3H8FA

High ph native structure of leucine aminopeptidase from pseudomonas putida
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
497
structure length
497
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosol aminopeptidase
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 168
structure length 497
sequence length 497
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8fA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8fA02
1YMEA 2ABZA 4FAIA 2Q4ZA 3SIJA 2IJZA 4KSIA 4X8IA 4IQYA 5JH9A 4Q7AA 3IIBA 3PB7X 5HVFA 4MMOA 1ARMA 3V2BA 1Y7EA 5FSVA 3KZWA 1FT7A 1HEEA 2AFOA 4ONWA 4PXEA 3V7ZA 1CX8A 3PRTA 5D8NA 3HUVA 1TKJA 2PJ0A 2ZEDA 3IEHA 4JLLA 1YLOA 4MCSA 1LAMA 4MCPA 1LFWA 2ZEMA 5FSYA 4P44A 4P4FA 3V38A 1ZR5A 3D66A 1ELMP 1HDQA 5LRGA 2BCOA 4GM5A 4ZI6A 3NA6A 1CPSA 3B3SA 3S9MA 1ZR3A 4ETKA 3Q71A 2RB7A 3WABA 3IIFA 4FBEA 3H8FA 4MHNA 3ISZA 3EWOA 4GUAA 3FEDA 4OIWA 4OKOA 2AFCA 4UF4A 4FWUA 4IAVA 1YW6A 5THWA 2AFUA 1TF8A 2PJ2A 2BO9A 4ZX9A 2PJ5A 1F2OA 2ZEPA 4PXBA 4TU0A 1XFOA 3B7IA 4B6ZA 2PJ6A 3B2YA 3BXMA 4NGNA 1Y0YA 2ZOGA 4WJBA 3GPQA 3KR5A 5D29A 2GU2A 2JBJA 4NGRA 2ZEEA 5F09A 4ZY1A 3VFQA 4NGMA 2LGRA 4H2KA 3HLPA 1LOKA 4P6YA 3KQXA 2PIZA 3FVLA 1YD9A 2OOTA 1TF9A 5LYDA 4ZYQA 2V8HA 3FECA 3IFEA 1LANA 3PEIA 1PYTB 3FJUA 1BPNA 3WC7A 4A39A 3LWUA 2PJBA 4PXDA 5LRKA 4MCQA 5FSUA 4IK2A 3KHZA 3IO1A 2GLFA 1PCAA 1VHEA 3VARA 3BI1A 4R6TA 1LCPA 3EW5A 2C6CA 3KI9A 3GPGA 1CG2A 2AFZA 1HJZA 4OC4A 1R43A 4OIDA 3EWPA 3D4UA 4OC0A 1ELLP 3EJFA 4RUHA 3CT9A 5HOLA 3CPAA 5CB5A 3WT4A 3PFEA 3EJGA 3SJEA 1NSAA 3D68A 3SJFA 1XMBA 2FXKA 4OC2A 3SI1A 5HVHA 1GYTA 1ZG7A 5FSZA 5DUSA 3DGVA 4JZ0A 3EKEA 2JEWA 2VRIA 4EMEA 2PJAA 