1BPMA

Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
484
structure length
481
Chain Sequence
b'TKGLVLGIYSKEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUCINE AMINOPEPTIDASE
publication title Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 155
structure length 481
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1993-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1bpmA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1bpmA02
3Q71A 1UWYA 2PJ1A 3H8FA 4ETKA 3BHXA 2FAVA 4JGKA 1LAMA 1PCAA 4X3RA 3B3SA 2ZENA 1DE4C 2EK9A 2ZEGA 5LYIA 2F7VA 4UEFA 4KYBA 2XEGA 1TY8A 1XFOA 4O23A 1VHUA 1TXZA 2NYQA 2C6CA 3B7IA 1R3NA 4FAIA 4H2KA 4OC3A 5JM6A 1BPNA 1IY7A 3IWWA 4NJQA 3JZTA 5LRGA 2JBKA 1YW6A 3GLJA 4NGSA 4ZYQA 2QJ8A 2PJCA 3PRTA 3T8WA 4K3NA 3FVLA 2O53A 4YWYA 2PJ9A 5DUSA 1BAVA 1ZLHA 2GLJA 3FJUA 2JEWA 5HVGA 2IMOA 2ZEOA 3ETIA 1IGBA 2ABZA 1AYEA 2NSMA 3TC8A 2ZOFA 2OR4A 2C6GA 1AMPA 3EW5A 3WC7A 4NGNA 3KHXA 1VGYA 1QMUA 2WYRA 1DTDA 2AFMA 3D67A 3MRUA 3GPGA 2AFSA 3KZWA 3SJEA 5FSZA 3RBUA 3IFEA 2Q4ZA 2GLFA 4P45A 4J5SA 5K8NA 4ABLA 2PJ0A 4WWVA 4JYWA 3BI1A 1SPVA 2AFWA 4A38A 5AILA 3SJGA 3WABA 1LCPA 1CG2A 2PJ7A 2PJ3A 1F2PA 5LYLA 3QNVA 4P4IA 4NGMA 1Z5RA 2QVPA 4W9YA 1ZG8A 4B6ZA 2G9DA 2Q51A 5IB9A 3RZAA 2BFRA 1ARLA 5D29A 3IJ3A 4NGRA 4NJRA 4NGPA 3KQXA 3NH8A 4ESSA 2ZEPA 4MMOA 2HB6A 2PIZA 3GUXA 4ZY2A 2PJ4A 1TKJA 2GREA 4DJLA 3D66A 4OP4A 4R76A 2BCOA 2XEFA 3PBEA 2AFXA 3S9MA 4X8IA 4P4JA 1FNOA 1Z8LA 3EJGA 3H8GA 3KGQA 3NA6A 3HLPA 2BFQA 4ZI6A 2V8GA 1Y0YA 4EMEA 1EE3P 4P4EA 2V8HA 2PVVA 3S9NA 4ZX9A 1YW4A 4OMEA 4IQYA 4Q7AA 3PB4X 3SJFA 4R7MA 4EWTA 4J5QA 1FT7A 2EK8A 3SJXA 5I4MA 4PQAA 2EWBA 5K8OA 4ETJA 3V2BA 3FECA 4RUHA 2PJ5A 4UEEA 1OBRA 3FF3A 4MRIA 2AFCA 1BPMA 1CPSA 2ZEFA 2EEEA 4DYOA 2F8HA 4JCAA 3FEEA 4FBEA 2C6PA 3V45A 5LYDA 4GVWA 1LANA 3CT9A 2BOAA 3GB0A 1YLOA 2IQ6A 4TWEA 5HOLA 3RAMA 3PEIA 1VIXA 4J5RA 3B35A 5FSYA 7CPAA 1Z2LA 3LMSA 3KL9A 4WJBA 5LRJA 3HUVA 4Z65A 4TU0A 4P4DA 4BD9A 4PPZA 2FG1A 1VHOA 1TKHA 4MHNA 3IIDA 5CBMA 4OIDA 4X2TA 1YSJA 3GPQA 2PJ8A 1JQGA 3PFOA 3KASA 3WC5A 3EWPA 4IHMA 3DGVA 4UEZA 3D7HA 3PB6X 3PB8X 3PB7X 3FX6A 1ZG7A 3SIJA 2PJAA 1ZR3A 4OIWA 2ZELA 4MHYA 3VH9A 2PJBA 4MCSA 2PVWA 1TXRA 2JBJA 4P4BA 4PXDA 2ZEHA 3IC1A 4FUUA 1LOKA 4J4ZA 3NH4A 4UMLA 2V8DA 3V38A 3GPOA 4ZX8A 4OC4A 5ELYA 5HVFA 4UIBA 1HDQA 3B3VA 3IIFA 3KR5A 3L2NA 3K2KA 3D7DA 4UIAA 4CPAA 1CPXA 4R6TA 2AFZA 1YD9A 4FWUA 3SIHA 4YU9A 1XBUA 3MN8A 2BO9A 3PB9X 3V7ZA 4EFDA 1ELLP 2RB7A 2I3CA 2WZNA 1YMEA 2PJ2A 2CIJA 2POKA 4JZ0A 3B3CA 1H8LA 4PXBA 5FSUA 1TF8A 1Y0RA 2OOTA 5F09A 2VRIA 4OC5A 3IEHA 4P10A 1ARMA 1CP7A 2V77A 5DS0A 3EKEA 3PFEA 2GU2A 3D4UA 4OC0A 3N5FA 4MHPA 2IJZA 2PIYA 2XEIA 2FXKA 3H8EA 3SI1A 3I1UA 4G1PA 3BXMA 2J9AA 1CBXA 1LFWA 5FSVA 3VARA 4UF4A 1BLLE 1XJOA 1TF9A 6CPAA 4MCPA 5E3BA 3ISXA 5THWA 2ZEEA 1F57A 1CP6A 1TKFA 4LQGA 1R43A 3DLJA 2CF4A 3SI2A 5D8NA 1M4LA 5FSXA 3EWQA 3D7FA 2X47A 3EWOA 2HC9A 5K8MA 2L8RA 5CMSA 1ELMP 3KHZA 4NGQA 5JH9A 3FH4A 4ONWA 2AFUA 3S9LA 3EJFA 2CTBA 1XMBA 4PXEA 2QYVA 1HEEA 1VHEA 3KI9A 4MCQA 3VATA 4DUKA 2RFHA 4OC2A 1XRYA 4R8FA 2CTCA 2ACFA 3SIIA 3D7GA 4F9UA 1NSAA 3FMCA 4A94A 4IK2A 5HVHA 4GUAA 3CPXA 3NH5A 4OKOA 5J1QA 5HIHA 4PXCA 4P6YA 2AFOA 4F8ZA 4ZY0A 2PE3A 3ISZA 5CB3A 3B2YA 3SIGA 3K9TA 3D68A 4OC1A 2ANPA 4MHZA 4KSIA 4P44A 1HJZA 4TNUA 2LGRA 5HXDA 8CPAA 2XEJA 2DEAA 1F2OA 2PRQA 4JVVA 2PJ6A 1Y7EA 2V8VA 1ZG9A 4GVVA 4GM5A 4MXUA 4NGTA 1ZR5A 2ZOGA 3PBBA 3TX8A 4F9VA 3Q6ZA 4AXVA 2VL1A 5LYFA 3B3TA 4ZY1A 2FVGA 3NFZA 2XD7A 4A39A 1HDUA 1Q7LA 3WT4A 4A37A 3CPAA 5K8PA 4NFRA 4K0CA 2ZEMA 5CPAA 1RTQA 3BI0A 1NJRA 1ZLIA 2C1CA 3JRUA 5CB5A 3VFQA 5JGFA 1LAPA 3KQZA 2ZEDA 3B3WA 4D86A 1PYTB 1GYTA 3GQEA 4MCRA 5LRKA 3KR4A 2PCUA 2DX6A 3GQOA 3CDXA 1KWMA 3FEDA 3EWRA 1CX8A 1QQ9A 2O4HA 3IO1A 4P4FA 4ABKA 4IAVA 3SI0A 2Q43A 3WC6A 3IIBA 4JLLA 3LWUA
chains in the Genus database with same CATH superfamily
