1BPMA

Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
484
structure length
481
Chain Sequence
TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
molecule keywords LEUCINE AMINOPEPTIDASE
total genus 155
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1993-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1bpmA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1bpmA02
1CG2A 4OC1A 4D86A 2PJ5A 2PJ9A 1HDUA 4UIBA 1YW6A 3EJGA 3D7HA 1ZR3A 4ABLA 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 5CPAA 1CPXA 4KYBA 2JBJA 3KHXA 2FVGA 2PVVA 2EWBA 2PCUA 4NFRA 3SIHA 3B2YA 2LGRA 3IFEA 3ISXA 5THWA 4JVVA 3SJEA 2F8HA 5LRKA 4IAVA 2GREA 3HLPA 3EW5A 4R8FA 2CF4A 3NFZA 4FUUA 2PVWA 1QMUA 1TY8A 2BO9A 2XEFA 4P4FA 4PXEA 4K3NA 1Z5RA 4FBEA 5FSVA 3VFQA 3FVLA 3FF3A 3I1UA 2ZEFA 2QVPA 4JCAA 2NSMA 3TC8A 2IJZA 1H8LA 1CX8A 1ZG8A 4JZ0A 3IIDA 4IQYA 1Z2LA 1TF8A 3NH8A 4P4BA 3GQEA 3CPXA 1EE3P 5J1QA 4OIWA 4MHZA 4NJQA 4O23A 4PQAA 1XJOA 4DUKA 2VRIA 1IY7A 3T8WA 3SIJA 2V8DA 2J9AA 3FX6A 3KASA 1Z8LA 2AFUA 2PJBA 5FSZA 2WZNA 4OIDA 3PBBA 1CPSA 3KL9A 2ZELA 3MN8A 3IWWA 4J5SA 3NH5A 4WJBA 4EFDA 3KZWA 4OP4A 1CP7A 4PXBA 3FJUA 2PJ7A 5K8MA 5FSXA 4H2KA 3VATA 3S9NA 2JEWA 2EEEA 2IQ6A 4NGMA 2OOTA 2PJ8A 2ZEPA 2HC9A 3B3WA 3PB8X 3IJ3A 5K8OA 2ZEDA 1Y7EA 1XBUA 2ABZA 3D68A 4PXCA 2POKA 2BFQA 1BAVA 1NSAA 1LANA 4ONWA 4P6YA 5I4MA 3Q6ZA 5FSUA 1TXZA 2ZEOA 3D7FA 3ISZA 4YWYA 2PJ6A 4OC2A 3TX8A 3CPAA 1LCPA 2XD7A 3EWRA 4DYOA 1PCAA 4R6TA 2C6GA 3ETIA 3GUXA 5LYIA 1R43A 2FG1A 3GPOA 1R3NA 1TF9A 1TKFA 1HJZA 3SI2A 4BD9A 4MCRA 3IO1A 5FSYA 2PJAA 3PB6X 4ETKA 1ZLHA 1IGBA 8CPAA 2EK9A 3GLJA 3B3CA 5AILA 2V8GA 3WC7A 5D8NA 4P10A 2OR4A 4J5QA 2PJCA 3BI0A 3PB7X 1HEEA 1ZG9A 4G1PA 2V8VA 3IIFA 3GPGA 1PYTB 4TWEA 5LRGA 1LFWA 2AFXA 2EK8A 2XEIA 4R7MA 4F9UA 3KGQA 5HXDA 3V45A 4Z65A 3SI0A 4ZX9A 2ZOFA 3D67A 4J4ZA 3V38A 3JZTA 4NGTA 4X3RA 4P44A 4NGSA 3PFEA 2RB7A 3HUVA 5IB9A 4J5RA 4UEFA 4UIAA 2VL1A 1BLLE 5HVHA 2AFMA 1LAMA 4TU0A 4NGNA 4A39A 4WWVA 1Q7LA 3FEDA 4NGQA 4GM5A 1AMPA 2C1CA 4P4DA 3H8EA 3D7DA 4B6ZA 4JYWA 4P45A 3SJGA 4GUAA 4W9YA 2QYVA 3RBUA 3B3TA 4F9VA 3D7GA 1ZLIA 1YW4A 3WABA 3Q71A 4MMOA 2DEAA 3CT9A 3MRUA 3SIGA 4GVVA 3NA6A 5LYFA 1VGYA 2PRQA 3KI9A 1DTDA 3BXMA 1DE4C 2O4HA 4MXUA 3PRTA 3B7IA 5F09A 1FT7A 3B3SA 1VHEA 2ZEHA 3SIIA 4EWTA 4ZY0A 4ZY1A 3GPQA 3IC1A 4ZY2A 2AFOA 2PJ0A 2XEGA 2PJ3A 1QQ9A 3H8FA 4FAIA 3DLJA 4IHMA 3N5FA 3QNVA 3LWUA 3BI1A 4ETJA 4OC4A 2ZEMA 1XFOA 3PB9X 4GVWA 4RUHA 2Q51A 3S9MA 4R76A 1VHUA 4UMLA 3B3VA 2CTCA 5HOLA 5K8PA 4Q7AA 1TXRA 4JGKA 3WT4A 4MHNA 5K8NA 2ZEGA 3GB0A 1UWYA 3PBEA 4OMEA 5DS0A 4JLLA 1F2OA 2NYQA 2BFRA 3NH4A 2CTBA 2PIYA 2V77A 4A38A 3RZAA 3VARA 2GLFA 5CB5A 2PJ2A 4AXVA 3S9LA 1GYTA 3EWPA 5LYDA 3V7ZA 4MHYA 4NJRA 2IMOA 2CIJA 2QJ8A 2G9DA 1M4LA 3D4UA 4OC0A 3KQZA 1ZR5A 3JRUA 4FWUA 2FXKA 2DX6A 5JGFA 2ZEEA 3GQOA 2C6CA 2WYRA 2O53A 2PE3A 1ELMP 4OKOA 1NJRA 4OC5A 4KSIA 2XEJA 2AFZA 2BCOA 1OBRA 5CB3A 7CPAA 2ANPA 4CPAA 1TKHA 4UEZA 3L2NA 2ZENA 1Y0YA 5DUSA 3FMCA 4P4EA 3PFOA 1ZG7A 1JQGA 4MCPA 3EKEA 1ELLP 3KR5A 2L8RA 3IEHA 4YU9A 1XMBA 5D29A 3CDXA 2BOAA 1BPNA 3SJFA 2Q43A 2Q4ZA 5CMSA 2HB6A 4IK2A 5E3BA 1SPVA 2JBKA 4LQGA 4A37A 4X2TA 1LOKA 2GLJA 3EJFA 3BHXA 4ABKA 2ACFA 5HVGA 4NGPA 2PJ1A 1CP6A 3WC6A 1AYEA 3D66A 4MCQA 5ELYA 1VHOA 3FH4A 5HIHA 3WC5A 4ZX8A 5LRJA 1ARLA 3LMSA 5HVFA 3SI1A 1F57A 3PB4X 4ESSA 4P4IA 3EWOA 4ZYQA 3KHZA 4TNUA 3V2BA 3B35A 2I3CA 5CBMA 3FEEA 3SJXA 1KWMA 3H8GA 4K0CA 4NGRA 2X47A 1RTQA 3EWQA 6CPAA 1YMEA 2GU2A 2V8HA 1FNOA 1HDQA 1YLOA 3PEIA 2PJ4A 1CBXA 2F7VA 1ARMA 2RFHA 3DGVA 1YD9A 1Y0RA 2FAVA 2AFWA 4UEEA 4DJLA 5JH9A 4ZI6A 3VH9A 2C6PA 2ZOGA 4UF4A 1XRYA 4EMEA 1YSJA 1TKJA 4F8ZA 4OC3A 3KR4A 3K9TA 4X8IA 4MRIA 3RAMA 4PXDA 2AFSA 4P4JA 4A94A 4MCSA 3FECA 4PPZA 2AFCA 2PIZA 5JM6A 3K2KA 5LYLA 3IIBA 1VIXA
chains in the Genus database with same CATH superfamily