4KYBA 4ESSA 3TX8A 7CPAA 3VH9A 4GVVA 5LYIA 4MHZA 1OBRA 2Q43A 3PFOA 5LRJA 1XJOA 3PBEA 1AMPA 1Z5RA 2F7VA 5LYFA 2GLJA 3MN8A 4AXVA 2IMOA 3ETIA 3WC6A 3T8WA 4LQGA 4UEZA 3B3TA 3IC1A 1IGBA 3RZAA 4MRIA 4WWVA 4P10A 2XEIA 4PPZA 5CBMA 3FX6A 5JM6A 3PB8X 2JBKA 2POKA 2RFHA 3KASA 4P45A 3SI2A 5K8PA 3GUXA 2C6GA 4MHPA 2BFQA 4R76A 1R3NA 1TKHA 1Z2LA 2PJ8A 3MRUA 3H8EA 2CTCA 3IWWA 3SJGA 2FG1A 3B35A 4ZX8A 4YWYA 4DUKA 2CTBA 4G1PA 3K2KA 2AFWA 3FF3A 4UIBA 4NFRA 1F2PA 4X2TA 4ETJA 2BFRA 4UEEA 3SJXA 4A94A 1BPMA 4R8FA 2PCUA 4F9VA 2PE3A 3FEEA 1VHUA 2BOAA 1KWMA 2XEGA 1VHOA 3EWQA 1DE4C 4F8ZA 2OR4A 1RTQA 4J5QA 1FNOA 4NGTA 2VL1A 2DEAA 4NJRA 4K0CA 1JQGA 1XRYA 3N5FA 2C1CA 2QVPA 3JZTA 4ZY2A 3B3WA 2J9AA 3SI0A 3VATA 1TXRA 3SIGA 2O4HA 4K3NA 2NYQA 2AFXA 5LYLA 3RBUA 4ABLA 2PJ1A 4OMEA 5HXDA 3D7DA 3NH5A 2WZNA 1CP7A 2ZOFA 3CPXA 3D7GA 1ZLHA 3LMSA 2PVWA 3NH4A 1ARLA 3I1UA 3NH8A 2ACFA 5HIHA 2V8GA 4TWEA 3GQOA 2F8HA 2X47A 6CPAA 3PBBA 1H8LA 1Z8LA 2ZENA 4IHMA 4PQAA 2HB6A 5CB3A 2PIYA 4OC3A 1M4LA 5K8MA 4DJLA 1Y0RA 3GLJA 3KGQA 4J5RA 3IJ3A 1AYEA 4O23A 4DYOA 3DLJA 3ISXA 1BLLE 4FUUA 4P4BA 4UEFA 3JRUA 2NSMA 4CPAA 2GREA 3EWRA 3KL9A 4NJQA 2DX6A 1QMUA 3D67A 4JGKA 2PRQA 3D7FA 3S9LA 4UIAA 1CPXA 2O53A 5ELYA 5FSXA 5HVGA 4W9YA 3S9NA 3B3VA 2FAVA 3SIIA 2L8RA 4MHYA 4OC5A 2V8DA 1CP6A 1ZLIA 2QJ8A 5K8NA 2PJ3A 4X3RA 1HDUA 3IIDA 1SPVA 5CPAA 2Q51A 4JYWA 4D86A 3WC5A 4ZY0A 1VGYA 3FH4A 2EK8A 8CPAA 2WYRA 3PB4X 3KR4A 1TY8A 2ZEOA 5E3BA 2XEJA 4EWTA 4YU9A 3GQEA 2CF4A 5IB9A 4R7MA 4A38A 3PB9X 1IY7A 2XD7A 4NGQA 4JCAA 1VIXA 3BI0A 1UWYA 4ABKA 1QQ9A 3L2NA 3NFZA 4OP4A 4P4DA 3SIHA 5J1QA 1CBXA 4BD9A 1YSJA 4NGPA 1EE3P 1Q7LA 3H8GA 2AFSA 4NGSA 2V77A 1ZG8A 3FMCA 