3Q71A 4AVAA 3QAYA 4MJ8A 4YFJA 4AVCA 1UWYA 3DNSA 2PJ1A 3H8FA 4ETKA 4Y49B 2BUEA 1WK4A 3BHXA 4KLVA 2FAVA 4KSFA 1Q2CA 2OZUA 4JGKA 1LAMA 1PCAA 1IOIA 2K5TA 4X3RA 3SXNA 3B3SA 3FYNA 2P6EA 2F5IA 2ZENA 5A28A 1DE4C 5G22A 4CGNA 2EK9A 2ZEGA 4LX9A 3JUWA 4PV6A 3FBUA 5LYIA 4MFJA 1I1DA 2F7VA 4U9ZA 4KYBA 4UEFA 4UFXA 2XEGA 1TY8A 1LRZA 4M6IA 3SXOA 3TO7A 1XEBA 1XFOA 1AUGA 4NF1A 4O23A 1VHUA 1V0CA 4PK3A 5IX3A 1TXZA 4CGPA 4A2ZA 2NYQA 3NE8A 2C6CA 5G21A 3GYAA 2RC4A 3B7IA 1R3NA 2FL4A 2VEZA 2YNCC 3CXQA 3LODA 4H2KA 1BPNA 1IY7A 2B5GB 3G3SA 3JZTA 3IWWA 2A4NA 3P2FA 4NJQA 1GHEA 5LRGA 1Q2YA 2JBKA 1YW6A 3GLJA 1S7FA 4NGSA 4ZYQA 2QJ8A 3EXNA 2PJCA 3PRTA 3T8WA 4K3NA 3FVLA 2FT0A 2O53A 2Z3OA 2Q7SA 1QSTA 4YWYA 3TCVA 3TOAA 4XPDB 4OADA 2PJ9A 5DUSA 2CNTA 1BAVA 2Z3MA 1ZLHA 2Z3PA 1P4NA 2GLJA 3FJUA 4KOVA 4CAFA 4R87A 2JEWA 5HVGA 2PC1A 2IMOA 2ZEOA 4QC6A 4RS2A 3ETIA 4E0AA 1Z9UA 1IGBA 5KTAA 2ZXVA 4A32A 1YVOA 2ABZA 1AYEA 2NSMA 3TC8A 2ZOFA 5AG7A 2OR4A 3QB8A 4CGOA 4BBHA 2C6GA 1AMPA 1M1DA 1TIQA 3EW5A 3WC7A 4FD6A 4KOWA 4NGNA 3KHXA 1XF8A 4XNHC 5GCNA 5H86A 1VGYA 1QMUA 2WYRA 1DTDA 2AFMA 2H5MA 3D67A 3IU1A 1WWZA 2Q4YA 3MRUA 1KUVA 4A33A 3GPGA 2AFSA 4LQ6A 3KZWA 1P0HA 2EBJA 4H6UA 5EMIA 5FSZA 3RBUA 3SJEA 3E0KA 1I12A 2VZZA 1L0CA 3IFEA 2Q4ZA 2GLFA 1IYKA 4J5SA 4P45A 5K8NA 3D2PA 4ABLA 2Z3KA 2GANA 2PJ0A 4WWVA 4JYWA 2FSRA 3BI1A 1SPVA 2QIRA 1UFHA 2AFWA 4MFPA 4XNHB 5AILA 3SJGA 3WABA 4A38A 1LCPA 1CG2A 2B3UA 2PJ7A 2PJ3A 1F2PA 2REEA 4OC3A 5LYLA 3QNVA 4P4IA 4NGMA 4GS4A 4HNYB 4H89A 1Z5RA 3R9FA 3TOBA 3TTHA 4CGLA 2QVPA 4W9YA 3PZJA 3W6XA 1ZG8A 4B5PA 3IGRA 4A31A 4MY0A 4B6ZA 2G9DA 4FD7A 2Q51A 4FD4A 2ZW7A 3RO0A 2YNEA 4CYQA 3RZAA 2BFRA 5IB9A 4MY3A 1ARLA 2P6FA 5D29A 1M4DA 3S6HA 3IJ3A 1S7KA 4NJRA 4NGRA 2HUZA 5EC4A 4NGPA 3KQXA 3NH8A 4ESSA 2ZEPA 4MMOA 3SHPA 2FE7A 2KQVA 2HB6A 2PIZA 3GUXA 4B12A 4H6ZA 4ZY2A 2G3TA 2PJ4A 4CAXA 4F0YA 1TKJA 5JQ4A 1Z8XA 2GREA 2B5GA 1S60A 4DJLA 1MJBA 2PR1A 3D66A 4OP4A 4R76A 4KOXA 4UWIA 3R9EA 3TT2A 2BCOA 3DR6A 1NE9A 1MK4A 2XEFA 2FIAA 2VZYA 3PBEA 4EMEA 2WPWA 2AFXA 3R1KA 4JD6A 3S9MA 4B10A 4X8IA 2J8MA 3C26A 1Q2DA 4P4JA 3H4QA 4R3KA 2IL4A 1X12A 4NCZA 1FNOA 4CRYB 1X10A 1Z8LA 3EJGA 2YNCA 3D3SA 1YGHA 3H8GA 3KGQA 3NA6A 3HLPA 2BFQA 4JXRA 4ZI6A 2YNDA 5KTCA 4IUSA 3TO6A 2V8GA 3F0AA 1Y0YA 4MFKA 1EE3P 2FCKA 3DDDA 4KUAA 2V8HA 2PVVA 4P4EA 4UA3A 2Q7BA 2BSWA 3S9NA 3H5ZA 2CY2A 3WR7A 1Y9WA 2WCTA 4ZX9A 1YW4A 2EO8A 2O28A 4OMEA 2ATRA 4C7HA 3N7ZA 5F47A 4IQYA 4Q7AA 2VBQA 4FD5A 3PB4X 4CYOA 1KUYA 5IB0A 4CYNA 3SJFA 4R7MA 4EWTA 4J5QA 1IOFA 1S7LA 1FT7A 2EK8A 4XPDC 3SJXA 2FS5A 5AG5A 5I4MA 4PQAA 2EWBA 5K8OA 3P2HA 4ETJA 2FIWA 2OH1A 2PDOA 3V2BA 4KVME 1YLEA 4HPSA 3FECA 1SQHA 4RUHA 2PJ5A 4UEEA 5ISVA 2VQYA 1Z4RA 4M3SA 1OBRA 2Q0YA 3FNCA 3FF3A 4KVOE 3VWDA 4MRIA 4YGOA 2AFCA 1BPMA 1CPSA 3BJ8A 2ZEFA 1XE4A 4CRZB 1Y7RA 2EEEA 4DYOA 4FAIA 3VWEA 2F8HA 4JCAA 3FEEA 4FBEA 2C6PA 2PR8A 2ZPAA 3V45A 3EY5A 5LYDA 5AG4A 1XMTA 4GVWA 1ZO0A 1LANA 1NSLA 3GKRA 3CT9A 2BOAA 3GB0A 1YLOA 2IQ6A 4TWEA 5F48A 5HOLA 4UCNA 3RAMA 3PEIA 1VIXA 4J5RA 4JJXA 2EVNA 2J8NA 2QECA 3B35A 5FSYA 4R9MA 7CPAA 1Z2LA 4AG9A 2OZHA 3LMSA 3KL9A 3B8GA 4ONUA 4WJBA 3FIXA 5LRJA 3HUVA 4Z65A 4TU0A 1IYLA 1IB1E 2J8RA 3DSBA 4P4DA 4ZBGA 4BD9A 4QBJA 4CGMA 4I49A 1QSRA 2WSAA 4PPZA 5C82A 2BEIA 2JZFA 3BJ7A 3EC4A 2FG1A 4R57A 5BWAB 1VHOA 1TKHA 4MHNA 2D4PA 1J4JA 4HKFA 1BOBA 4U5YA 3IIDA 1CM0A 5CBMA 4OIDA 4X2TA 1YSJA 4KZTA 3GPQA 4KS9A 4AG7A 1PU9A 1VHSA 2PJ8A 1JQGA 1MJAA 1PUAA 3PFOA 3KASA 4KOTA 3WC5A 2Q04A 3EWPA 1Z8WA 4IHMA 1QSMA 1BO4A 3DGVA 2Q44A 4UEZA 1QSOA 4U9YA 3D7HA 3PB6X 3S6GA 4KVXA 4UCPA 3PB8X 1Y9KA 2P6GA 2B4BA 5DWMA 3PB7X 2Y0MA 3FX6A 4L8AA 4QUSA 2AJ6A 1ZG7A 3SIJA 2PJAA 5KTDA 1ZR3A 4OIWA 2ZELA 4MHYA 3VH9A 1YREA 4IF5A 2PJBA 2VI7A 3K9UA 2KCWA 1XIXA 4MCSA 1S7NA 2B58A 5AG6A 4L89A 2PVWA 3EFAA 1TXRA 4F0XA 4RN7A 4A30A 2JBJA 4P4BA 2WPXA 4PXDA 4CAWA 1QSNA 2JEVA 2QMLA 2ZEHA 1B87A 3IC1A 4FUUA 1LOKA 5E96A 4J4ZA 3D2MA 2PQ8A 3NH4A 4A95A 2AE6A 4MI4A 1S3ZA 4UMLA 2V8DA 3OWCA 3V38A 3GPOA 3I9SA 4ZX8A 4OC4A 5ELYA 4UCMA 5HVFA 3LD2A 1Z8TA 4MBUA 4UIBA 1HDQA 2DPSA 3B3VA 3IIFA 3KR5A 3L2NA 3K2KA 4PK2A 5IV0A 3D7DA 4UIAA 4CPAA 1CPXA 4R6TA 2AFZA 1YD9A 4FWUA 3BLNA 3V8IA 2D4OA 3CXSA 3SIHA 2GFQA 3FB3A 1XBUA 3MN8A 4YU9A 2BO9A 2REFA 3PB9X 5HMNA 2DXQA 3V7ZA 4EFDA 1ELLP 2ZW6A 2RB7A 4KOUA 4KLWA 4EVYA 1JWQA 2I3CA 4UWJA 2WZNA 2EUIA 3D8PA 4PSXA 5H84A 1YMEA 2PJ2A 2CIJA 2HQYA 1KUXA 5FVJA 2POKA 4E8OA 2OU2A 3F5BA 5A27A 2JZDA 3W6SA 4NEXA 4JZ0A 3B3CA 1H8LA 4PXBA 2ODFA 5FSUA 1TF8A 1Y0RA 4YRHA 2OOTA 3JVNA 5F09A 2VRIA 4OC5A 3IEHA 4QVTA 4P10A 2CNMA 3DR8A 4MFQA 5J8CA 1ARMA 1CP7A 3S6FA 2V77A 4PSWA 4JWPA 5DWNA 3FRMA 2RNKA 2PRBA 5DS0A 3EKEA 3PFEA 1M4IA 4NXYA 2GU2A 5F49A 3D4UA 1IICA 4OC0A 3ZZIA 4BINA 4OLLA 4UFWA 3N5FA 4MHPA 2IJZA 2Z10A 4E2AA 2FXFA 1A2ZA 2HV2A 2FXKA 3H8EA 2PIYA 2XEIA 3JTKA 3SI1A 3I1UA 3T9YA 4G1PA 1LFWA 2J9AA 1CBXA 3BXMA 4AB7A 2B4DB 