A;  3JRU A;  3DLJ A;  4KSI A;  2BOA A;  5JM6 A;  5FSY A;  4J5Q A;  4K3N A;  3S9M A;  2ZEN A;  3KQZ A;  3PRT A;  1UWY A;  7CPA A;  4ZY1 A;  4Z65 A;  1ZLH A;  5HXD A;  1BPM A;  4P4J A;  4UF4 A;  1HDU A;  2OR4 A;  3IFE A;  2PJ1 A;  3WAB A;  1SPV A;  2CTC A;  2C6G A;  5HOL A;  2F8H A;  2GRE A;  2AFW A;  4F8Z A;  4ABK A;  3IIF A;  4GUA A;  4ESS A;  4J5S A;  2CIJ A;  5D29 A;  5HVF A;  1Z2L A;  4NGS A;  2PCU A;  1CX8 A;  4P4D A;  4ETK A;  1VHO A;  4OKO A;  3Q6Z A;  3CDX A;  4NJR A;  2ZED A;  1LAP A;  2F7V A;  4OME A;  1LAN A;  3EKE A;  4NJQ A;  1TKH A;  2ZEO A;  3GLJ A;  4R8F A;  4MCP A;  3HUV A;  4F9U A;  2FAV A;  4PXC A;  2FVG A;  3PFO A;  2Q4Z A;  4GVW A;  3KZW A;  4WWV A;  4A38 A;  3PEI A;  3D7H A;  2ZEM A;  1F2P A;  3D68 A;  5FSU A;  5HVH A;  3H8F A;  2BCO A;  2ZEE A;  3VFQ A;  1QQ9 A;  1F2O A;  2PVV A;  2L8R A;  2VRI A;  3NH4 A;  4J4Z A;  3B7I A;  3D7D A;  1YME A;  2VL1 A;  3RAM A;  2ZEP A;  4GVV A;  4IQY A;  4O23 A;  3FVL A;  2J9A A;  2PJ5 A;  3ISX A;  3KGQ A;  3TX8 A;  4R7M A;  3D7G A;  4PQA A;  1HJZ A;  3IO1 A;  4P45 A;  4DUK A;  2XEJ A;  4A37 A;  4W9Y A;  4B6Z A;  5K8P A;  4P4F A;  2AFX A;  3B2Y A;  4OID A;  4NGT A;  4X2T A;  2XD7 A;  2BFQ A;  2POK A;  1DTD A;  2PJ8 A;  3NFZ A;  4MHY A;  4RUH A;  1VGY A;  5LYI A;  5E3B A;  5LRJ A;  1ZG9 A;  1TXZ A;  3Q71 A;  1ARL A;  5ELY A;  2X47 A;  2EWB A;  2C6C A;  1ELM P;  3GUX A;  4OC1 A;  3CPA A;  5LYF A;  1AYE A;  4MHN A;  1PCA A;  2I3C A;  4UEZ A;  2IQ6 A;  1TXR A;  3ISZ A;  4LQG A;  1ZG8 A;  3EW5 A;  4WJB A;  2PJ4 A;  3D67 A;  1EE3 P;  5K8O A;  3PBB A;  4IAV A;  4NGP A;  1XRY A;  3B3V A;  1IY7 A;  4JGK A;  5CB3 A;  2QYV A;  3PB6 X;  4UML A;  2GU2 A;  4JCA A;  4ETJ A;  4P4B A;  3S9L A;  3V38 A;  1H8L A;  2ZOG A;  1YD9 A;  3BHX A;  4JLL A;  5LYD A;  2ZEG A;  4MXU A;  4OC0 A;  3QNV A;  3V45 A;  4DJL A;  3SI2 A;  4A39 A;  3EWQ A;  1LOK A;  2PE3 A;  2WYR A;  3IIB A;  3SJX A;  1Y0Y A;  4MHZ A;  1GYT A;  2ZEL A;  3FJU A;  3WC6 A;  1CP7 A;  1HEE A;  2FG1 A;  1TY8 A;  2PJA A;  2V77 A;  2EK9 A;  3PB8 X;  2QVP A;  2AFM A;  8CPA A;  2PJ6 A;  3T8W A;  2PJ0 A;  1BLL E;  3WC7 A;  3GQE A;  5D8N A;  1ZR3 A;  2PJB A;  3EJG A;  3VH9 A;  4H2K A;  3D4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...