1TKFA 3GB0A 2C6PA 3PB6X 4PXCA 4J5SA 4F9UA 3CDXA 4GVWA 2FVGA 3Q6ZA 4TNUA 2PVVA 3KHXA 5I4MA 2PJ4A 2PJ7A 2ANPA 3GPOA 2QYVA 5CMSA 3D7HA 5DS0A 1NJRA 5AILA 3TC8A 3KQZA 1ZG9A 1XBUA 2V8VA 2XEFA 3B3CA 2EK9A 1F57A 4P4JA 4P4IA 5K8OA 2ZELA 1YW4A 2G9DA 1LAPA 2EEEA 3QNVA 2CIJA 3V45A 2IQ6A 2ZEFA 2ZEGA 1TXZA 3K9TA 2PJCA 4MCRA 2I3CA 2AFMA 4JVVA 2PJ9A 2HC9A 4Z65A 3BHXA 4A37A 2EWBA 3RAMA 4P4EA 1DTDA 2ZEHA 4EFDA 4UMLA 5JGFA 4OC1A 1BAVA 4J4ZA 4MXUA
chains in the Genus database with same CATH superfamily
1YMEA 4R3LA 2ABZA 4FAIA 2Q4ZA 4KOWA 2R7HA 3DSBA 3SIJA 3IGRA 3R9GA 1PU9A 3S6GA 1X12A 2IJZA 3EO4A 2CXAA 3NE8A 4KORA 3IU1A 1S60A 4KSIA 4NCZA 4Q36A 4X8IA 4IQYA 5JH9A 3LODA 4Q7AA 2PC1A 5F49A 3IIBA 3PB7X 2GIVA 2REEA 2D4PA 5HVFA 5G1ZA 5KTDA 4NEXA 4MMOA 2RNKA 1ARMA 3V2BA 1Y7EA 5FSVA 3KZWA 1FT7A 2R8VA 2HV2A 5IB0A 1HEEA 3RZAA 1Q2YA 2AFOA 4ONWA 1P0HA 4U9YA 4PXEA 4B5PB 3GIUA 3V7ZA 2H5MA 4LX9A 1CX8A 2CNMA 2VQYA 5D8NA 3HUVA 1XIXA 3PRTA 2JZDA 1TKJA 2PJ0A 1IU8A 3RYOA 3H4QA 2ZEDA 3IEHA 2DPSA 4JLLA 1YLOA 1IIDA 4CGOA 2OZGA 4MCSA 4UA3A 3D3SA 1LAMA 5AGEA 5KTCA 4MCPA 3PZJA 1LFWA 2ZEMA 4KOTA 4RS2A 5FSYA 1I12A 4P44A 4P4FA 3V38A 5KTAA 1ZR5A 3D66A 4KLWA 1ELMP 1HDQA 1IYKA 2P6FA 2BCOA 2YNCA 5LRGA 4GM5A 4ZI6A 1YX0A 3NA6A 1CPSA 4GS4A 1Y7RA 3B3SA 4R87A 4KSAA 3S9MA 2G3AA 4B14A 1ZR3A 4ETKA 2A4NA 2CY2A 3Q71A 2RB7A 3WABA 2FIAA 3IIFA 4KVOE 4MFJA 4FBEA 1Z9UA 3H8FA 4MHNA 3ISZA 1P4NA 2JDCA 4QUSA 2Z3NA 4U9ZA 3EWOA 4M3SA 3TO9A 4GUAA 2DXQA 3FEDA 2HUZA 2KQVA 1XE4A 4OIWA 4OKOA 2AFCA 4UF4A 3R96A 4FWUA 4KUAA 4IAVA 1M44A 1YW6A 2QECA 2Z0ZA 2AFUA 5THWA 2OB0A 1TF8A 4A33A 2PJ2A 1K4JA 3BLNA 2BUEA 4AG9A 2BO9A 4A2ZA 4ZX9A 2FS5A 3EXNA 2PJ5A 