4QB9A 1CG2A 2G0BA 2AJ6A 2PDOA 2JLMA 4OC1A 4AVBA 4D86A 1RXTA 1S3ZA 2R1IA 2R98A 2PJ5A 2G3TA 2D4PA 2ZW5A 2B3VA 4B10A 2PJ9A 1HDUA 2JDCA 4UIBA 1YW6A 3EJGA 4MFJA 2FSRA 4KLVA 2ZPAA 3D7HA 1ZR3A 3ZJ0A 4ABLA 1XF8A 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 2ATRA 4PV6A 4OAEA 2YNCC 4PSWA 5KTDA 5CPAA 1CPXA 4KYBA 2JBJA 2R7HA 3GYAA 3KHXA 2FVGA 4UA3A 2PVVA 2EWBA 1S7KA 2DPSA 2PCUA 4NFRA 1P0HA 2CXAA 1CM0A 2ARHA 3SIHA 1YQEA 2VI7A 3D3SA 3B2YA 2GFQA 3DR8A 2LGRA 3IFEA 2VXKA 4CGPA 3ISXA 4HKFA 4UFVA 5ISVA 3LACA 4LUAA 5THWA 1YGHA 4JVVA 3F0AA 1Y7RA 2F8HA 2I79A 2B5GB 1RO5A 4HPSA 5G20A 3SJEA 2Z3LA 5LRKA 1IIDA 4IAVA 2GREA 3HLPA 3EW5A 4R8FA 4B5OA 2CF4A 4B14A 4A32A 3NFZA 3QB8A 4FUUA 4RS2A 1PUAA 2PVWA 2JZFA 1QMUA 4R3LA 1TY8A 2BO9A 4CGOA 2XEFA 4P4FA 4PXEA 1SQHA 4K3NA 1Z5RA 4CAEA 4ZGYB 4FBEA 4E0AA 5FSVA 3VFQA 3IIBA 3FVLA 5EBVA 3FF3A 3I1UA 1XOVA 4EVYA 2ZEFA 4YFJA 4CGLA 1Z4EA 4CYQA 1Z8TA 2QVPA 2VZYA 4JCAA 1MJ9A 2NSMA 3TC8A 1H8LA 1ZG8A 1CX8A 2IJZA 3R95A 2HV2A 4JZ0A 4CAVA 3IIDA 2FL4A 3PZJA 4PK3A 4IQYA 1Z2LA 4B5PB 4MFQA 1TF8A 4KOSA 3NH8A 4P4BA 3GQEA 1PU9A 2Q04A 4YRHA 1X12A 3D8PA 2J8NA 4AG7A 3CPXA 1EE3P 5J1QA 4NSQA 4OIWA 4MHZA 4NJQA 2P6GA 4O23A 4UCPA 4PQAA 1XJOA 4AVAA 2K5TA 3EC4A 4CGNA 4DUKA 2VRIA 3P2FA 1IY7A 4RI1A 1Y9WA 3T8WA 3SIJA 3BJ7A 2V8DA 4MY0A 2J9AA 3FX6A 3KASA 3TO6A 1Z8LA 2AFUA 2PJBA 5FSZA 2WZNA 4OIDA 3PBBA 1CPSA 3KL9A 2ZELA 2VEZA 5EMIA 1S7FA 3MN8A 4GS4A 1B87A 3IWWA 4KZTA 4J5SA 3NH5A 3PGPA 4Q36A 4WJBA 4EFDA 3KZWA 3EO4A 1CP7A 4OP4A 4PXBA 4UWIA 2PSWA 3FJUA 2RNKA 2PJ7A 4CAFA 4QVTA 4C68A 3TFYA 5K8MA 2FIAA 5FSXA 4NXYA 5AG6A 5J8CA 4H2KA 3VATA 3S9NA 3OWCA 2JEWA 4R87A 2EEEA 2VZZA 5F47A 4K30A 1I1DA 2IQ6A 2CNTA 4NGMA 4MI4A 2OOTA 3TE4A 2O28A 2PJ8A 2ZEPA 2HC9A 1Q2YA 3B3WA 3PB8X 4HNYB 3IJ3A 4AVCA 1WK4A 5K8OA 1MJAA 1Y7EA 1XBUA 2ABZA 2ZEDA 3D68A 4PXCA 3QAYA 1B6BA 4PK2A 4KOVA 4A30A 1NMTA 1M4GA 2P6FA 2POKA 2BFQA 3EXNA 1BAVA 1NSAA 1LANA 2Z3MA 4ORFA 4ONWA 4P6YA 1U6MA 1A2ZA 2AE6A 2Z11A 3Q6ZA 5FSUA 1TXZA 2ZEOA 3D7FA 3DR6A 3ISZA 4YWYA 5A28A 5AG4A 2PJ6A 4OC2A 4CRYB 1YK3A 4L89A 3TX8A 3CPAA 2PQ8A 3T9YA 1QSNA 1BOBA 2B58A 5AGEA 3R9GA 2FS5A 4C2ZA 2ZXVA 1LCPA 2QECA 3TOBA 4FD7A 2XD7A 3EWRA 2FE7A 4DYOA 1PCAA 4R6TA 2C6GA 4KVXA 3ETIA 3EFAA 3TO9A 3EY5A 3GUXA 5KTAA 4MY3A 3S6KA 3TT2A 4XPDC 2OZHA 5G1ZA 4C7HA 1J4JA 2Q0YA 5LYIA 1R43A 2FG1A 3GPOA 1R3NA 5BWAB 2KCWA 1TF9A 4KVME 1TKFA 3JVNA 1HJZA 1VHSA 2NMTA 4E2AA 1XMTA 5CNPA 4YGOA 3SI2A 2YGWA 2YNCA 4BD9A 4MCRA 2JDDA 3IO1A 3LD2A 5FSYA 2Q7BA 5F46A 2PJAA 1S60A 2QMLA 3PB6X 4ETKA 1ZLHA 2EUIA 2JZEA 1IGBA 5J8FA 8CPAA 2EK9A 3GLJA 1KUYA 3B3CA 5AILA 1ZO0A 2V8GA 4B13A 5I4MA 4MJ8A 3WC7A 5D8NA 1QSRA 4P10A 3SXNA 2OR4A 1OZPA 4J5QA 2PJCA 4M3SA 4MHDA 2I00A 4C2YA 3BI0A 4E8OA 3LODA 1ON0A 1HEEA 2EVNA 3PB7X 5JPHA 1Z8XA 2CNMA 1P4NA 1ZG9A 4G1PA 1L0CA 3C26A 4KOTA 3GIUA 2V8VA 4KSFA 3IIFA 3GPGA 1PYTB 2P0WA 3FRMA 4TWEA 5LRGA 1LFWA 2AFXA 1Y9KA 1BO4A 2EK8A 4R7MA 2XEIA 4MBUA 3D2PA 4F9UA 4KOXA 4M6HA 1CJWA 3KGQA 3KKWA 4KORA 5HXDA 5HMNA 3V45A 3SHPA 1Q2DA 4CRZB 4Z65A 4KSAA 3SI0A 4XPLA 4ZX9A 2ZOFA 1IYLA 3D67A 3CXPA 5DWNA 4J4ZA 2Y0MA 3V38A 3P2HA 3JZTA 3SXOA 4NGTA 2EO8A 2ODFA 4LQ6A 3NE8A 3FNCA 3ZZIA 1N71A 2Q4YA 4X3RA 2HQYA 4P44A 4HNWB 4NGSA 3PFEA 2RB7A 3HUVA 5IB9A 4OLLA 4J5RA 3GY9A 4UEFA 3S6FA 2GANA 3E0KA 2J8RA 4A2ZA 4UIAA 1BLLE 2BEIA 2VL1A 3CXQA 2AFMA 4JJXA 4AG9A 5HVHA 1LAMA 1X10A 2Z10A 4CS0B 4TU0A 4JXQA 4NGNA 4A39A 1YLEA 4WWVA 1Q7LA 2OZUA 4B12A 4CYNA 3FEDA 2FT0A 4NGQA 4GM5A 1AMPA 2C1CA 4UFWA 1KUVA 1IYKA 5I0CA 4P4DA 3H8EA 3D7DA 2WSAA 4B6ZA 4JYWA 4X5KA 2HUZA 2WCTA 2B5GA 4P45A 3SJGA 4GUAA 4W9YA 4F6AA 2QYVA 2OB0A 3RBUA 3B3TA 2Z3OA 2WUUA 4A95A 2FIWA 3K9UA 4F9VA 3D7GA 1S7LA 1ZLIA 1YW4A 3CZXA 4M6IA 3R96A 3RYOA 4UCNA 5HH1A 3Q71A 2DPTA 3WABA 2EBJA 4MMOA 4Y49C 3IU1A 2PR1A 1QSOA 2DEAA 3CT9A 3MRUA 3SIGA 4M85A 4Q38A 4UBRA 4GVVA 1I12A 4U9ZA 1IICA 2BL1A 3NA6A 3R1KA 5LYFA 5F48A 1NE9A 1VGYA 1K4JA 2PRQA 3KI9A 1DTDA 3BXMA 1YVOA 1Z8WA 1DE4C 2O4HA 3G3SA 4MXUA 4KOWA 3UY5A 2QIRA 3PRTA 3JUWA 1Z9UA 3B7IA 4II9A 4JWPA 5F09A 1FT7A 1FY7A 3B3SA 1VHEA 2ZEHA 1V0CA 3SIIA 1XIXA 4EWTA 1IU8A 3DSBA 4PSXA 4ZY0A 4ZY1A 3GPQA 3D2MA 5G22A 3IC1A 4ZY2A 2AFOA 2PJ0A 2XEGA 1M4DA 2PJ3A 1QQ9A 2B3UA 3H8FA 4FAIA 3DLJA 3IGRA 4IHMA 3N5FA 3QNVA 4KS9A 1S7NA 3TO7A 4UFXA 3W6SA 3LWUA 4C2XA 4DNCA 1MJBA 3BI1A 5E96A 4ETJA 2PC1A 4OC4A 2Q4VA 2ZEMA 4FD5A 4KUBA 4F0XA 2OZGA 1XFOA 3PB9X 4GVWA 3BJ8A 4RUHA 2Q51A 3S9MA 4R76A 1VHUA 3G8WA 4RN7A 4UMLA 3B3VA 1Z4RA 2A4NA 4CYOA 3I9SA 2CTCA 3S6GA 4Y49B 2Z0ZA 5HOLA 5K8PA 2IL4A 2JEVA 4Q7AA 4XNHB 1TXRA 4JGKA 4MFPA 5IB0A 4UCMA 1QSMA 1XE4A 4MHNA 4XPDB 3WT4A 4CGMA 4QBJA 2CNSA 5K8NA 4OADA 2ZEGA 2B4DA 3GB0A 2ZW6A 1UWYA 2YNDA 3PBEA 4OMEA 5H86A 4JD6A 4JLLA 1F2OA 2NYQA 3FXTA 2BFRA 3DDDA 5DS0A 3RO0A 2W2GA 3FBUA 4KVOE 2Z3KA 3IU2A 3NH4A 4IUSA 4L8AA 4R9MA 5AG7A 4JXRA 5AG5A 2RC4A 4U9YA 1R57A 2CTBA 2PIYA 2V77A 4KLWA 3RZAA 4A38A 4MFZA 3VARA 2GLFA 5CB5A 2PJ2A 1S5KA 3V8IA 4AXVA 1GYTA 3EWPA 4BINA 3N7ZA 