5FSVA 1S5KA 4JLYA 3VARA 3PGPA 3I3GA 4B5PB 3R96A 4UF4A 1BLLE 2JDCA 1XJOA 4XPKA 1TF9A 2NMTA 4X5KA 4B13A 6CPAA 4MCPA 5E3BA 3ISXA 4Q38A 5THWA 2ZEEA 4B14A 5CNPA 4C2XA 1F57A 3S6KA 2VXKA 4UFVA 5C88A 2R8VA 1CP6A 2ZW4A 3F8KA 4KSAA 1TKFA 2X7BA 4LQGA 1R43A 3DLJA 4OAEA 2CF4A 3SI2A 5D8NA 5J8FA 1M4LA 3A9LA 2GE3A 2DF5A 4Q36A 5FSXA 3EWQA 4JXQA 3D7FA 2Z3NA 3LACA 1RXTA 2X47A 4M85A 3EWOA 5AGEA 2HC9A 4UBRA 3TO9A 2L8RA 2WUUA 5K8MA 4QB9A 5CMSA 1ELMP 3KHZA 4NGQA 5JH9A 2DPTA 3FH4A 4ONWA 2AFUA 3S9LA 3EJFA 1N71A 2CTBA 1XMBA 1YQEA 4PXEA 3R95A 1Z4EA 2QYVA 3CXPA 1HEEA 1VHEA 2G3AA 3KI9A 4MCQA 3VATA 4M6GA 4DUKA 2RFHA 4RI1A 4OC2A 1XRYA 3R9GA 4LUAA 2CTCA 4R8FA 4C68A 2CXAA 4C2YA 2ACFA 4C7IA 1FY7A 3SIIA 4CAVA 1K4JA 3D7GA 4MHDA 3IWGA 3CZXA 2I00A 2OZGA 1NSAA 3FMCA 2I79A 4F9UA 4MFLA 3T90A 4BMHA 2C27A 4A94A 4IK2A 5HVHA 1KZFA 4GUAA 5F46A 3CPXA 3NH5A 4OKOA 5J1QA 5I0CA 5HIHA 2BL1A 4PXCA 2Z0ZA 4P6YA 4R3LA 4C2ZA 5JPHA 2AFOA 3KKWA 1IU8A 3W91A 4F8ZA 4KUBA 4ZY0A 2PE3A 4KOYA 2W2GA 3ISZA 5CB3A 2R98A 3B2YA 1MJ9A 2Z11A 4XPLA 3SIGA 3K9TA 1YVKA 2YGWA 3D68A 4OC1A 4KOSA 3RYOA 4B11A 1M44A 1NMTA 2ANPA 1M4GA 4MHZA 4KSIA 4P44A 1HJZA 5JM6A 2R1IA 4CAEA 4TNUA 2LGRA 3MGDA 1B6BA 5HXDA 3TFYA 8CPAA 2XEJA 5HH1A 3ZJ0A 2DEAA 1F2OA 1XOVA 4JVVA 2PRQA 4J3GA 4CYPA 1U6MA 2PJ6A 1Y7EA 2V8VA 4F6AA 1IIDA 1ZG9A 2P0WA 3PP9A 4GVVA 4GM5A 4MXUA 4NGTA 1ZR5A 4GXHA 1VKCA 2ZOGA 2JZEA 3PBBA 4KORA 3TX8A 4F9VA 4HNWB 1YX0A 2B4DA 3Q6ZA 2CNSA 2VL1A 3NE7A 3IWEA 1YR0A 4AXVA 5LYFA 4AVBA 4II9A 3B3TA 5EBVA 4ZY1A 5G20A 2FVGA 3NFZA 2XD7A 3GIUA 4K30A 4A39A 1HDUA 1Q7LA 3WT4A 4A37A 3CPAA 3RNZA 1R57A 2Q4VA 1I21A 5K8PA 3EO4A 4NFRA 2ARHA 2Z3LA 2ZW5A 4K0CA 2ZEMA 5CPAA 2GIVA 4CS0B 1RTQA 3BI0A 2PSWA 1NJRA 1ZLIA 2C1CA 3JRUA 5CB5A 2JDDA 3TE4A 3VFQA 2OB0A 2R7HA 3QAHA 3UY5A 4ZGYB 1RO5A 1YK3A 5JGFA 1LAPA 3KQZA 2ZEDA 3B3WA 4B5OA 4DNCA 2G0BA 4D86A 4Y49C 1PYTB 1GYTA 3GQEA 4ORFA 4MCRA 5G1ZA 3GY9A 5LRKA 3KR4A 2PCUA 3G8WA 3IU2A 4HNXB 2DX6A 2B3VA 3GQOA 3CDXA 1CJWA 1KWMA 3FEDA 3EWRA 1CX8A 1QQ9A 2O4HA 3IO1A 4NSQA 4P4FA 4ABKA 4MFZA 4IAVA 3SI0A 3FXTA 4M6HA 2Q43A 1ON0A 1OZPA 3IIBA 4JLLA 3WC6A 3LWUA 2JLMA
chains in the Genus database with same CATH topology
3Q71A 1UWYA 2PJ1A 3H8FA 4ETKA 3BHXA 2FAVA 4JGKA 1LAMA 1PCAA 4X3RA 3B3SA 2ZENA 1DE4C 2EK9A 2ZEGA 5LYIA 2F7VA 4UEFA 4KYBA 2XEGA 1TY8A 1XFOA 4O23A 1VHUA 1TXZA 2NYQA 2C6CA 3B7IA 1R3NA 4FAIA 4H2KA 4OC3A 5JM6A 1BPNA 1IY7A 3IWWA 4NJQA 3JZTA 5LRGA 2JBKA 1YW6A 3GLJA 4NGSA 4ZYQA 2QJ8A 2PJCA 3PRTA 3T8WA 4K3NA 3FVLA 2O53A 4YWYA 2PJ9A 5DUSA 1BAVA 1ZLHA 2GLJA 3FJUA 2JEWA 5HVGA 2IMOA 2ZEOA 3ETIA 1IGBA 2ABZA 1AYEA 2NSMA 3TC8A 2ZOFA 2OR4A 2C6GA 1AMPA 3EW5A 3WC7A 4NGNA 3KHXA 1VGYA 1QMUA 2WYRA 1DTDA 2AFMA 3D67A 3MRUA 3GPGA 2AFSA 3KZWA 3SJEA 5FSZA 3RBUA 3IFEA 2Q4ZA 2GLFA 4P45A 4J5SA 5K8NA 4ABLA 2PJ0A 4WWVA 4JYWA 3BI1A 1SPVA 2AFWA 4A38A 5AILA 3SJGA 3WABA 1LCPA 1CG2A 2PJ7A 2PJ3A 1F2PA 5LYLA 3QNVA 4P4IA 4NGMA 1Z5RA 2QVPA 4W9YA 1ZG8A 4B6ZA 2G9DA 2Q51A 5IB9A 3RZAA 2BFRA 1ARLA 5D29A 3IJ3A 4NGRA 4NJRA 4NGPA 3KQXA 3NH8A 4ESSA 2ZEPA 4MMOA 2HB6A 2PIZA 3GUXA 4ZY2A 2PJ4A 1TKJA 2GREA 4DJLA 3D66A 4OP4A 4R76A 2BCOA 2XEFA 3PBEA 2AFXA 3S9MA 4X8IA 4P4JA 1FNOA 1Z8LA 3EJGA 3H8GA 3KGQA 3NA6A 3HLPA 2BFQA 4ZI6A 2V8GA 1Y0YA 4EMEA 1EE3P 4P4EA 2V8HA 2PVVA 3S9NA 4ZX9A 1YW4A 4OMEA 4IQYA 4Q7AA 3PB4X 3SJFA 4R7MA 4EWTA 4J5QA 1FT7A 2EK8A 3SJXA 5I4MA 4PQAA 2EWBA 5K8OA 4ETJA 3V2BA 3FECA 4RUHA 2PJ5A 4UEEA 1OBRA 3FF3A 4MRIA 2AFCA 1BPMA 1CPSA 2ZEFA 2EEEA 4DYOA 2F8HA 4JCAA 3FEEA 4FBEA 2C6PA 3V45A 5LYDA 4GVWA 1LANA 3CT9A 2BOAA 3GB0A 1YLOA 2IQ6A 4TWEA 5HOLA 3RAMA 3PEIA 1VIXA 4J5RA 3B35A 5FSYA 7CPAA 1Z2LA 3LMSA 3KL9A 4WJBA 5LRJA 3HUVA 4Z65A 4TU0A 4P4DA 4BD9A 4PPZA 2FG1A 1VHOA 1TKHA 4MHNA 3IIDA 5CBMA 4OIDA 4X2TA 1YSJA 3GPQA 2PJ8A 1JQGA 3PFOA 3KASA 3WC5A 3EWPA 4IHMA 3DGVA 4UEZA 3D7HA 3PB6X 3PB8X 3PB7X 3FX6A 1ZG7A 3SIJA 2PJAA 1ZR3A 4OIWA 2ZELA 4MHYA 3VH9A 2PJBA 4MCSA 2PVWA 1TXRA 2JBJA 4P4BA 4PXDA 2ZEHA 3IC1A 4FUUA 1LOKA 4J4ZA 3NH4A 4UMLA 2V8DA 3V38A 3GPOA 4ZX8A 4OC4A 5ELYA 5HVFA 4UIBA 1HDQA 3B3VA 3IIFA 3KR5A 3L2NA 3K2KA 3D7DA 4UIAA 4CPAA 1CPXA 4R6TA 2AFZA 1YD9A 4FWUA 3SIHA 4YU9A 1XBUA 3MN8A 2BO9A 3PB9X 3V7ZA 4EFDA 1ELLP 2RB7A 2I3CA 2WZNA 1YMEA 2PJ2A 2CIJA 2POKA 4JZ0A 3B3CA 1H8LA 4PXBA 5FSUA 1TF8A 1Y0RA 2OOTA 5F09A 2VRIA 4OC5A 3IEHA 4P10A 1ARMA 1CP7A 2V77A 5DS0A 3EKEA 3PFEA 2GU2A 3D4UA 4OC0A 3N5FA 4MHPA 2IJZA 