1F2OA 5C82A 4FD4A 3JVNA 4KSFA 2ZEPA 4PXBA 4TU0A 1XFOA 3B7IA 4B6ZA 2PJ6A 3B2YA 3BXMA 4NGNA 1Y0YA 1QSRA 2ZOGA 4WJBA 4KVXA 3GPQA 4CAVA 3R9EA 3KR5A 2HQYA 1ZO0A 5D29A 2GU2A 2JBJA 4CGPA 4NGRA 2ZEEA 2VXKA 2DF5A 2D4OA 2ZW6A 5F09A 4C2XA 4ZY1A 2WCTA 3VFQA 1L0CA 2B58A 1QSTA 3FXTA 4KOXA 4NGMA 3TT2A 4L89A 2LGRA 4H2KA 5JQ4A 3B8GA 3HLPA 1LOKA 4P6YA 4UFVA 1A2ZA 2VEZA 3KQXA 1YK3A 2PIZA 3FVLA 4KZTA 1YD9A 2OOTA 3GYAA 2B4DB 1TF9A 2F5IA 2Z3OA 5LYDA 2ZXVA 3C26A 4ZYQA 2C27A 2V8HA 3FECA 4MFKA 3FRMA 3IFEA 1IB1E 5F46A 3TOAA 1LANA 5BWAB 5IV0A 1S7NA 3PEIA 1PYTB 2VBQA 1BPNA 3FJUA 4AB7A 3FNCA 3WC7A 4A39A 2Q44A 3TOBA 2B4BA 3LWUA 2PJBA 4PXDA 5LRKA 1WK4A 4MCQA 5FSUA 4IK2A 4EVYA 1RO5A 2KCWA 3KHZA 2ZPAA 4XPDB 2GANA 3IO1A 2GLFA 3EY5A 4UCPA 1PCAA 5AG7A 1Z8XA 3PP9A 2Z3MA 4JWPA 1VHEA 3VARA 1BO4A 3BI1A 5GCNA 4R6TA 3S6KA 1XOVA 3JUWA 2FL4A 1LCPA 3EW5A 1CM0A 2C6CA 3KI9A 2B5GA 4AVBA 4MFZA 3GPGA 1I1DA 3DR8A 1CG2A 2AFZA 2X7BA 4C68A 1HJZA 1Y9KA 2RC4A 1XEBA 4K30A 3PGPA 4OC4A 1R43A 4OIDA 3EWPA 3D4UA 4OC0A 1N71A 4FD5A 1ELLP 1M1DA 1M4IA 4MFLA 4XPLA 3EJFA 2R98A 4RUHA 1QSOA 3CT9A 4PSXA 5HOLA 3CPAA 5CB5A 4PK2A 3PFEA 3EJGA 3SJEA 3WT4A 1NSAA 3D68A 4H6ZA 2P6GA 2P0WA 1M4GA 4U5YA 4BINA 1IOIA 3SJFA 4CYPA 1XMBA 2FXKA 2B3UA 4OC2A 3SI1A 5HVHA 1GYTA 4H89A 4QBJA 4HNXB 2JZFA 1ZG7A 5FSZA 2ZW5A 5DUSA 3DGVA 3I9SA 3KKWA 4I49A 4JZ0A 5EC4A 3P2HA 3EKEA 2JEWA 3D7HA 1NSLA 3SHPA 4FD6A 4ZBGA 4B5OA 2VRIA 2QMLA 4EMEA 3R95A 5FVJA 3F0AA 4PV6A 3LD2A 2PJAA 1VKCA 4YRHA 2EBJA 5ISVA 2JZEA 4KYBA 4ESSA 3TX8A 7CPAA 3VH9A 4GVVA 3RO0A 5LYIA 4MHZA 3TE4A 1OBRA 2I79A 4JXRA 2JLMA 2Q43A 3PFOA 3CZXA 1LRZA 4B5PA 5LRJA 1XJOA 4M6HA 5HMNA 3PBEA 2ZW7A 4ORFA 3WR7A 