3S9LA 1YREA 1JWQA 5LYDA 3R9FA 3V7ZA 3QAHA 4MHYA 4NJRA 2IMOA 4B5PA 2GIVA 2CIJA 2QJ8A 2DF5A 1KZFA 2G9DA 1M4LA 3DNSA 3D4UA 4UWJA 4OC0A 3KQZA 3S6HA 4U5YA 4QC6A 1ZR5A 3JRUA 4FWUA 4A33A 2FXKA 2DX6A 1M4IA 5A27A 2ZEEA 5JGFA 3GQOA 2C6CA 2WYRA 4F0YA 1TIQA 4H6ZA 2Z3PA 2O53A 2PE3A 1ELMP 4NEXA 4OKOA 1NJRA 4MFLA 4OC5A 2OU2A 4XPKA 4KSIA 2GE3A 2PR8A 3TTHA 4A31A 2BUEA 1UFHA 4R57A 2X7BA 2AFZA 2BCOA 2XEJA 1WWZA 2G3AA 1OBRA 2VBQA 4KOYA 5CB3A 3RNZA 4M6GA 7CPAA 2OH1A 5G21A 3H4QA 3W6XA 2ANPA 4CPAA 1TKHA 4UEZA 4NCZA 4CAXA 4BBHA 3IWEA 5DWMA 3L2NA 2ZENA 1Y0YA 5DUSA 3FMCA 4GXHA 4P4EA 3BLNA 2FXFA 1AUGA 3PFOA 5JQ4A 1ZG7A 2H5MA 1JQGA 4MCPA 2VQYA 3EKEA 2B4BA 4FD4A 3GKRA 1ELLP 4MFKA 3KR5A 5IX3A 2L8RA 2FCKA 3IEHA 4YU9A 4NF1A 1XMBA 1GHEA 5D29A 3CDXA 2BOAA 3T90A 1BPNA 3SJFA 2Q43A 1M44A 1VKCA 2Q4ZA 2REFA 3A9LA 5CMSA 5IV0A 4H89A 2YNEA 4KOUA 2HB6A 4IK2A 1Q2CA 5E3BA 3FYNA 3VWEA 1SPVA 2JBKA 3F8KA 4HNXB 3PP9A 4LQGA 4A37A 2PRBA 4X2TA 1LOKA 2GLJA 3EJFA 3BHXA 3I3GA 4ABKA 2Z3NA 2ACFA 4LX9A 5HVGA 1QSTA 4NGPA 2PJ1A 1CP6A 3F5BA 4H6UA 5EC4A 3WC6A 1AYEA 2ZW7A 2J8MA 3D66A 2Q7SA 4MCQA 5ELYA 1VHOA 4ONUA 5HIHA 3FH4A 3WC5A 4CYPA 4ZX8A 5LRJA 2C27A 5C82A 1ARLA 3LMSA 3VWDA 5HVFA 1XEBA 3WR7A 3IWGA 1YVKA 2WPWA 3SI1A 1MK4A 1F57A 3PB4X 4ESSA 5H84A 4P4IA 2ZW4A 2D4OA 3EWOA 4ZYQA 3H5ZA 2P6EA 3KHZA 4KUAA 4C7IA 4TNUA 3V2BA 3B35A 2I3CA 1NSLA 5CBMA 4R3KA 1LRZA 3FEEA 5F49A 3SJXA 1YX0A 1KWMA 3H8GA 4K0CA 4FD6A 5GCNA 4NGRA 2X47A 1RTQA 3EWQA 6CPAA 2JZDA 1YMEA 3JTKA 4B11A 1KUXA 2GU2A 2V8HA 1FNOA 4AB7A 4J3GA 1HDQA 1YLOA 2B4DB 2F5IA 3PEIA 2PJ4A 1IOIA 2WPXA 1CBXA 1IB1E 2F7VA 4XNHC 1ARMA 3CXSA 2DXQA 2RFHA 3DGVA 1YD9A 1Y0RA 2FAVA 2KQVA 2AFWA 2R8VA 4UEEA 2Q44A 4QUSA 3FIXA 4I49A 1YR0A 4DJLA 5JH9A 4ZI6A 3VH9A 2C6PA 3W91A 2ZOGA 4UF4A 1XRYA 4CAWA 3B8GA 4EMEA 1YSJA 4IF5A 1TKJA 1IOFA 5KTCA 4F8ZA 3MGDA 4OC3A 2CY2A 5C88A 2REEA 3KR4A 3K9TA 1M1DA 4JLYA 4X8IA 4MRIA 3RAMA 4PXDA 2AFSA 4P4JA 4A94A 3R9EA 2BSWA 4ZBGA 4MCSA 3FECA 3NE7A 4PPZA 2AFCA 5FVJA 4BMHA 2PIZA 3TCVA 5JM6A 3K2KA 5LYLA 3TOAA 3FB3A 1I21A 1VIXA
chains in the Genus database with same CATH topology
1CG2A 4OC1A 4D86A 2PJ5A 2PJ9A 1HDUA 4UIBA 1YW6A 3EJGA 3D7HA 1ZR3A 4ABLA 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 5CPAA 1CPXA 4KYBA 2JBJA 3KHXA 2FVGA 2PVVA 2EWBA 2PCUA 4NFRA 3SIHA 3B2YA 2LGRA 3IFEA 3ISXA 5THWA 4JVVA 3SJEA 2F8HA 5LRKA 4IAVA 2GREA 3HLPA 3EW5A 4R8FA 2CF4A 3NFZA 4FUUA 2PVWA 1QMUA 1TY8A 2BO9A 2XEFA 4P4FA 4PXEA 4K3NA 1Z5RA 4FBEA 5FSVA 3VFQA 3FVLA 3FF3A 3I1UA 2ZEFA 2QVPA 4JCAA 2NSMA 3TC8A 2IJZA 1H8LA 1CX8A 1ZG8A 4JZ0A 3IIDA 4IQYA 1Z2LA 1TF8A 3NH8A 4P4BA 3GQEA 3CPXA 1EE3P 5J1QA 4OIWA 4MHZA 4NJQA 4O23A 4PQAA 1XJOA 4DUKA 2VRIA 1IY7A 3T8WA 3SIJA 2V8DA 2J9AA 3FX6A 3KASA 1Z8LA 2AFUA 2PJBA 5FSZA 2WZNA 4OIDA 3PBBA 1CPSA 3KL9A 2ZELA 3MN8A 3IWWA 4J5SA 3NH5A 4WJBA 4EFDA 3KZWA 4OP4A 1CP7A 4PXBA 3FJUA 2PJ7A 5K8MA 5FSXA 4H2KA 3VATA 3S9NA 2JEWA 2EEEA 2IQ6A 4NGMA 2OOTA 2PJ8A 2ZEPA 2HC9A 3B3WA 3PB8X 3IJ3A 5K8OA 2ZEDA 1Y7EA 1XBUA 2ABZA 3D68A 4PXCA 2POKA 2BFQA 1BAVA 1NSAA 1LANA 4ONWA 4P6YA 5I4MA 3Q6ZA 5FSUA 1TXZA 2ZEOA 3D7FA 3ISZA 4YWYA 2PJ6A 4OC2A 3TX8A 3CPAA 1LCPA 2XD7A 3EWRA 4DYOA 1PCAA 4R6TA 2C6GA 3ETIA 3GUXA 5LYIA 1R43A 2FG1A 3GPOA 1R3NA 1TF9A 1TKFA 1HJZA 3SI2A 4BD9A 4MCRA 3IO1A 5FSYA 2PJAA 3PB6X 4ETKA 1ZLHA 1IGBA 8CPAA 2EK9A 3GLJA 3B3CA 5AILA 2V8GA 3WC7A 5D8NA 4P10A 2OR4A 4J5QA 2PJCA 3BI0A 3PB7X 1HEEA 1ZG9A 4G1PA 2V8VA 3IIFA 3GPGA 1PYTB 4TWEA 5LRGA 1LFWA 2AFXA 2EK8A 2XEIA 4R7MA 4F9UA 3KGQA 5HXDA 3V45A 4Z65A 3SI0A 4ZX9A 2ZOFA 3D67A 4J4ZA 3V38A 3JZTA 4NGTA 4X3RA 4P44A 4NGSA 3PFEA 2RB7A 3HUVA 5IB9A 4J5RA 4UEFA 4UIAA 2VL1A 1BLLE 5HVHA 2AFMA 1LAMA 4TU0A 4NGNA 4A39A 4WWVA 1Q7LA 3FEDA 4NGQA 4GM5A 1AMPA 2C1CA 4P4DA 3H8EA 3D7DA 4B6ZA 4JYWA 4P45A 3SJGA 4GUAA 4W9YA 2QYVA 3RBUA 3B3TA 4F9VA 3D7GA 1ZLIA 1YW4A 3WABA 3Q71A 4MMOA 2DEAA 3CT9A 3MRUA 3SIGA 4GVVA 3NA6A 5LYFA 1VGYA 2PRQA 3KI9A 1DTDA 3BXMA 1DE4C 2O4HA 4MXUA 3PRTA 3B7IA 5F09A 1FT7A 3B3SA 1VHEA 2ZEHA 3SIIA 4EWTA 4ZY0A 4ZY1A 3GPQA 3IC1A 4ZY2A 2AFOA 2PJ0A 2XEGA 2PJ3A 1QQ9A 3H8FA 4FAIA 3DLJA 4IHMA 3N5FA 3QNVA 3LWUA 3BI1A 4ETJA 4OC4A 2ZEMA 1XFOA 3PB9X 4GVWA 4RUHA 2Q51A 3S9MA 4R76A 1VHUA 4UMLA 3B3VA 2CTCA 5HOLA 5K8PA 4Q7AA 1TXRA 4JGKA 3WT4A 4MHNA 5K8NA 2ZEGA 3GB0A 1UWYA 3PBEA 4OMEA 5DS0A 4JLLA 1F2OA 2NYQA 2BFRA 3NH4A 2CTBA 2PIYA 2V77A 4A38A 3RZAA 3VARA 2GLFA 5CB5A 2PJ2A 4AXVA 3S9LA 