2PIYA 2XEIA 2FXKA 3H8EA 3SI1A 3I1UA 4G1PA 3BXMA 2J9AA 1CBXA 1LFWA 5FSVA 3VARA 4UF4A 1BLLE 1XJOA 1TF9A 6CPAA 4MCPA 5E3BA 3ISXA 5THWA 2ZEEA 1F57A 1CP6A 1TKFA 4LQGA 1R43A 3DLJA 2CF4A 3SI2A 5D8NA 1M4LA 5FSXA 3EWQA 3D7FA 2X47A 3EWOA 2HC9A 5K8MA 2L8RA 5CMSA 1ELMP 3KHZA 4NGQA 5JH9A 3FH4A 4ONWA 2AFUA 3S9LA 3EJFA 2CTBA 1XMBA 4PXEA 2QYVA 1HEEA 1VHEA 3KI9A 4MCQA 3VATA 4DUKA 2RFHA 4OC2A 1XRYA 4R8FA 2CTCA 2ACFA 3SIIA 3D7GA 4F9UA 1NSAA 3FMCA 4A94A 4IK2A 5HVHA 4GUAA 3CPXA 3NH5A 4OKOA 5J1QA 5HIHA 4PXCA 4P6YA 2AFOA 4F8ZA 4ZY0A 2PE3A 3ISZA 5CB3A 3B2YA 3SIGA 3K9TA 3D68A 4OC1A 2ANPA 4MHZA 4KSIA 4P44A 1HJZA 4TNUA 2LGRA 5HXDA 8CPAA 2XEJA 2DEAA 1F2OA 2PRQA 4JVVA 2PJ6A 1Y7EA 2V8VA 1ZG9A 4GVVA 4GM5A 4MXUA 4NGTA 1ZR5A 2ZOGA 3PBBA 3TX8A 4F9VA 3Q6ZA 4AXVA 2VL1A 5LYFA 3B3TA 4ZY1A 2FVGA 3NFZA 2XD7A 4A39A 1HDUA 1Q7LA 3WT4A 4A37A 3CPAA 5K8PA 4NFRA 4K0CA 2ZEMA 5CPAA 1RTQA 3BI0A 1NJRA 1ZLIA 2C1CA 3JRUA 5CB5A 3VFQA 5JGFA 1LAPA 3KQZA 2ZEDA 3B3WA 4D86A 1PYTB 1GYTA 3GQEA 4MCRA 5LRKA 3KR4A 2PCUA 2DX6A 3GQOA 3CDXA 1KWMA 3FEDA 3EWRA 1CX8A 1QQ9A 2O4HA 3IO1A 4P4FA 4ABKA 4IAVA 3SI0A 2Q43A 3WC6A 3IIBA 4JLLA 3LWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q71 A;  1UWY A;  2PJ1 A;  3H8F A;  4ETK A;  3BHX A;  2FAV A;  4JGK A;  1LAM A;  1PCA A;  4X3R A;  3B3S A;  2ZEN A;  1DE4 C;  2EK9 A;  2ZEG A;  5LYI A;  2F7V A;  4UEF A;  4KYB A;  2XEG A;  1TY8 A;  1XFO A;  4O23 A;  1VHU A;  1TXZ A;  2NYQ A;  2C6C A;  3B7I A;  1R3N A;  4FAI A;  4H2K A;  4OC3 A;  5JM6 A;  1BPN A;  1IY7 A;  3IWW A;  4NJQ A;  3JZT A;  5LRG A;  2JBK A;  1YW6 A;  3GLJ A;  4NGS A;  4ZYQ A;  2QJ8 A;  2PJC A;  3PRT A;  3T8W A;  4K3N A;  3FVL A;  2O53 A;  4YWY A;  2PJ9 A;  5DUS A;  1BAV A;  1ZLH A;  2GLJ A;  3FJU A;  2JEW A;  5HVG A;  2IMO A;  2ZEO A;  3ETI A;  1IGB A;  2ABZ A;  1AYE A;  2NSM A;  3TC8 A;  2ZOF A;  2OR4 A;  2C6G A;  1AMP A;  3EW5 A;  3WC7 A;  4NGN A;  3KHX A;  1VGY A;  1QMU A;  2WYR A;  1DTD A;  2AFM A;  3D67 A;  3MRU A;  3GPG A;  2AFS A;  3KZW A;  3SJE A;  5FSZ A;  3RBU A;  3IFE A;  2Q4Z A;  2GLF A;  4P45 A;  4J5S A;  5K8N A;  4ABL A;  2PJ0 A;  4WWV A;  4JYW A;  3BI1 A;  1SPV A;  2AFW A;  4A38 A;  5AIL A;  3SJG A;  3WAB A;  1LCP A;  1CG2 A;  2PJ7 A;  2PJ3 A;  1F2P A;  5LYL A;  3QNV A;  4P4I A;  4NGM A;  1Z5R A;  2QVP A;  4W9Y A;  1ZG8 A;  4B6Z A;  2G9D A;  2Q51 A;  5IB9 A;  3RZA A;  2BFR A;  1ARL A;  5D29 A;  3IJ3 A;  4NGR A;  4NJR A;  4NGP A;  3KQX A;  3NH8 A;  4ESS A;  2ZEP A;  4MMO A;  2HB6 A;  2PIZ A;  3GUX A;  4ZY2 A;  2PJ4 A;  1TKJ A;  2GRE A;  4DJL A;  3D66 A;  4OP4 A;  4R76 A;  2BCO A;  2XEF A;  3PBE A;  2AFX A;  3S9M A;  4X8I A;  4P4J A;  1FNO A;  1Z8L A;  3EJG A;  3H8G A;  3KGQ A;  3NA6 A;  3HLP A;  2BFQ A;  4ZI6 A;  2V8G A;  1Y0Y A;  4EME A;  1EE3 P;  4P4E A;  2V8H A;  2PVV A;  3S9N A;  4ZX9 A;  1YW4 A;  4OME A;  4IQY A;  4Q7A A;  3PB4 X;  3SJF A;  4R7M A;  4EWT A;  4J5Q A;  1FT7 A;  2EK8 A;  3SJX A;  5I4M A;  4PQA A;  2EWB A;  5K8O A;  4ETJ A;  3V2B A;  3FEC A;  4RUH A;  2PJ5 A;  4UEE A;  1OBR A;  3FF3 A;  4MRI A;  2AFC A;  1BPM A;  1CPS A;  2ZEF A;  2EEE A;  4DYO A;  2F8H A;  4JCA A;  3FEE A;  4FBE A;  2C6P A;  3V45 A;  5LYD A;  4GVW A;  1LAN A;  3CT9 A;  2BOA A;  3GB0 A;  1YLO A;  2IQ6 A;  4TWE A;  5HOL A;  3RAM A;  3PEI A;  1VIX A;  4J5R A;  3B35 A;  5FSY A;  7CPA A;  1Z2L A;  3LMS A;  3KL9 A;  4WJB A;  5LRJ A;  3HUV A;  4Z65 A;  4TU0 A;  4P4D A;  4BD9 A;  4PPZ A;  2FG1 A;  1VHO A;  1TKH A;  4MHN A;  3IID A;  5CBM A;  4OID A;  4X2T A;  1YSJ A;  3GPQ A;  2PJ8 A;  1JQG A;  3PFO A;  3KAS A;  3WC5 A;  3EWP A;  4IHM A;  3DGV A;  4UEZ A;  3D7H A;  3PB6 X;  3PB8 X;  3PB7 X;  3FX6 A;  1ZG7 A;  3SIJ A;  2PJA A;  1ZR3 A;  4OIW A;  2ZEL A;  4MHY A;  3VH9 A;  2PJB A;  4MCS A;  2PVW A;  1TXR A;  2JBJ A;  4P4B A;  4PXD A;  2ZEH A;  3IC1 A;  4FUU A;  1LOK A;  4J4Z A;  3NH4 A;  4UML A;  2V8D A;  3V38 A;  3GPO A;  4ZX8 A;  4OC4 A;  5ELY A;  5HVF A;  4UIB A;  1HDQ A;  3B3V A;  3IIF A;  3KR5 A;  3L2N A;  3K2K A;  3D7D A;  4UIA A;  4CPA A;  1CPX A;  4R6T A;  2AFZ A;  1YD9 A;  4FWU A;  3SIH A;  4YU9 A;  1XBU A;  3MN8 A;  2BO9 A;  3PB9 X;  3V7Z A;  4EFD A;  1ELL P;  2RB7 A;  2I3C A;  2WZN A;  1YME A;  2PJ2 A;  2CIJ A;  2POK A;  4JZ0 A;  3B3C A;  1H8L A;  4PXB A;  5FSU A;  1TF8 A;  1Y0R A;  2OOT A;  5F09 A;  2VRI A;  4OC5 A;  3IEH A;  4P10 