4MBUA 4C2ZA 3F8KA 5E96A 1AMPA 4IF5A 1Z5RA 1PUAA 4NXYA 1NMTA 2F7VA 1I21A 2GLJA 3MN8A 4AXVA 2IMOA 5LYFA 3S6FA 3ETIA 3WC6A 3T8WA 2FIWA 4LQGA 2WSAA 4UEZA 1MJ9A 3B3TA 3IC1A 1IGBA 3EFAA 1Z8WA 3QAHA 2REFA 4MRIA 4WWVA 5G22A 4P10A 2XEIA 3D2MA 5CBMA 1AUGA 3FX6A 4PPZA 3W6SA 5JM6A 3T9YA 2OZHA 2YNCC 3D8PA 3PB8X 2JBKA 2POKA 2RFHA 3KASA 4P45A 3SI2A 5K8PA 1MJAA 3GUXA 5H86A 2P6EA 4PK3A 4JJXA 2C6GA 4MHPA 2BFQA 4A30A 5G21A 4ZGYB 4R76A 1R3NA 1TKHA 2G0BA 2Z3PA 1Z2LA 2PJ8A 4MJ8A 3MRUA 3CXSA 4PSWA 4KLVA 3NE7A 4A31A 3H8EA 1KUVA 4Y49C 2CTCA 3IWWA 3SJGA 2FG1A 4M6GA 3B35A 4ZX8A 4UWJA 4YWYA 1CJWA 1KUXA 4DUKA 1B87A 2CTBA 4G1PA 1MJBA 3S6HA 3K2KA 2CNSA 2AFWA 2VZZA 2GFQA 2W2GA 3DDDA 3FF3A 4UIBA 4F0YA 1J4JA 4NFRA 1FY7A 3ZZIA 1YVKA 4UCNA 1F2PA 2AJ6A 3CXQA 4NF1A 1GHEA 1YR0A 4X2TA 3FYNA 3SXNA 4ETJA 2BFRA 2BSWA 4UEEA 3SJXA 3CXPA 4AG7A 4A94A 4B10A 3TTHA 1BPMA 4R8FA 4XNHC 2PCUA 4CGNA 4F9VA 2PE3A 3FEEA 4R3KA 4B11A 1VHUA 2BOAA 1KWMA 2CNTA 2XEGA 2PSWA 1VHOA 3T90A 1YREA 1Y9WA 1XF8A 1S7FA 4CAXA 3EWQA 1DE4C 2FCKA 3BJ7A 2OR4A 4F8ZA 1RTQA 4J5QA 1FNOA 4NGTA 2VL1A 2VZYA 1RXTA 2DEAA 3G8WA 4CGMA 4NJRA 3JTKA 4K0CA 1JQGA 1KUYA 1XRYA 3N5FA 5EMIA 4XPKA 3TO6A 5C88A 2C1CA 2QVPA 3JZTA 3K9UA 4ZY2A 3B3WA 1Q2CA 2J9AA 5J8FA 4JD6A 4KVME 4LUAA 3SI0A 3VATA 1TXRA 2J8NA 3SIGA 1B6BA 2Y0MA 2O4HA 4K3NA 2NYQA 4RI1A 3TO7A 5A27A 2AFXA 5LYLA 4II9A 3RBUA 4CS0B 4ABLA 1NE9A 4FD7A 1QSNA 4J3GA 2PJ1A 3GY9A 1Z4RA 4OMEA 2ODFA 1BOBA 5HXDA 2OZUA 2QIRA 4H6UA 3D7DA 3NH5A 4JLYA 2WZNA 2Z11A 1CP7A 2ZOFA 3CPXA 2GE3A 3D7GA 1ZLHA 5IX3A 1YQEA 3F5BA 3TCVA 3LMSA 2PVWA 1S5KA 3NH4A 4YGOA 1ARLA 3I1UA 1X10A 3NH8A 4CYOA 4F6AA 2JEVA 2Q4VA 4MI4A 2YNEA 2ACFA 1QSMA 