1GYTA 3EWPA 5LYDA 3V7ZA 4MHYA 4NJRA 2IMOA 2CIJA 2QJ8A 2G9DA 1M4LA 3D4UA 4OC0A 3KQZA 1ZR5A 3JRUA 4FWUA 2FXKA 2DX6A 5JGFA 2ZEEA 3GQOA 2C6CA 2WYRA 2O53A 2PE3A 1ELMP 4OKOA 1NJRA 4OC5A 4KSIA 2XEJA 2AFZA 2BCOA 1OBRA 5CB3A 7CPAA 2ANPA 4CPAA 1TKHA 4UEZA 3L2NA 2ZENA 1Y0YA 5DUSA 3FMCA 4P4EA 3PFOA 1ZG7A 1JQGA 4MCPA 3EKEA 1ELLP 3KR5A 2L8RA 3IEHA 4YU9A 1XMBA 5D29A 3CDXA 2BOAA 1BPNA 3SJFA 2Q43A 2Q4ZA 5CMSA 2HB6A 4IK2A 5E3BA 1SPVA 2JBKA 4LQGA 4A37A 4X2TA 1LOKA 2GLJA 3EJFA 3BHXA 4ABKA 2ACFA 5HVGA 4NGPA 2PJ1A 1CP6A 3WC6A 1AYEA 3D66A 4MCQA 5ELYA 1VHOA 3FH4A 5HIHA 3WC5A 4ZX8A 5LRJA 1ARLA 3LMSA 5HVFA 3SI1A 1F57A 3PB4X 4ESSA 4P4IA 3EWOA 4ZYQA 3KHZA 4TNUA 3V2BA 3B35A 2I3CA 5CBMA 3FEEA 3SJXA 1KWMA 3H8GA 4K0CA 4NGRA 2X47A 1RTQA 3EWQA 6CPAA 1YMEA 2GU2A 2V8HA 1FNOA 1HDQA 1YLOA 3PEIA 2PJ4A 1CBXA 2F7VA 1ARMA 2RFHA 3DGVA 1YD9A 1Y0RA 2FAVA 2AFWA 4UEEA 4DJLA 5JH9A 4ZI6A 3VH9A 2C6PA 2ZOGA 4UF4A 1XRYA 4EMEA 1YSJA 1TKJA 4F8ZA 4OC3A 3KR4A 3K9TA 4X8IA 4MRIA 3RAMA 4PXDA 2AFSA 4P4JA 4A94A 4MCSA 3FECA 4PPZA 2AFCA 2PIZA 5JM6A 3K2KA 5LYLA 3IIBA 1VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CG2 A;  4OC1 A;  4D86 A;  2PJ5 A;  2PJ9 A;  1HDU A;  4UIB A;  1YW6 A;  3EJG A;  3D7H A;  1ZR3 A;  4ABL A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  5CPA A;  1CPX A;  4KYB A;  2JBJ A;  3KHX A;  2FVG A;  2PVV A;  2EWB A;  2PCU A;  4NFR A;  3SIH A;  3B2Y A;  2LGR A;  3IFE A;  3ISX A;  5THW A;  4JVV A;  3SJE A;  2F8H A;  5LRK A;  4IAV A;  2GRE A;  3HLP A;  3EW5 A;  4R8F A;  2CF4 A;  3NFZ A;  4FUU A;  2PVW A;  1QMU A;  1TY8 A;  2BO9 A;  2XEF A;  4P4F A;  4PXE A;  4K3N A;  1Z5R A;  4FBE A;  5FSV A;  3VFQ A;  3FVL A;  3FF3 A;  3I1U A;  2ZEF A;  2QVP A;  4JCA A;  2NSM A;  3TC8 A;  2IJZ A;  1H8L A;  1CX8 A;  1ZG8 A;  4JZ0 A;  3IID A;  4IQY A;  1Z2L A;  1TF8 A;  3NH8 A;  4P4B A;  3GQE A;  3CPX A;  1EE3 P;  5J1Q A;  4OIW A;  4MHZ A;  4NJQ A;  4O23 A;  4PQA A;  1XJO A;  4DUK A;  2VRI A;  1IY7 A;  3T8W A;  3SIJ A;  2V8D A;  2J9A A;  3FX6 A;  3KAS A;  1Z8L A;  2AFU A;  2PJB A;  5FSZ A;  2WZN A;  4OID A;  3PBB A;  1CPS A;  3KL9 A;  2ZEL A;  3MN8 A;  3IWW A;  4J5S A;  3NH5 A;  4WJB A;  4EFD A;  3KZW A;  4OP4 A;  1CP7 A;  4PXB A;  3FJU A;  2PJ7 A;  5K8M A;  5FSX A;  4H2K A;  3VAT A;  3S9N A;  2JEW A;  2EEE A;  2IQ6 A;  4NGM A;  2OOT A;  2PJ8 A;  2ZEP A;  2HC9 A;  3B3W A;  3PB8 X;  3IJ3 A;  5K8O A;  2ZED A;  1Y7E A;  1XBU A;  2ABZ A;  3D68 A;  4PXC A;  2POK A;  2BFQ A;  1BAV A;  1NSA A;  1LAN A;  4ONW A;  4P6Y A;  5I4M A;  3Q6Z A;  5FSU A;  1TXZ A;  2ZEO A;  3D7F A;  3ISZ A;  4YWY A;  2PJ6 A;  4OC2 A;  3TX8 A;  3CPA A;  1LCP A;  2XD7 A;  3EWR A;  4DYO A;  1PCA A;  4R6T A;  2C6G A;  3ETI A;  3GUX A;  5LYI A;  1R43 A;  2FG1 A;  3GPO A;  1R3N A;  1TF9 A;  1TKF A;  1HJZ A;  3SI2 A;  4BD9 A;  4MCR A;  3IO1 A;  5FSY A;  2PJA A;  3PB6 X;  4ETK A;  1ZLH A;  1IGB A;  8CPA A;  2EK9 A;  3GLJ A;  3B3C A;  5AIL A;  2V8G A;  3WC7 A;  5D8N A;  4P10 A;  2OR4 A;  4J5Q A;  2PJC A;  3BI0 A;  3PB7 X;  1HEE A;  1ZG9 A;  4G1P A;  2V8V A;  3IIF A;  3GPG A;  1PYT B;  4TWE A;  5LRG A;  1LFW A;  2AFX A;  2EK8 A;  2XEI A;  4R7M A;  4F9U A;  3KGQ A;  5HXD A;  3V45 A;  4Z65 A;  3SI0 A;  4ZX9 A;  2ZOF A;  3D67 A;  4J4Z A;  3V38 A;  3JZT A;  4NGT A;  4X3R A;  4P44 A;  4NGS A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  4J5R A;  4UEF A;  4UIA A;  2VL1 A;  1BLL E;  5HVH A;  2AFM A;  1LAM A;  4TU0 A;  4NGN A;  4A39 A;  4WWV A;  1Q7L A;  3FED A;  4NGQ A;  4GM5 A;  1AMP A;  2C1C A;  4P4D A;  3H8E A;  3D7D A;  4B6Z A;  4JYW A;  4P45 A;  3SJG A;  4GUA A;  4W9Y A;  2QYV A;  3RBU A;  3B3T A;  4F9V A;  3D7G A;  1ZLI A;  1YW4 A;  3WAB A;  3Q71 A;  4MMO A;  2DEA A;  3CT9 A;  3MRU A;  3SIG A;  4GVV A;  3NA6 A;  5LYF A;  1VGY A;  2PRQ A;  3KI9 A;  1DTD A;  3BXM A;  1DE4 C;  2O4H A;  4MXU A;  3PRT A;  3B7I A;  5F09 A;  1FT7 A;  3B3S A;  1VHE A;  2ZEH A;  3SII A;  4EWT A;  4ZY0 A;  4ZY1 A;  3GPQ A;  3IC1 A;  4ZY2 A;  2AFO A;  2PJ0 A;  2XEG A;  2PJ3 A;  1QQ9 A;  3H8F A;  4FAI A;  3DLJ A;  4IHM A;  3N5F A;  3QNV A;  3LWU A;  3BI1 A;  4ETJ A;  4OC4 A;  2ZEM A;  1XFO A;  3PB9 X;  4GVW A;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  1VHU A;  4UML A;  3B3V A;  2CTC A;  5HOL A;  5K8P A;  4Q7A A;  1TXR A;  4JGK A;  3WT4 A;  4MHN A;  5K8N A;  2ZEG A;  3GB0 A;  1UWY A;  3PBE A;  4OME