A;  1ARM A;  1CP7 A;  2V77 A;  5DS0 A;  3EKE A;  3PFE A;  2GU2 A;  3D4U A;  4OC0 A;  3N5F A;  4MHP A;  2IJZ A;  2PIY A;  2XEI A;  2FXK A;  3H8E A;  3SI1 A;  3I1U A;  4G1P A;  3BXM A;  2J9A A;  1CBX A;  1LFW A;  5FSV A;  3VAR A;  4UF4 A;  1BLL E;  1XJO A;  1TF9 A;  6CPA A;  4MCP A;  5E3B A;  3ISX A;  5THW A;  2ZEE A;  1F57 A;  1CP6 A;  1TKF A;  4LQG A;  1R43 A;  3DLJ A;  2CF4 A;  3SI2 A;  5D8N A;  1M4L A;  5FSX A;  3EWQ A;  3D7F A;  2X47 A;  3EWO A;  2HC9 A;  5K8M A;  2L8R A;  5CMS A;  1ELM P;  3KHZ A;  4NGQ A;  5JH9 A;  3FH4 A;  4ONW A;  2AFU A;  3S9L A;  3EJF A;  2CTB A;  1XMB A;  4PXE A;  2QYV A;  1HEE A;  1VHE A;  3KI9 A;  4MCQ A;  3VAT A;  4DUK A;  2RFH A;  4OC2 A;  1XRY A;  4R8F A;  2CTC A;  2ACF A;  3SII A;  3D7G A;  4F9U A;  1NSA A;  3FMC A;  4A94 A;  4IK2 A;  5HVH A;  4GUA A;  3CPX A;  3NH5 A;  4OKO A;  5J1Q A;  5HIH A;  4PXC A;  4P6Y A;  2AFO A;  4F8Z A;  4ZY0 A;  2PE3 A;  3ISZ A;  5CB3 A;  3B2Y A;  3SIG A;  3K9T A;  3D68 A;  4OC1 A;  2ANP A;  4MHZ A;  4KSI A;  4P44 A;  1HJZ A;  4TNU A;  2LGR A;  5HXD A;  8CPA A;  2XEJ A;  2DEA A;  1F2O A;  2PRQ A;  4JVV A;  2PJ6 A;  1Y7E A;  2V8V A;  1ZG9 A;  4GVV A;  4GM5 A;  4MXU A;  4NGT A;  1ZR5 A;  2ZOG A;  3PBB A;  3TX8 A;  4F9V A;  3Q6Z A;  4AXV A;  2VL1 A;  5LYF A;  3B3T A;  4ZY1 A;  2FVG A;  3NFZ A;  2XD7 A;  4A39 A;  1HDU A;  1Q7L A;  3WT4 A;  4A37 A;  3CPA A;  5K8P A;  4NFR A;  4K0C A;  2ZEM A;  5CPA A;  1RTQ A;  3BI0 A;  1NJR A;  1ZLI A;  2C1C A;  3JRU A;  5CB5 A;  3VFQ A;  5JGF A;  1LAP A;  3KQZ A;  2ZED A;  3B3W A;  4D86 A;  1PYT B;  1GYT A;  3GQE A;  4MCR A;  5LRK A;  3KR4 A;  2PCU A;  2DX6 A;  3GQO A;  3CDX A;  1KWM A;  3FED A;  3EWR A;  1CX8 A;  1QQ9 A;  2O4H A;  3IO1 A;  4P4F A;  4ABK A;  4IAV A;  3SI0 A;  2Q43 A;  3WC6 A;  3IIB A;  4JLL A;  3LWU A; 
#chains in the Genus database with same CATH topology
 3Q71 A;  4AVA A;  3QAY A;  4MJ8 A;  4YFJ A;  4AVC A;  1UWY A;  3DNS A;  2PJ1 A;  3H8F A;  4ETK A;  4Y49 B;  2BUE A;  1WK4 A;  3BHX A;  4KLV A;  2FAV A;  4KSF A;  1Q2C A;  2OZU A;  4JGK A;  1LAM A;  1PCA A;  1IOI A;  2K5T A;  4X3R A;  3SXN A;  3B3S A;  3FYN A;  2P6E A;  2F5I A;  2ZEN A;  5A28 A;  1DE4 C;  5G22 A;  4CGN A;  2EK9 A;  2ZEG A;  4LX9 A;  3JUW A;  4PV6 A;  3FBU A;  5LYI A;  4MFJ A;  1I1D A;  2F7V A;  4U9Z A;  4KYB A;  4UEF A;  4UFX A;  2XEG A;  1TY8 A;  1LRZ A;  4M6I A;  3SXO A;  3TO7 A;  1XEB A;  1XFO A;  1AUG A;  4NF1 A;  4O23 A;  1VHU A;  1V0C A;  4PK3 A;  5IX3 A;  1TXZ A;  4CGP A;  4A2Z A;  2NYQ A;  3NE8 A;  2C6C A;  5G21 A;  3GYA A;  2RC4 A;  3B7I A;  1R3N A;  2FL4 A;  2VEZ A;  2YNC C;  3CXQ A;  3LOD A;  4H2K A;  1BPN A;  1IY7 A;  2B5G B;  3G3S A;  3JZT A;  3IWW A;  2A4N A;  3P2F A;  4NJQ A;  1GHE A;  5LRG A;  1Q2Y A;  2JBK A;  1YW6 A;  3GLJ A;  1S7F A;  4NGS A;  4ZYQ A;  2QJ8 A;  3EXN A;  2PJC A;  3PRT A;  3T8W A;  4K3N A;  3FVL A;  2FT0 A;  2O53 A;  2Z3O A;  2Q7S A;  1QST A;  4YWY A;  3TCV A;  3TOA A;  4XPD B;  4OAD A;  2PJ9 A;  5DUS A;  2CNT A;  1BAV A;  2Z3M A;  1ZLH A;  2Z3P A;  1P4N A;  2GLJ A;  3FJU A;  4KOV A;  4CAF A;  4R87 A;  2JEW A;  5HVG A;  2PC1 A;  2IMO A;  2ZEO A;  4QC6 A;  4RS2 A;  3ETI A;  4E0A A;  1Z9U A;  1IGB A;  5KTA A;  2ZXV A;  4A32 A;  1YVO A;  2ABZ A;  1AYE A;  2NSM A;  3TC8 A;  2ZOF A;  5AG7 A;  2OR4 A;  3QB8 A;  4CGO A;  4BBH A;  2C6G A;  1AMP A;  1M1D A;  1TIQ A;  3EW5 A;  3WC7 A;  4FD6 A;  4KOW A;  4NGN A;  3KHX A;  1XF8 A;  4XNH C;  5GCN A;  5H86 A;  1VGY A;  1QMU A;  2WYR A;  1DTD A;  2AFM A;  2H5M A;  3D67 A;  3IU1 A;  1WWZ A;  2Q4Y A;  3MRU A;  1KUV A;  4A33 A;  3GPG A;  2AFS A;  4LQ6 A;  3KZW A;  1P0H A;  2EBJ A;  4H6U A;  5EMI A;  5FSZ A;  3RBU A;  3SJE A;  3E0K A;  1I12 A;  2VZZ A;  1L0C A;  3IFE A;  2Q4Z A;  2GLF A;  1IYK A;  4J5S A;  4P45 A;  5K8N A;  3D2P A;  4ABL A;  2Z3K A;  2GAN A;  2PJ0 A;  4WWV A;  4JYW A;  2FSR A;  3BI1 A;  1SPV A;  2QIR A;  1UFH A;  2AFW A;  4MFP A;  4XNH B;  5AIL A;  3SJG A;  3WAB A;  4A38 A;  1LCP A;  1CG2 A;  2B3U A;  2PJ7 A;  2PJ3 A;  1F2P A;  2REE A;  4OC3 A;  5LYL A;  3QNV A;  4P4I A;  4NGM A;  4GS4 A;  4HNY B;  4H89 A;  1Z5R A;  3R9F A;  3TOB A;  3TTH A;  4CGL A;  2QVP A;  4W9Y A;  3PZJ A;  3W6X A;  1ZG8 A;  4B5P A;  3IGR A;  4A31 A;  4MY0 A;  4B6Z A;  2G9D A;  4FD7 A;  2Q51 A;  4FD4 A;  2ZW7 A;  3RO0 A;  2YNE A;  4CYQ A;  