3W6XA 4AVAA 5HIHA 2V8GA 3FBUA 3GQOA 2EO8A 4HNWB 2F8HA 4TWEA 5DWNA 4YFJA 1S7KA 2X47A 4MFQA 2B3VA 6CPAA 3PBBA 1H8LA 1Z8LA 3DNSA 4HNYB 4QVTA 3E0KA 2FT0A 2WUUA 3VWDA 4CYNA 4IUSA 3UY5A 2DPTA 2ZENA 4IHMA 4C2YA 2Q04A 4PQAA 2HB6A 5CB3A 1UFHA 2PIYA 4BMHA 4C7HA 1U6MA 2IL4A 4B12A 4OC3A 2FSRA 2FE7A 1M4LA 2ATRA 4OADA 5K8MA 3R9FA 4LQ6A 4DJLA 4KOSA 3GKRA 1Y0RA 3GLJA 3KGQA 4J5RA 3IJ3A 1AYEA 3N7ZA 4O23A 3QAYA 4DYOA 3A9LA 4MFPA 3DLJA 3ISXA 1BLLE 2Q0YA 4FUUA 4P4BA 4E8OA 4M6IA 4UEFA 4QC6A 3P2FA 3JRUA 2NSMA 3R1KA 4UBRA 4CPAA 2ARHA 2GREA 1YLEA 5A28A 3EWRA 1YGHA 3KL9A 4CAWA 4NJQA 2DX6A 1QMUA 2ZW4A 4KOUA 2JDDA 3TFYA 3D67A 4JGKA 2PRQA 3D7FA 2Q4YA 4GXHA 3S9LA 4UIAA 1SQHA 5I0CA 1TIQA 1CPXA 2O53A 5ELYA 4ONUA 5FSXA 4CRZB 5HVGA 4W9YA 3W91A 5F47A 3S9NA 3B3VA 4OAEA 2FAVA 1OZPA 3SIIA 2L8RA 4MHYA 4OC5A 4HKFA 3VWEA 5J8CA 2V8DA 1CP6A 1ZLIA 2QJ8A 5K8NA 2PJ3A 4X3RA 1HDUA 3IIDA 2PDOA 1SPVA 2WPXA 5CPAA 4E0AA 2J8MA 5G20A 1MK4A 2Q51A 2O28A 4JYWA 4MY0A 4D86A 4KUBA 4UFXA 3WC5A 4ZY0A 1VGYA 3FH4A 2EK8A 2EUIA 2PR1A 8CPAA 2WYRA 1ON0A 1YVOA 3PB4X 3KR4A 2BL1A 1TY8A 2ZEOA 4Y49B 5E3BA 4JXQA 5AG4A 3V8IA 2XEJA 5CNPA 4RN7A 4EWTA 4YU9A 2R1IA 3GQEA 2CF4A 3DR6A 5IB9A 1Z4EA 4R7MA 4A38A 5AG5A 1XMTA 3PB9X 4BBHA 3LACA 1IY7A 2Q7SA 2XD7A 3IWGA 4NGQA 4F0XA 4JCAA 4R9MA 1VIXA 1Z8TA 5EBVA 4CRYB 5JPHA 2Z3KA 3BI0A 1UWYA 4ABKA 2Z3LA 1QQ9A 3L2NA 2J8RA 4KOYA 3NFZA 4OP4A 4P4DA 3SIHA 4E2AA 5J1QA 4KS9A 2PR8A 2YGWA 1CBXA 4QB9A 1JWQA 1Q2DA 1S3ZA 3FB3A 1V0CA 4XNHB 4AVCA 4BD9A 1YSJA 4NGPA 2YNDA 1EE3P 1Q7LA 4CAEA 4A32A 3H8GA 1VHSA 2AFSA 2PQ8A 4NGSA 1IYLA 4M85A 2V77A 1ZG8A 3FMCA 1TKFA 3GB0A 3IU2A 4UFWA 2C6PA 3PB6X 4PXCA 4J5SA 2FXFA 4F9UA 3CDXA 