A;  5DS0 A;  4JLL A;  1F2O A;  2NYQ A;  2BFR A;  3NH4 A;  2CTB A;  2PIY A;  2V77 A;  4A38 A;  3RZA A;  3VAR A;  2GLF A;  5CB5 A;  2PJ2 A;  4AXV A;  3S9L A;  1GYT A;  3EWP A;  5LYD A;  3V7Z A;  4MHY A;  4NJR A;  2IMO A;  2CIJ A;  2QJ8 A;  2G9D A;  1M4L A;  3D4U A;  4OC0 A;  3KQZ A;  1ZR5 A;  3JRU A;  4FWU A;  2FXK A;  2DX6 A;  5JGF A;  2ZEE A;  3GQO A;  2C6C A;  2WYR A;  2O53 A;  2PE3 A;  1ELM P;  4OKO A;  1NJR A;  4OC5 A;  4KSI A;  2XEJ A;  2AFZ A;  2BCO A;  1OBR A;  5CB3 A;  7CPA A;  2ANP A;  4CPA A;  1TKH A;  4UEZ A;  3L2N A;  2ZEN A;  1Y0Y A;  5DUS A;  3FMC A;  4P4E A;  3PFO A;  1ZG7 A;  1JQG A;  4MCP A;  3EKE A;  1ELL P;  3KR5 A;  2L8R A;  3IEH A;  4YU9 A;  1XMB A;  5D29 A;  3CDX A;  2BOA A;  1BPN A;  3SJF A;  2Q43 A;  2Q4Z A;  5CMS A;  2HB6 A;  4IK2 A;  5E3B A;  1SPV A;  2JBK A;  4LQG A;  4A37 A;  4X2T A;  1LOK A;  2GLJ A;  3EJF A;  3BHX A;  4ABK A;  2ACF A;  5HVG A;  4NGP A;  2PJ1 A;  1CP6 A;  3WC6 A;  1AYE A;  3D66 A;  4MCQ A;  5ELY A;  1VHO A;  3FH4 A;  5HIH A;  3WC5 A;  4ZX8 A;  5LRJ A;  1ARL A;  3LMS A;  5HVF A;  3SI1 A;  1F57 A;  3PB4 X;  4ESS A;  4P4I A;  3EWO A;  4ZYQ A;  3KHZ A;  4TNU A;  3V2B A;  3B35 A;  2I3C A;  5CBM A;  3FEE A;  3SJX A;  1KWM A;  3H8G A;  4K0C A;  4NGR A;  2X47 A;  1RTQ A;  3EWQ A;  6CPA A;  1YME A;  2GU2 A;  2V8H A;  1FNO A;  1HDQ A;  1YLO A;  3PEI A;  2PJ4 A;  1CBX A;  2F7V A;  1ARM A;  2RFH A;  3DGV A;  1YD9 A;  1Y0R A;  2FAV A;  2AFW A;  4UEE A;  4DJL A;  5JH9 A;  4ZI6 A;  3VH9 A;  2C6P A;  2ZOG A;  4UF4 A;  1XRY A;  4EME A;  1YSJ A;  1TKJ A;  4F8Z A;  4OC3 A;  3KR4 A;  3K9T A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  2AFS A;  4P4J A;  4A94 A;  4MCS A;  3FEC A;  4PPZ A;  2AFC A;  2PIZ A;  5JM6 A;  3K2K A;  5LYL A;  3IIB A;  1VIX A; 
#chains in the Genus database with same CATH topology
 4QB9 A;  1CG2 A;  2G0B A;  2AJ6 A;  2PDO A;  2JLM A;  4OC1 A;  4AVB A;  4D86 A;  1RXT A;  1S3Z A;  2R1I A;  2R98 A;  2PJ5 A;  2G3T A;  2D4P A;  2ZW5 A;  2B3V A;  4B10 A;  2PJ9 A;  1HDU A;  2JDC A;  4UIB A;  1YW6 A;  3EJG A;  4MFJ A;  2FSR A;  4KLV A;  2ZPA A;  3D7H A;  1ZR3 A;  3ZJ0 A;  4ABL A;  1XF8 A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  2ATR A;  4PV6 A;  4OAE A;  2YNC C;  4PSW A;  5KTD A;  5CPA A;  1CPX A;  4KYB A;  2JBJ A;  2R7H A;  3GYA A;  3KHX A;  2FVG A;  4UA3 A;  2PVV A;  2EWB A;  1S7K A;  2DPS A;  2PCU A;  4NFR A;  1P0H A;  2CXA A;  1CM0 A;  2ARH A;  3SIH A;  1YQE A;  2VI7 A;  3D3S A;  3B2Y A;  2GFQ A;  3DR8 A;  2LGR A;  3IFE A;  2VXK A;  4CGP A;  3ISX A;  4HKF A;  4UFV A;  5ISV A;  3LAC A;  4LUA A;  5THW A;  1YGH A;  4JVV A;  3F0A A;  1Y7R A;  2F8H A;  2I79 A;  2B5G B;  1RO5 A;  4HPS A;  5G20 A;  3SJE A;  2Z3L A;  5LRK A;  1IID A;  4IAV A;  2GRE A;  3HLP A;  3EW5 A;  4R8F A;  4B5O A;  2CF4 A;  4B14 A;  4A32 A;  3NFZ A;  3QB8 A;  4FUU A;  4RS2 A;  1PUA A;  2PVW A;  2JZF A;  1QMU A;  4R3L A;  1TY8 A;  2BO9 A;  4CGO A;  2XEF A;  4P4F A;  4PXE A;  1SQH A;  4K3N A;  1Z5R A;  4CAE A;  4ZGY B;  4FBE A;  4E0A A;  5FSV A;  3VFQ A;  3IIB A;  3FVL A;  5EBV A;  3FF3 A;  3I1U A;  1XOV A;  4EVY A;  2ZEF A;  4YFJ A;  4CGL A;  1Z4E A;  4CYQ A;  1Z8T A;  2QVP A;  2VZY A;  4JCA A;  1MJ9 A;  2NSM A;  3TC8 A;  1H8L A;  1ZG8 A;  1CX8 A;  2IJZ A;  3R95 A;  2HV2 A;  4JZ0 A;  4CAV A;  3IID A;  2FL4 A;  3PZJ A;  4PK3 A;  4IQY A;  1Z2L A;  4B5P B;  4MFQ A;  1TF8 A;  4KOS A;  3NH8 A;  4P4B A;  3GQE A;  1PU9 A;  2Q04 A;  4YRH A;  1X12 A;  3D8P A;  2J8N A;  4AG7 A;  3CPX A;  1EE3 P;  5J1Q A;  4NSQ A;  4OIW A;  4MHZ A;  4NJQ A;  2P6G A;  4O23 A;  4UCP A;  4PQA A;  1XJO A;  4AVA A;  2K5T A;  3EC4 A;  4CGN A;  4DUK A;  2VRI A;  3P2F A;  1IY7 A;  4RI1 A;  1Y9W A;  3T8W A;  3SIJ A;  3BJ7 A;  2V8D A;  4MY0 A;  2J9A A;  3FX6 A;  3KAS A;  3TO6 A;  1Z8L A;  2AFU A;  2PJB A;  5FSZ A;  2WZN A;  4OID A;  3PBB A;  1CPS A;  3KL9 A;  2ZEL A;  2VEZ A;  5EMI A;  1S7F A;  3MN8 A;  4GS4 A;  1B87 A;  3IWW A;  4KZT A;  4J5S A;  3NH5 A;  3PGP A;  4Q36 A;  4WJB A;  4EFD A;  3KZW A;  3EO4 A;  1CP7 A;  4OP4 A;  4PXB A;  4UWI A;  2PSW A;  3FJU A;  2RNK A;  2PJ7 A;  4CAF A;  4QVT A;  4C68 A;  3TFY A;  5K8M A;  2FIA A;  5FSX A;  4NXY A;  5AG6 A;  5J8C A;  4H2K A;  3VAT A;  3S9N A;  3OWC A;  2JEW A;  4R87 A;  2EEE A;  2VZZ A;  5F47 A;  4K30 A;  1I1D A;  2IQ6 A;  2CNT A;  4NGM A;  4MI4 A;  