3RZA A;  2BFR A;  5IB9 A;  4MY3 A;  1ARL A;  2P6F A;  5D29 A;  1M4D A;  3S6H A;  3IJ3 A;  1S7K A;  4NJR A;  4NGR A;  2HUZ A;  5EC4 A;  4NGP A;  3KQX A;  3NH8 A;  4ESS A;  2ZEP A;  4MMO A;  3SHP A;  2FE7 A;  2KQV A;  2HB6 A;  2PIZ A;  3GUX A;  4B12 A;  4H6Z A;  4ZY2 A;  2G3T A;  2PJ4 A;  4CAX A;  4F0Y A;  1TKJ A;  5JQ4 A;  1Z8X A;  2GRE A;  2B5G A;  1S60 A;  4DJL A;  1MJB A;  2PR1 A;  3D66 A;  4OP4 A;  4R76 A;  4KOX A;  4UWI A;  3R9E A;  3TT2 A;  2BCO A;  3DR6 A;  1NE9 A;  1MK4 A;  2XEF A;  2FIA A;  2VZY A;  3PBE A;  4EME A;  2WPW A;  2AFX A;  3R1K A;  4JD6 A;  3S9M A;  4B10 A;  4X8I A;  2J8M A;  3C26 A;  1Q2D A;  4P4J A;  3H4Q A;  4R3K A;  2IL4 A;  1X12 A;  4NCZ A;  1FNO A;  4CRY B;  1X10 A;  1Z8L A;  3EJG A;  2YNC A;  3D3S A;  1YGH A;  3H8G A;  3KGQ A;  3NA6 A;  3HLP A;  2BFQ A;  4JXR A;  4ZI6 A;  2YND A;  5KTC A;  4IUS A;  3TO6 A;  2V8G A;  3F0A A;  1Y0Y A;  4MFK A;  1EE3 P;  2FCK A;  3DDD A;  4KUA A;  2V8H A;  2PVV A;  4P4E A;  4UA3 A;  2Q7B A;  2BSW A;  3S9N A;  3H5Z A;  2CY2 A;  3WR7 A;  1Y9W A;  2WCT A;  4ZX9 A;  1YW4 A;  2EO8 A;  2O28 A;  4OME A;  2ATR A;  4C7H A;  3N7Z A;  5F47 A;  4IQY A;  4Q7A A;  2VBQ A;  4FD5 A;  3PB4 X;  4CYO A;  1KUY A;  5IB0 A;  4CYN A;  3SJF A;  4R7M A;  4EWT A;  4J5Q A;  1IOF A;  1S7L A;  1FT7 A;  2EK8 A;  4XPD C;  3SJX A;  2FS5 A;  5AG5 A;  5I4M A;  4PQA A;  2EWB A;  5K8O A;  3P2H A;  4ETJ A;  2FIW A;  2OH1 A;  2PDO A;  3V2B A;  4KVM E;  1YLE A;  4HPS A;  3FEC A;  1SQH A;  4RUH A;  2PJ5 A;  4UEE A;  5ISV A;  2VQY A;  1Z4R A;  4M3S A;  1OBR A;  2Q0Y A;  3FNC A;  3FF3 A;  4KVO E;  3VWD A;  4MRI A;  4YGO A;  2AFC A;  1BPM A;  1CPS A;  3BJ8 A;  2ZEF A;  1XE4 A;  4CRZ B;  1Y7R A;  2EEE A;  4DYO A;  4FAI A;  3VWE A;  2F8H A;  4JCA A;  3FEE A;  4FBE A;  2C6P A;  2PR8 A;  2ZPA A;  3V45 A;  3EY5 A;  5LYD A;  5AG4 A;  1XMT A;  4GVW A;  1ZO0 A;  1LAN A;  1NSL A;  3GKR A;  3CT9 A;  2BOA A;  3GB0 A;  1YLO A;  2IQ6 A;  4TWE A;  5F48 A;  5HOL A;  4UCN A;  3RAM A;  3PEI A;  1VIX A;  4J5R A;  4JJX A;  2EVN A;  2J8N A;  2QEC A;  3B35 A;  5FSY A;  4R9M A;  7CPA A;  1Z2L A;  4AG9 A;  2OZH A;  3LMS A;  3KL9 A;  3B8G A;  4ONU A;  4WJB A;  3FIX A;  5LRJ A;  3HUV A;  4Z65 A;  4TU0 A;  1IYL A;  1IB1 E;  2J8R A;  3DSB A;  4P4D A;  4ZBG A;  4BD9 A;  4QBJ A;  4CGM A;  4I49 A;  1QSR A;  2WSA A;  4PPZ A;  5C82 A;  2BEI A;  2JZF A;  3BJ7 A;  3EC4 A;  2FG1 A;  4R57 A;  5BWA B;  1VHO A;  1TKH A;  4MHN A;  2D4P A;  1J4J A;  4HKF A;  1BOB A;  4U5Y A;  3IID A;  1CM0 A;  5CBM A;  4OID A;  4X2T A;  1YSJ A;  4KZT A;  3GPQ A;  4KS9 A;  4AG7 A;  1PU9 A;  1VHS A;  2PJ8 A;  1JQG A;  1MJA A;  1PUA A;  3PFO A;  3KAS A;  4KOT A;  3WC5 A;  2Q04 A;  3EWP A;  1Z8W A;  4IHM A;  1QSM A;  1BO4 A;  3DGV A;  2Q44 A;  4UEZ A;  1QSO A;  4U9Y A;  3D7H A;  3PB6 X;  3S6G A;  4KVX A;  4UCP A;  3PB8 X;  1Y9K A;  2P6G A;  2B4B A;  5DWM A;  3PB7 X;  2Y0M A;  3FX6 A;  4L8A A;  4QUS A;  2AJ6 A;  1ZG7 A;  3SIJ A;  2PJA A;  5KTD A;  1ZR3 A;  4OIW A;  2ZEL A;  4MHY A;  3VH9 A;  1YRE A;  4IF5 A;  2PJB A;  2VI7 A;  3K9U A;  2KCW A;  1XIX A;  4MCS A;  1S7N A;  2B58 A;  5AG6 A;  4L89 A;  2PVW A;  3EFA A;  1TXR A;  4F0X A;  4RN7 A;  4A30 A;  2JBJ A;  4P4B A;  2WPX A;  4PXD A;  4CAW A;  1QSN A;  2JEV A;  2QML A;  2ZEH A;  1B87 A;  3IC1 A;  4FUU A;  1LOK A;  5E96 A;  4J4Z A;  3D2M A;  2PQ8 A;  3NH4 A;  4A95 A;  2AE6 A;  4MI4 A;  1S3Z A;  4UML A;  2V8D A;  3OWC A;  3V38 A;  3GPO A;  3I9S A;  4ZX8 A;  4OC4 A;  5ELY A;  4UCM A;  5HVF A;  3LD2 A;  1Z8T A;  4MBU A;  4UIB A;  1HDQ A;  2DPS A;  3B3V A;  3IIF A;  3KR5 A;  3L2N A;  3K2K A;  4PK2 A;  5IV0 A;  3D7D A;  4UIA A;  4CPA A;  1CPX A;  4R6T A;  2AFZ A;  1YD9 A;  4FWU A;  3BLN A;  3V8I A;  2D4O A;  3CXS A;  3SIH A;  2GFQ A;  3FB3 A;  1XBU A;  3MN8 A;  4YU9 A;  2BO9 A;  2REF A;  3PB9 X;  5HMN A;  2DXQ A;  3V7Z A;  4EFD A;  1ELL P;  2ZW6 A;  2RB7 A;  4KOU A;  4KLW A;  4EVY A;  1JWQ A;  2I3C A;  4UWJ A;  2WZN A;  2EUI A;  3D8P A;  4PSX A;  5H84 A;  1YME A;  2PJ2 A;  2CIJ A;  2HQY A;  1KUX A;  5FVJ A;  2POK A;  4E8O A;  2OU2 A;  3F5B A;  5A27 A;  2JZD A;  3W6S A;  4NEX A;  4JZ0 A;  3B3C A;  1H8L A;  4PXB A;  2ODF A;  5FSU A;  1TF8 A;  1Y0R A;  4YRH A;  2OOT A;  3JVN A;  5F09 A;  2VRI A;  4OC5 A;  3IEH A;  4QVT A;  4P10 A;  2CNM A;  3DR8 A;  4MFQ A;  5J8C A;  1ARM A;  