4MHDA 3D2PA 4MY3A 4GVWA 5H84A 2B4DA 2FVGA 3Q6ZA 3QB8A 4TNUA 2PVVA 3KHXA 5I4MA 4R57A 2PJ4A 1IICA 2PJ7A 3IWEA 3ZJ0A 2ANPA 3GPOA 2OH1A 5CMSA 1R57A 2NMTA 2QYVA 1NJRA 5AILA 2WPWA 5DS0A 3KQZA 3TC8A 1ZG9A 1XBUA 2V8VA 2XEFA 4OLLA 2BEIA 2AE6A 3B3CA 2EK9A 1F57A 1S7LA 4P4JA 4P4IA 2ZELA 5K8OA 1WWZA 4UCMA 1YW4A 2G9DA 2EVNA 4KOVA 1LAPA 2EEEA 2Z10A 3QNVA 2Q7BA 2CIJA 3V45A 1IOFA 5DWMA 4CYQA 2IQ6A 2ZEFA 2ZEGA 4NSQA 2VI7A 4UWIA 1M4DA 2I00A 5AG6A 1TXZA 3FIXA 3K9TA 2PJCA 4Q38A 2B5GB 2K5TA 4XPDC 3OWCA 4X5KA 4CGLA 4MCRA 5F48A 2I3CA 2AFMA 4DNCA 3BJ8A 4JVVA 2PRBA 2OU2A 3EC4A 4C7IA 2PJ9A 2HC9A 4Z65A 3RNZA 3BHXA 4A37A 2EWBA 1KZFA 4L8AA 3RAMA 4P4EA 3SXOA 2G3TA 5HH1A 3G3SA 4B13A 1DTDA 2ZEHA 4EFDA 4UMLA 5JGFA 4A95A 3MGDA 3H5ZA 3I3GA 4HPSA 1BAVA 4OC1A 4J4ZA 4MXUA 4CAFA
chains in the Genus database with same CATH topology
1YMEA 2ABZA 4FAIA 2Q4ZA 3SIJA 2IJZA 4KSIA 4X8IA 4IQYA 5JH9A 4Q7AA 3IIBA 3PB7X 5HVFA 4MMOA 1ARMA 3V2BA 1Y7EA 5FSVA 3KZWA 1FT7A 1HEEA 2AFOA 4ONWA 4PXEA 3V7ZA 1CX8A 3PRTA 5D8NA 3HUVA 1TKJA 2PJ0A 2ZEDA 3IEHA 4JLLA 1YLOA 4MCSA 1LAMA 4MCPA 1LFWA 2ZEMA 5FSYA 4P44A 4P4FA 3V38A 1ZR5A 3D66A 1ELMP 1HDQA 5LRGA 2BCOA 4GM5A 4ZI6A 3NA6A 1CPSA 3B3SA 3S9MA 1ZR3A 4ETKA 3Q71A 2RB7A 3WABA 3IIFA 4FBEA 3H8FA 4MHNA 3ISZA 3EWOA 4GUAA 3FEDA 4OIWA 4OKOA 2AFCA 4UF4A 4FWUA 4IAVA 1YW6A 5THWA 2AFUA 1TF8A 2PJ2A 2BO9A 4ZX9A 2PJ5A 1F2OA 2ZEPA 4PXBA 4TU0A 1XFOA 3B7IA 4B6ZA 2PJ6A 3B2YA 3BXMA 4NGNA 1Y0YA 2ZOGA 4WJBA 3GPQA 3KR5A 5D29A 2GU2A 2JBJA 4NGRA 2ZEEA 5F09A 4ZY1A 3VFQA 4NGMA 2LGRA 4H2KA 3HLPA 1LOKA 4P6YA 3KQXA 2PIZA 3FVLA 1YD9A 2OOTA 1TF9A 5LYDA 4ZYQA 2V8HA 3FECA 3IFEA 1LANA 3PEIA 1PYTB 3FJUA 1BPNA 3WC7A 4A39A 