2OOT A;  3TE4 A;  2O28 A;  2PJ8 A;  2ZEP A;  2HC9 A;  1Q2Y A;  3B3W A;  3PB8 X;  4HNY B;  3IJ3 A;  4AVC A;  1WK4 A;  5K8O A;  1MJA A;  1Y7E A;  1XBU A;  2ABZ A;  2ZED A;  3D68 A;  4PXC A;  3QAY A;  1B6B A;  4PK2 A;  4KOV A;  4A30 A;  1NMT A;  1M4G A;  2P6F A;  2POK A;  2BFQ A;  3EXN A;  1BAV A;  1NSA A;  1LAN A;  2Z3M A;  4ORF A;  4ONW A;  4P6Y A;  1U6M A;  1A2Z A;  2AE6 A;  2Z11 A;  3Q6Z A;  5FSU A;  1TXZ A;  2ZEO A;  3D7F A;  3DR6 A;  3ISZ A;  4YWY A;  5A28 A;  5AG4 A;  2PJ6 A;  4OC2 A;  4CRY B;  1YK3 A;  4L89 A;  3TX8 A;  3CPA A;  2PQ8 A;  3T9Y A;  1QSN A;  1BOB A;  2B58 A;  5AGE A;  3R9G A;  2FS5 A;  4C2Z A;  2ZXV A;  1LCP A;  2QEC A;  3TOB A;  4FD7 A;  2XD7 A;  3EWR A;  2FE7 A;  4DYO A;  1PCA A;  4R6T A;  2C6G A;  4KVX A;  3ETI A;  3EFA A;  3TO9 A;  3EY5 A;  3GUX A;  5KTA A;  4MY3 A;  3S6K A;  3TT2 A;  4XPD C;  2OZH A;  5G1Z A;  4C7H A;  1J4J A;  2Q0Y A;  5LYI A;  1R43 A;  2FG1 A;  3GPO A;  1R3N A;  5BWA B;  2KCW A;  1TF9 A;  4KVM E;  1TKF A;  3JVN A;  1HJZ A;  1VHS A;  2NMT A;  4E2A A;  1XMT A;  5CNP A;  4YGO A;  3SI2 A;  2YGW A;  2YNC A;  4BD9 A;  4MCR A;  2JDD A;  3IO1 A;  3LD2 A;  5FSY A;  2Q7B A;  5F46 A;  2PJA A;  1S60 A;  2QML A;  3PB6 X;  4ETK A;  1ZLH A;  2EUI A;  2JZE A;  1IGB A;  5J8F A;  8CPA A;  2EK9 A;  3GLJ A;  1KUY A;  3B3C A;  5AIL A;  1ZO0 A;  2V8G A;  4B13 A;  5I4M A;  4MJ8 A;  3WC7 A;  5D8N A;  1QSR A;  4P10 A;  3SXN A;  2OR4 A;  1OZP A;  4J5Q A;  2PJC A;  4M3S A;  4MHD A;  2I00 A;  4C2Y A;  3BI0 A;  4E8O A;  3LOD A;  1ON0 A;  1HEE A;  2EVN A;  3PB7 X;  5JPH A;  1Z8X A;  2CNM A;  1P4N A;  1ZG9 A;  4G1P A;  1L0C A;  3C26 A;  4KOT A;  3GIU A;  2V8V A;  4KSF A;  3IIF A;  3GPG A;  1PYT B;  2P0W A;  3FRM A;  4TWE A;  5LRG A;  1LFW A;  2AFX A;  1Y9K A;  1BO4 A;  2EK8 A;  4R7M A;  2XEI A;  4MBU A;  3D2P A;  4F9U A;  4KOX A;  4M6H A;  1CJW A;  3KGQ A;  3KKW A;  4KOR A;  5HXD A;  5HMN A;  3V45 A;  3SHP A;  1Q2D A;  4CRZ B;  4Z65 A;  4KSA A;  3SI0 A;  4XPL A;  4ZX9 A;  2ZOF A;  1IYL A;  3D67 A;  3CXP A;  5DWN A;  4J4Z A;  2Y0M A;  3V38 A;  3P2H A;  3JZT A;  3SXO A;  4NGT A;  2EO8 A;  2ODF A;  4LQ6 A;  3NE8 A;  3FNC A;  3ZZI A;  1N71 A;  2Q4Y A;  4X3R A;  2HQY A;  4P44 A;  4HNW B;  4NGS A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  4OLL A;  4J5R A;  3GY9 A;  4UEF A;  3S6F A;  2GAN A;  3E0K A;  2J8R A;  4A2Z A;  4UIA A;  1BLL E;  2BEI A;  2VL1 A;  3CXQ A;  2AFM A;  4JJX A;  4AG9 A;  5HVH A;  1LAM A;  1X10 A;  2Z10 A;  4CS0 B;  4TU0 A;  4JXQ A;  4NGN A;  4A39 A;  1YLE A;  4WWV A;  1Q7L A;  2OZU A;  4B12 A;  4CYN A;  3FED A;  2FT0 A;  4NGQ A;  4GM5 A;  1AMP A;  2C1C A;  4UFW A;  1KUV A;  1IYK A;  5I0C A;  4P4D A;  3H8E A;  3D7D A;  2WSA A;  4B6Z A;  4JYW A;  4X5K A;  2HUZ A;  2WCT A;  2B5G A;  4P45 A;  3SJG A;  4GUA A;  4W9Y A;  4F6A A;  2QYV A;  2OB0 A;  3RBU A;  3B3T A;  2Z3O A;  2WUU A;  4A95 A;  2FIW A;  3K9U A;  4F9V A;  3D7G A;  1S7L A;  1ZLI A;  1YW4 A;  3CZX A;  4M6I A;  3R96 A;  3RYO A;  4UCN A;  5HH1 A;  3Q71 A;  2DPT A;  3WAB A;  2EBJ A;  4MMO A;  4Y49 C;  3IU1 A;  2PR1 A;  1QSO A;  2DEA A;  3CT9 A;  3MRU A;  3SIG A;  4M85 A;  4Q38 A;  4UBR A;  4GVV A;  1I12 A;  4U9Z A;  1IIC A;  2BL1 A;  3NA6 A;  3R1K A;  5LYF A;  5F48 A;  1NE9 A;  1VGY A;  1K4J A;  2PRQ A;  3KI9 A;  1DTD A;  3BXM A;  1YVO A;  1Z8W A;  1DE4 C;  2O4H A;  3G3S A;  4MXU A;  4KOW A;  3UY5 A;  2QIR A;  3PRT A;  3JUW A;  1Z9U A;  3B7I A;  4II9 A;  4JWP A;  5F09 A;  1FT7 A;  1FY7 A;  3B3S A;  1VHE A;  2ZEH A;  1V0C A;  3SII A;  1XIX A;  4EWT A;  1IU8 A;  3DSB A;  4PSX A;  4ZY0 A;  4ZY1 A;  3GPQ A;  3D2M A;  5G22 A;  3IC1 A;  4ZY2 A;  2AFO A;  2PJ0 A;  2XEG A;  1M4D A;  2PJ3 A;  1QQ9 A;  2B3U A;  3H8F A;  4FAI A;  3DLJ A;  3IGR A;  4IHM A;  3N5F A;  3QNV A;  4KS9 A;  1S7N A;  3TO7 A;  4UFX A;  3W6S A;  3LWU A;  4C2X A;  4DNC A;  1MJB A;  3BI1 A;  5E96 A;  4ETJ A;  2PC1 A;  4OC4 A;  2Q4V A;  2ZEM A;  4FD5 A;  4KUB A;  4F0X A;  2OZG A;  1XFO A;  3PB9 X;  4GVW A;  3BJ8 A;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  1VHU A;  3G8W A;  4RN7 A;  4UML A;  3B3V A;  1Z4R A;  2A4N A;  4CYO A;  3I9S A;  2CTC A;  3S6G A;  4Y49 B;  2Z0Z A;  5HOL A;  5K8P A;  2IL4 A;  2JEV A;  4Q7A A;  4XNH B;  1TXR A;  4JGK A;  4MFP A;  5IB0 A;  4UCM A;  1QSM A;  1XE4 A;  4MHN A;  4XPD B;  3WT4 A;  4CGM A;  4QBJ A;  