1CP7 A;  3S6F A;  2V77 A;  4PSW A;  4JWP A;  5DWN A;  3FRM A;  2RNK A;  2PRB A;  5DS0 A;  3EKE A;  3PFE A;  1M4I A;  4NXY A;  2GU2 A;  5F49 A;  3D4U A;  1IIC A;  4OC0 A;  3ZZI A;  4BIN A;  4OLL A;  4UFW A;  3N5F A;  4MHP A;  2IJZ A;  2Z10 A;  4E2A A;  2FXF A;  1A2Z A;  2HV2 A;  2FXK A;  3H8E A;  2PIY A;  2XEI A;  3JTK A;  3SI1 A;  3I1U A;  3T9Y A;  4G1P A;  1LFW A;  2J9A A;  1CBX A;  3BXM A;  4AB7 A;  2B4D B;  5FSV A;  1S5K A;  4JLY A;  3VAR A;  3PGP A;  3I3G A;  4B5P B;  3R96 A;  4UF4 A;  1BLL E;  2JDC A;  1XJO A;  4XPK A;  1TF9 A;  2NMT A;  4X5K A;  4B13 A;  6CPA A;  4MCP A;  5E3B A;  3ISX A;  4Q38 A;  5THW A;  2ZEE A;  4B14 A;  5CNP A;  4C2X A;  1F57 A;  3S6K A;  2VXK A;  4UFV A;  5C88 A;  2R8V A;  1CP6 A;  2ZW4 A;  3F8K A;  4KSA A;  1TKF A;  2X7B A;  4LQG A;  1R43 A;  3DLJ A;  4OAE A;  2CF4 A;  3SI2 A;  5D8N A;  5J8F A;  1M4L A;  3A9L A;  2GE3 A;  2DF5 A;  4Q36 A;  5FSX A;  3EWQ A;  4JXQ A;  3D7F A;  2Z3N A;  3LAC A;  1RXT A;  2X47 A;  4M85 A;  3EWO A;  5AGE A;  2HC9 A;  4UBR A;  3TO9 A;  2L8R A;  2WUU A;  5K8M A;  4QB9 A;  5CMS A;  1ELM P;  3KHZ A;  4NGQ A;  5JH9 A;  2DPT A;  3FH4 A;  4ONW A;  2AFU A;  3S9L A;  3EJF A;  1N71 A;  2CTB A;  1XMB A;  1YQE A;  4PXE A;  3R95 A;  1Z4E A;  2QYV A;  3CXP A;  1HEE A;  1VHE A;  2G3A A;  3KI9 A;  4MCQ A;  3VAT A;  4M6G A;  4DUK A;  2RFH A;  4RI1 A;  4OC2 A;  1XRY A;  3R9G A;  4LUA A;  2CTC A;  4R8F A;  4C68 A;  2CXA A;  4C2Y A;  2ACF A;  4C7I A;  1FY7 A;  3SII A;  4CAV A;  1K4J A;  3D7G A;  4MHD A;  3IWG A;  3CZX A;  2I00 A;  2OZG A;  1NSA A;  3FMC A;  2I79 A;  4F9U A;  4MFL A;  3T90 A;  4BMH A;  2C27 A;  4A94 A;  4IK2 A;  5HVH A;  1KZF A;  4GUA A;  5F46 A;  3CPX A;  3NH5 A;  4OKO A;  5J1Q A;  5I0C A;  5HIH A;  2BL1 A;  4PXC A;  2Z0Z A;  4P6Y A;  4R3L A;  4C2Z A;  5JPH A;  2AFO A;  3KKW A;  1IU8 A;  3W91 A;  4F8Z A;  4KUB A;  4ZY0 A;  2PE3 A;  4KOY A;  2W2G A;  3ISZ A;  5CB3 A;  2R98 A;  3B2Y A;  1MJ9 A;  2Z11 A;  4XPL A;  3SIG A;  3K9T A;  1YVK A;  2YGW A;  3D68 A;  4OC1 A;  4KOS A;  3RYO A;  4B11 A;  1M44 A;  1NMT A;  2ANP A;  1M4G A;  4MHZ A;  4KSI A;  4P44 A;  1HJZ A;  5JM6 A;  2R1I A;  4CAE A;  4TNU A;  2LGR A;  3MGD A;  1B6B A;  5HXD A;  3TFY A;  8CPA A;  2XEJ A;  5HH1 A;  3ZJ0 A;  2DEA A;  1F2O A;  1XOV A;  4JVV A;  2PRQ A;  4J3G A;  4CYP A;  1U6M A;  2PJ6 A;  1Y7E A;  2V8V A;  4F6A A;  1IID A;  1ZG9 A;  2P0W A;  3PP9 A;  4GVV A;  4GM5 A;  4MXU A;  4NGT A;  1ZR5 A;  4GXH A;  1VKC A;  2ZOG A;  2JZE A;  3PBB A;  4KOR A;  3TX8 A;  4F9V A;  4HNW B;  1YX0 A;  2B4D A;  3Q6Z A;  2CNS A;  2VL1 A;  3NE7 A;  3IWE A;  1YR0 A;  4AXV A;  5LYF A;  4AVB A;  4II9 A;  3B3T A;  5EBV A;  4ZY1 A;  5G20 A;  2FVG A;  3NFZ A;  2XD7 A;  3GIU A;  4K30 A;  4A39 A;  1HDU A;  1Q7L A;  3WT4 A;  4A37 A;  3CPA A;  3RNZ A;  1R57 A;  2Q4V A;  1I21 A;  5K8P A;  3EO4 A;  4NFR A;  2ARH A;  2Z3L A;  2ZW5 A;  4K0C A;  2ZEM A;  5CPA A;  2GIV A;  4CS0 B;  1RTQ A;  3BI0 A;  2PSW A;  1NJR A;  1ZLI A;  2C1C A;  3JRU A;  5CB5 A;  2JDD A;  3TE4 A;  3VFQ A;  2OB0 A;  2R7H A;  3QAH A;  3UY5 A;  4ZGY B;  1RO5 A;  1YK3 A;  5JGF A;  1LAP A;  3KQZ A;  2ZED A;  3B3W A;  4B5O A;  4DNC A;  2G0B A;  4D86 A;  4Y49 C;  1PYT B;  1GYT A;  3GQE A;  4ORF A;  4MCR A;  5G1Z A;  3GY9 A;  5LRK A;  3KR4 A;  2PCU A;  3G8W A;  3IU2 A;  4HNX B;  2DX6 A;  2B3V A;  3GQO A;  3CDX A;  1CJW A;  1KWM A;  3FED A;  3EWR A;  1CX8 A;  1QQ9 A;  2O4H A;  3IO1 A;  4NSQ A;  4P4F A;  4ABK A;  4MFZ A;  4IAV A;  3SI0 A;  3FXT A;  4M6H A;  2Q43 A;  1ON0 A;  1OZP A;  3IIB A;  4JLL A;  3WC6 A;  3LWU A;  2JLM A; 
#chains in the Genus database with same CATH homology
 3Q71 A;  1UWY A;  2PJ1 A;  3H8F A;  4ETK A;  3BHX A;  2FAV A;  4JGK A;  1LAM A;  1PCA A;  4X3R A;  3B3S A;  2ZEN A;  1DE4 C;  2EK9 A;  2ZEG A;  5LYI A;  2F7V A;  4UEF A;  4KYB A;  2XEG A;  1TY8 A;  1XFO A;  4O23 A;  1VHU A;  1TXZ A;  2NYQ A;  2C6C A;  3B7I A;  1R3N A;  4FAI A;  4H2K A;  4OC3 A;  5JM6 A;  1BPN A;  1IY7 A;  3IWW A;  4NJQ A;  3JZT A;  5LRG A;  2JBK A;  1YW6 A;  3GLJ A;  4NGS A;  4ZYQ A;  2QJ8 A;  2PJC A;  3PRT A;  3T8W A;  4K3N A;  3FVL A;  2O53 A;  4YWY A;  2PJ9 A;  5DUS A;  1BAV A;  1ZLH A;  2GLJ A;  3FJU A;  2JEW A;  5HVG A;  2IMO A;  2ZEO A;  3ETI A;  1IGB A;  2ABZ A;  1AYE A;  2NSM A;  3TC8 A;  2ZOF A;  2OR4 A;  2C6G A;  1AMP