2CNS A;  5K8N A;  4OAD A;  2ZEG A;  2B4D A;  3GB0 A;  2ZW6 A;  1UWY A;  2YND A;  3PBE A;  4OME A;  5H86 A;  4JD6 A;  4JLL A;  1F2O A;  2NYQ A;  3FXT A;  2BFR A;  3DDD A;  5DS0 A;  3RO0 A;  2W2G A;  3FBU A;  4KVO E;  2Z3K A;  3IU2 A;  3NH4 A;  4IUS A;  4L8A A;  4R9M A;  5AG7 A;  4JXR A;  5AG5 A;  2RC4 A;  4U9Y A;  1R57 A;  2CTB A;  2PIY A;  2V77 A;  4KLW A;  3RZA A;  4A38 A;  4MFZ A;  3VAR A;  2GLF A;  5CB5 A;  2PJ2 A;  1S5K A;  3V8I A;  4AXV A;  1GYT A;  3EWP A;  4BIN A;  3N7Z A;  3S9L A;  1YRE A;  1JWQ A;  5LYD A;  3R9F A;  3V7Z A;  3QAH A;  4MHY A;  4NJR A;  2IMO A;  4B5P A;  2GIV A;  2CIJ A;  2QJ8 A;  2DF5 A;  1KZF A;  2G9D A;  1M4L A;  3DNS A;  3D4U A;  4UWJ A;  4OC0 A;  3KQZ A;  3S6H A;  4U5Y A;  4QC6 A;  1ZR5 A;  3JRU A;  4FWU A;  4A33 A;  2FXK A;  2DX6 A;  1M4I A;  5A27 A;  2ZEE A;  5JGF A;  3GQO A;  2C6C A;  2WYR A;  4F0Y A;  1TIQ A;  4H6Z A;  2Z3P A;  2O53 A;  2PE3 A;  1ELM P;  4NEX A;  4OKO A;  1NJR A;  4MFL A;  4OC5 A;  2OU2 A;  4XPK A;  4KSI A;  2GE3 A;  2PR8 A;  3TTH A;  4A31 A;  2BUE A;  1UFH A;  4R57 A;  2X7B A;  2AFZ A;  2BCO A;  2XEJ A;  1WWZ A;  2G3A A;  1OBR A;  2VBQ A;  4KOY A;  5CB3 A;  3RNZ A;  4M6G A;  7CPA A;  2OH1 A;  5G21 A;  3H4Q A;  3W6X A;  2ANP A;  4CPA A;  1TKH A;  4UEZ A;  4NCZ A;  4CAX A;  4BBH A;  3IWE A;  5DWM A;  3L2N A;  2ZEN A;  1Y0Y A;  5DUS A;  3FMC A;  4GXH A;  4P4E A;  3BLN A;  2FXF A;  1AUG A;  3PFO A;  5JQ4 A;  1ZG7 A;  2H5M A;  1JQG A;  4MCP A;  2VQY A;  3EKE A;  2B4B A;  4FD4 A;  3GKR A;  1ELL P;  4MFK A;  3KR5 A;  5IX3 A;  2L8R A;  2FCK A;  3IEH A;  4YU9 A;  4NF1 A;  1XMB A;  1GHE A;  5D29 A;  3CDX A;  2BOA A;  3T90 A;  1BPN A;  3SJF A;  2Q43 A;  1M44 A;  1VKC A;  2Q4Z A;  2REF A;  3A9L A;  5CMS A;  5IV0 A;  4H89 A;  2YNE A;  4KOU A;  2HB6 A;  4IK2 A;  1Q2C A;  5E3B A;  3FYN A;  3VWE A;  1SPV A;  2JBK A;  3F8K A;  4HNX B;  3PP9 A;  4LQG A;  4A37 A;  2PRB A;  4X2T A;  1LOK A;  2GLJ A;  3EJF A;  3BHX A;  3I3G A;  4ABK A;  2Z3N A;  2ACF A;  4LX9 A;  5HVG A;  1QST A;  4NGP A;  2PJ1 A;  1CP6 A;  3F5B A;  4H6U A;  5EC4 A;  3WC6 A;  1AYE A;  2ZW7 A;  2J8M A;  3D66 A;  2Q7S A;  4MCQ A;  5ELY A;  1VHO A;  4ONU A;  5HIH A;  3FH4 A;  3WC5 A;  4CYP A;  4ZX8 A;  5LRJ A;  2C27 A;  5C82 A;  1ARL A;  3LMS A;  3VWD A;  5HVF A;  1XEB A;  3WR7 A;  3IWG A;  1YVK A;  2WPW A;  3SI1 A;  1MK4 A;  1F57 A;  3PB4 X;  4ESS A;  5H84 A;  4P4I A;  2ZW4 A;  2D4O A;  3EWO A;  4ZYQ A;  3H5Z A;  2P6E A;  3KHZ A;  4KUA A;  4C7I A;  4TNU A;  3V2B A;  3B35 A;  2I3C A;  1NSL A;  5CBM A;  4R3K A;  1LRZ A;  3FEE A;  5F49 A;  3SJX A;  1YX0 A;  1KWM A;  3H8G A;  4K0C A;  4FD6 A;  5GCN A;  4NGR A;  2X47 A;  1RTQ A;  3EWQ A;  6CPA A;  2JZD A;  1YME A;  3JTK A;  4B11 A;  1KUX A;  2GU2 A;  2V8H A;  1FNO A;  4AB7 A;  4J3G A;  1HDQ A;  1YLO A;  2B4D B;  2F5I A;  3PEI A;  2PJ4 A;  1IOI A;  2WPX A;  1CBX A;  1IB1 E;  2F7V A;  4XNH C;  1ARM A;  3CXS A;  2DXQ A;  2RFH A;  3DGV A;  1YD9 A;  1Y0R A;  2FAV A;  2KQV A;  2AFW A;  2R8V A;  4UEE A;  2Q44 A;  4QUS A;  3FIX A;  4I49 A;  1YR0 A;  4DJL A;  5JH9 A;  4ZI6 A;  3VH9 A;  2C6P A;  3W91 A;  2ZOG A;  4UF4 A;  1XRY A;  4CAW A;  3B8G A;  4EME A;  1YSJ A;  4IF5 A;  1TKJ A;  1IOF A;  5KTC A;  4F8Z A;  3MGD A;  4OC3 A;  2CY2 A;  5C88 A;  2REE A;  3KR4 A;  3K9T A;  1M1D A;  4JLY A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  2AFS A;  4P4J A;  4A94 A;  3R9E A;  2BSW A;  4ZBG A;  4MCS A;  3FEC A;  3NE7 A;  4PPZ A;  2AFC A;  5FVJ A;  4BMH A;  2PIZ A;  3TCV A;  5JM6 A;  3K2K A;  5LYL A;  3TOA A;  3FB3 A;  1I21 A;  1VIX A; 
#chains in the Genus database with same CATH homology
 1CG2 A;  4OC1 A;  4D86 A;  2PJ5 A;  2PJ9 A;  1HDU A;  4UIB A;  1YW6 A;  3EJG A;  3D7H A;  1ZR3 A;  4ABL A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  5CPA A;  1CPX A;  4KYB A;  2JBJ A;  3KHX A;  2FVG A;  2PVV A;  2EWB A;  2PCU A;  4NFR A;  3SIH A;  3B2Y A;  2LGR A;  3IFE A;  3ISX A;  5THW A;  4JVV A;  3SJE A;  2F8H A;  5LRK A;  4IAV A;  2GRE A;  3HLP A;  3EW5 A;  4R8F A;  2CF4 A;  3NFZ A;  4FUU A;  2PVW A;  1QMU A;  1TY8 A;  2BO9 A;  2XEF A;  4P4F A;  4PXE A;  4K3N A;  1Z5R A;  4FBE A;  5FSV A;  3VFQ A;  3FVL A;  3FF3 A;  3I1U A;  2ZEF A;  2QVP A;  4JCA A;  2NSM A;  3TC8 A;  2IJZ A;  1H8L A;  1CX8 A;  1ZG8 A;  4JZ0 A;  3IID A;  4IQY A;  1Z2L A;  1TF8 A;  3NH8 A;  4P4B A;  3GQE A;  3CPX A;  1EE3 P;  5J1Q A;  4OIW A;  4MHZ A;  4NJQ A;  4O23 A;  4PQA A;  1XJO A;  4DUK A;  2VRI A;  1IY7 A;  3T8W A;  3SIJ A;  2V8D A;  2J9A A;  3FX6 A;  3KAS A;  1Z8L A;  2AFU A;  2PJB A;  5FSZ A;  2WZN A;  4OID A;  3PBB A;  1CPS A;  3KL9 A;  2ZEL A;  3MN8 A;  3IWW A;  4J5S A;  3NH5 A;  4WJB A;  4EFD A;  3KZW A;  4OP4 A;  1CP7 A;  4PXB A;  3FJU A;  2PJ7 A;  5K8M A;  5FSX A;  4H2K A;  3VAT A;  3S9N A;  2JEW A;  2EEE A;  2IQ6 A;  4NGM A;  2OOT A;  2PJ8 A;  2ZEP A;  2HC9 A;  3B3W A;  3PB8 X;  3IJ3 A;  5K8O A;  2ZED A;  1Y7E A;  1XBU A;  2ABZ A;  3D68 A;  4PXC A;  2POK A;  2BFQ A;  1BAV A;  1NSA A;  1LAN A;  4ONW A;  4P6Y A;  5I4M A;  3Q6Z A;  5FSU A;  1TXZ A;  2ZEO A;  3D7F A;  3ISZ A;  4YWY A;  2PJ6 A;  4OC2 A;  3TX8 A;  3CPA A;  1LCP A;  2XD7 A;  3EWR A;  4DYO A;  1PCA A;  4R6T A;  2C6G A;  3ETI A;  3GUX A;  5LYI A;  1R43 A;  2FG1 A;  3GPO A;  1R3N A;  1TF9 A;  1TKF A;  1HJZ A;  3SI2 A;  4BD9 A;  4MCR A;  3IO1 A;  5FSY A;  2PJA A;  3PB6 X;  4ETK A;  1ZLH A;  1IGB A;  8CPA A;  2EK9 A;  3GLJ A;  3B3C A;  5AIL A;  2V8G A;  3WC7 A;  5D8N A;  4P10 A;  2OR4 A;  4J5Q A;  2PJC A;  3BI0 A;  3PB7 X;  1HEE A;  1ZG9 A;  4G1P A;  2V8V A;  3IIF A;  3GPG A;  1PYT B;  4TWE A;  5LRG A;  1LFW A;  2AFX A;  2EK8 A;  2XEI A;  4R7M A;  4F9U A;  3KGQ A;  5HXD A;  3V45 A;  4Z65 A;  3SI0 A;  4ZX9 A;  2ZOF A;  3D67 A;  4J4Z A;  3V38 A;  3JZT A;  4NGT A;  4X3R A;  4P44 A;  4NGS A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  4J5R A;  4UEF A;  4UIA A;  2VL1 A;  1BLL E;  5HVH A;  2AFM A;  1LAM A;  4TU0 A;  4NGN A;  4A39 A;  4WWV A;  1Q7L A;  3FED A;  4NGQ A;  4GM5 A;  1AMP A;  2C1C A;  4P4D A;  3H8E A;  3D7D A;  4B6Z A;  4JYW A;  4P45 A;  3SJG A;  4GUA A;  4W9Y A;  2QYV A;  3RBU A;  3B3T A;  4F9V A;  3D7G A;  1ZLI A;  1YW4 A;  3WAB A;  3Q71 A;  4MMO A;  2DEA A;  3CT9 A;  3MRU A;  3SIG A;  4GVV A;  3NA6 A;  5LYF A;  1VGY A;  2PRQ A;  3KI9 A;  1DTD A;  3BXM A;  1DE4 C;  2O4H A;  4MXU A;  3PRT A;  3B7I A;  5F09 A;  1FT7 A;  3B3S A;  1VHE A;  2ZEH A;  3SII A;  4EWT A;  4ZY0 A;  4ZY1 A;  3GPQ A;  3IC1 A;  4ZY2 A;  2AFO A;  2PJ0 A;  2XEG A;  2PJ3 A;  1QQ9 A;  3H8F A;  4FAI A;  3DLJ A;  4IHM A;  3N5F A;  3QNV A;  3LWU A;  3BI1 A;  4ETJ A;  4OC4 A;  2ZEM A;  1XFO A;  3PB9 X;  4GVW A;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  1VHU A;  4UML A;  3B3V A;  2CTC A;  5HOL A;  5K8P A;  4Q7A A;  1TXR A;  4JGK A;  3WT4 A;  4MHN A;  5K8N A;  2ZEG A;  3GB0 A;  1UWY A;  3PBE A;  4OME A;  5DS0 A;  4JLL A;  1F2O A;  2NYQ A;  2BFR A;  3NH4 A;  2CTB A;  2PIY A;  2V77 A;  4A38 A;  3RZA A;  3VAR A;  2GLF A;  5CB5 A;  2PJ2 A;  4AXV A;  3S9L A;  1GYT A;  3EWP A;  5LYD A;  3V7Z A;  4MHY A;  4NJR A;  2IMO A;  2CIJ A;  2QJ8 A;  2G9D A;  1M4L A;  3D4U A;  4OC0 A;  3KQZ A;  1ZR5 A;  3JRU A;  4FWU A;  2FXK A;  2DX6 A;  5JGF A;  2ZEE A;  3GQO A;  2C6C A;  2WYR A;  2O53 A;  2PE3 A;  1ELM P;  4OKO A;  1NJR A;  4OC5 A;  4KSI A;  2XEJ A;  2AFZ A;  2BCO A;  1OBR A;  5CB3 A;  7CPA A;  2ANP A;  4CPA A;  1TKH A;  4UEZ A;  3L2N A;  2ZEN A;  1Y0Y A;  5DUS A;  3FMC A;  4P4E A;  3PFO A;  1ZG7 A;  1JQG A;  4MCP A;  3EKE A;  1ELL P;  3KR5 A;  2L8R A;  3IEH A;  4YU9 A;  1XMB A;  5D29 A;  3CDX A;  2BOA A;  1BPN A;  3SJF A;  2Q43 A;  2Q4Z A;  5CMS A;  2HB6 A;  4IK2 A;  5E3B A;  1SPV A;  2JBK A;  4LQG A;  4A37 A;  4X2T A;  1LOK A;  2GLJ A;  3EJF A;  3BHX A;  4ABK A;  2ACF A;  5HVG A;  4NGP A;  2PJ1 A;  1CP6 A;  3WC6 A;  1AYE A;  3D66 A;  4MCQ A;  5ELY A;  1VHO A;  3FH4 A;  5HIH A;  3WC5 A;  4ZX8 A;  5LRJ A;  1ARL A;  3LMS A;  5HVF A;  3SI1 A;  1F57 A;  3PB4 X;  4ESS A;  4P4I A;  3EWO A;  4ZYQ A;  3KHZ A;  4TNU A;  3V2B A;  3B35 A;  2I3C A;  5CBM A;  3FEE A;  3SJX A;  1KWM A;  3H8G A;  4K0C A;  4NGR A;  2X47 A;  1RTQ A;  3EWQ A;  6CPA A;  1YME A;  2GU2 A;  2V8H A;  1FNO A;  1HDQ A;  1YLO A;  3PEI A;  2PJ4 A;  1CBX A;  2F7V A;  1ARM A;  2RFH A;  3DGV A;  1YD9 A;  1Y0R A;  2FAV A;  2AFW A;  4UEE A;  4DJL A;  5JH9 A;  4ZI6 A;  3VH9 A;  2C6P A;  2ZOG A;  4UF4 A;  1XRY A;  4EME A;  1YSJ A;  1TKJ A;  4F8Z A;  4OC3 A;  3KR4 A;  3K9T A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  2AFS A;  4P4J A;  4A94 A;  4MCS A;  3FEC A;  4PPZ A;  2AFC A;  2PIZ A;  5JM6 A;  3K2K A;  5LYL A;  3IIB A;  1VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...