A;  3EW5 A;  3WC7 A;  4NGN A;  3KHX A;  1VGY A;  1QMU A;  2WYR A;  1DTD A;  2AFM A;  3D67 A;  3MRU A;  3GPG A;  2AFS A;  3KZW A;  3SJE A;  5FSZ A;  3RBU A;  3IFE A;  2Q4Z A;  2GLF A;  4P45 A;  4J5S A;  5K8N A;  4ABL A;  2PJ0 A;  4WWV A;  4JYW A;  3BI1 A;  1SPV A;  2AFW A;  4A38 A;  5AIL A;  3SJG A;  3WAB A;  1LCP A;  1CG2 A;  2PJ7 A;  2PJ3 A;  1F2P A;  5LYL A;  3QNV A;  4P4I A;  4NGM A;  1Z5R A;  2QVP A;  4W9Y A;  1ZG8 A;  4B6Z A;  2G9D A;  2Q51 A;  5IB9 A;  3RZA A;  2BFR A;  1ARL A;  5D29 A;  3IJ3 A;  4NGR A;  4NJR A;  4NGP A;  3KQX A;  3NH8 A;  4ESS A;  2ZEP A;  4MMO A;  2HB6 A;  2PIZ A;  3GUX A;  4ZY2 A;  2PJ4 A;  1TKJ A;  2GRE A;  4DJL A;  3D66 A;  4OP4 A;  4R76 A;  2BCO A;  2XEF A;  3PBE A;  2AFX A;  3S9M A;  4X8I A;  4P4J A;  1FNO A;  1Z8L A;  3EJG A;  3H8G A;  3KGQ A;  3NA6 A;  3HLP A;  2BFQ A;  4ZI6 A;  2V8G A;  1Y0Y A;  4EME A;  1EE3 P;  4P4E A;  2V8H A;  2PVV A;  3S9N A;  4ZX9 A;  1YW4 A;  4OME A;  4IQY A;  4Q7A A;  3PB4 X;  3SJF A;  4R7M A;  4EWT A;  4J5Q A;  1FT7 A;  2EK8 A;  3SJX A;  5I4M A;  4PQA A;  2EWB A;  5K8O A;  4ETJ A;  3V2B A;  3FEC A;  4RUH A;  2PJ5 A;  4UEE A;  1OBR A;  3FF3 A;  4MRI A;  2AFC A;  1BPM A;  1CPS A;  2ZEF A;  2EEE A;  4DYO A;  2F8H A;  4JCA A;  3FEE A;  4FBE A;  2C6P A;  3V45 A;  5LYD A;  4GVW A;  1LAN A;  3CT9 A;  2BOA A;  3GB0 A;  1YLO A;  2IQ6 A;  4TWE A;  5HOL A;  3RAM A;  3PEI A;  1VIX A;  4J5R A;  3B35 A;  5FSY A;  7CPA A;  1Z2L A;  3LMS A;  3KL9 A;  4WJB A;  5LRJ A;  3HUV A;  4Z65 A;  4TU0 A;  4P4D A;  4BD9 A;  4PPZ A;  2FG1 A;  1VHO A;  1TKH A;  4MHN A;  3IID A;  5CBM A;  4OID A;  4X2T A;  1YSJ A;  3GPQ A;  2PJ8 A;  1JQG A;  3PFO A;  3KAS A;  3WC5 A;  3EWP A;  4IHM A;  3DGV A;  4UEZ A;  3D7H A;  3PB6 X;  3PB8 X;  3PB7 X;  3FX6 A;  1ZG7 A;  3SIJ A;  2PJA A;  1ZR3 A;  4OIW A;  2ZEL A;  4MHY A;  3VH9 A;  2PJB A;  4MCS A;  2PVW A;  1TXR A;  2JBJ A;  4P4B A;  4PXD A;  2ZEH A;  3IC1 A;  4FUU A;  1LOK A;  4J4Z A;  3NH4 A;  4UML A;  2V8D A;  3V38 A;  3GPO A;  4ZX8 A;  4OC4 A;  5ELY A;  5HVF A;  4UIB A;  1HDQ A;  3B3V A;  3IIF A;  3KR5 A;  3L2N A;  3K2K A;  3D7D A;  4UIA A;  4CPA A;  1CPX A;  4R6T A;  2AFZ A;  1YD9 A;  4FWU A;  3SIH A;  4YU9 A;  1XBU A;  3MN8 A;  2BO9 A;  3PB9 X;  3V7Z A;  4EFD A;  1ELL P;  2RB7 A;  2I3C A;  2WZN A;  1YME A;  2PJ2 A;  2CIJ A;  2POK A;  4JZ0 A;  3B3C A;  1H8L A;  4PXB A;  5FSU A;  1TF8 A;  1Y0R A;  2OOT A;  5F09 A;  2VRI A;  4OC5 A;  3IEH A;  4P10 A;  1ARM A;  1CP7 A;  2V77 A;  5DS0 A;  3EKE A;  3PFE A;  2GU2 A;  3D4U A;  4OC0 A;  3N5F A;  4MHP A;  2IJZ A;  2PIY A;  2XEI A;  2FXK A;  3H8E A;  3SI1 A;  3I1U A;  4G1P A;  3BXM A;  2J9A A;  1CBX A;  1LFW A;  5FSV A;  3VAR A;  4UF4 A;  1BLL E;  1XJO A;  1TF9 A;  6CPA A;  4MCP A;  5E3B A;  3ISX A;  5THW A;  2ZEE A;  1F57 A;  1CP6 A;  1TKF A;  4LQG A;  1R43 A;  3DLJ A;  2CF4 A;  3SI2 A;  5D8N A;  1M4L A;  5FSX A;  3EWQ A;  3D7F A;  2X47 A;  3EWO A;  2HC9 A;  5K8M A;  2L8R A;  5CMS A;  1ELM P;  3KHZ A;  4NGQ A;  5JH9 A;  3FH4 A;  4ONW A;  2AFU A;  3S9L A;  3EJF A;  2CTB A;  1XMB A;  4PXE A;  2QYV A;  1HEE A;  1VHE A;  3KI9 A;  4MCQ A;  3VAT A;  4DUK A;  2RFH A;  4OC2 A;  1XRY A;  4R8F A;  2CTC A;  2ACF A;  3SII A;  3D7G A;  4F9U A;  1NSA A;  3FMC A;  4A94 A;  4IK2 A;  5HVH A;  4GUA A;  3CPX A;  3NH5 A;  4OKO A;  5J1Q A;  5HIH A;  4PXC A;  4P6Y A;  2AFO A;  4F8Z A;  4ZY0 A;  2PE3 A;  3ISZ A;  5CB3 A;  3B2Y A;  3SIG A;  3K9T A;  3D68 A;  4OC1 A;  2ANP A;  4MHZ A;  4KSI A;  4P44 A;  1HJZ A;  4TNU A;  2LGR A;  5HXD A;  8CPA A;  2XEJ A;  2DEA A;  1F2O A;  2PRQ A;  4JVV A;  2PJ6 A;  1Y7E A;  2V8V A;  1ZG9 A;  4GVV A;  4GM5 A;  4MXU A;  4NGT A;  1ZR5 A;  2ZOG A;  3PBB A;  3TX8 A;  4F9V A;  3Q6Z A;  4AXV A;  2VL1 A;  5LYF A;  3B3T A;  4ZY1 A;  2FVG A;  3NFZ A;  2XD7 A;  4A39 A;  1HDU A;  1Q7L A;  3WT4 A;  4A37 A;  3CPA A;  5K8P A;  4NFR A;  4K0C A;  2ZEM A;  5CPA A;  1RTQ A;  3BI0 A;  1NJR A;  1ZLI A;  2C1C A;  3JRU A;  5CB5 A;  3VFQ A;  5JGF A;  1LAP A;  3KQZ A;  2ZED A;  3B3W A;  4D86 A;  1PYT B;  1GYT A;  3GQE A;  4MCR A;  5LRK A;  3KR4 A;  2PCU A;  2DX6 A;  3GQO A;  3CDX A;  1KWM A;  3FED A;  3EWR A;  1CX8 A;  1QQ9 A;  2O4H A;  3IO1 A;  4P4F A;  4ABK A;  4IAV A;  3SI0 A;  2Q43 A;  3WC6 A;  3IIB A;  4JLL A;  3LWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...