3LWUA 2PJBA 4PXDA 5LRKA 4MCQA 5FSUA 4IK2A 3KHZA 3IO1A 2GLFA 1PCAA 1VHEA 3VARA 3BI1A 4R6TA 1LCPA 3EW5A 2C6CA 3KI9A 3GPGA 1CG2A 2AFZA 1HJZA 4OC4A 1R43A 4OIDA 3EWPA 3D4UA 4OC0A 1ELLP 3EJFA 4RUHA 3CT9A 5HOLA 3CPAA 5CB5A 3WT4A 3PFEA 3EJGA 3SJEA 1NSAA 3D68A 3SJFA 1XMBA 2FXKA 4OC2A 3SI1A 5HVHA 1GYTA 1ZG7A 5FSZA 5DUSA 3DGVA 4JZ0A 3EKEA 2JEWA 2VRIA 4EMEA 2PJAA 4KYBA 4ESSA 3TX8A 7CPAA 3VH9A 4GVVA 5LYIA 4MHZA 1OBRA 2Q43A 3PFOA 5LRJA 1XJOA 3PBEA 1AMPA 1Z5RA 2F7VA 5LYFA 2GLJA 3MN8A 4AXVA 2IMOA 3ETIA 3WC6A 3T8WA 4LQGA 4UEZA 3B3TA 3IC1A 1IGBA 3RZAA 4MRIA 4WWVA 4P10A 2XEIA 4PPZA 5CBMA 3FX6A 5JM6A 3PB8X 2JBKA 2POKA 2RFHA 3KASA 4P45A 3SI2A 5K8PA 3GUXA 2C6GA 4MHPA 2BFQA 4R76A 1R3NA 1TKHA 1Z2LA 2PJ8A 3MRUA 3H8EA 2CTCA 3IWWA 3SJGA 2FG1A 3B35A 4ZX8A 4YWYA 4DUKA 2CTBA 4G1PA 3K2KA 2AFWA 3FF3A 4UIBA 4NFRA 1F2PA 4X2TA 4ETJA 2BFRA 4UEEA 3SJXA 4A94A 1BPMA 4R8FA 2PCUA 4F9VA 2PE3A 3FEEA 1VHUA 2BOAA 1KWMA 2XEGA 1VHOA 3EWQA 1DE4C 4F8ZA 2OR4A 1RTQA 4J5QA 1FNOA 4NGTA 2VL1A 2DEAA 4NJRA 4K0CA 1JQGA 1XRYA 3N5FA 2C1CA 2QVPA 3JZTA 4ZY2A 3B3WA 2J9AA 3SI0A 3VATA 1TXRA 3SIGA 2O4HA 4K3NA 2NYQA 2AFXA 5LYLA 3RBUA 4ABLA 2PJ1A 4OMEA 5HXDA 3D7DA 3NH5A 2WZNA 1CP7A 2ZOFA 3CPXA 3D7GA 1ZLHA 3LMSA 2PVWA 3NH4A 1ARLA 3I1UA 3NH8A 2ACFA 5HIHA 2V8GA 4TWEA 3GQOA 2F8HA 2X47A 6CPAA 3PBBA 1H8LA 1Z8LA 2ZENA 4IHMA 4PQAA 2HB6A 5CB3A 2PIYA 4OC3A 1M4LA 5K8MA 4DJLA 1Y0RA 3GLJA 3KGQA 4J5RA 3IJ3A 1AYEA 4O23A 4DYOA 3DLJA 3ISXA 1BLLE 4FUUA 4P4BA 4UEFA 3JRUA 2NSMA 4CPAA 2GREA 3EWRA 3KL9A 4NJQA 2DX6A 1QMUA 3D67A 4JGKA 2PRQA 3D7FA 3S9LA 4UIAA 1CPXA 2O53A 5ELYA 5FSXA 5HVGA 4W9YA 3S9NA 3B3VA 2FAVA 3SIIA 2L8RA 4MHYA 4OC5A 2V8DA 1CP6A 1ZLIA 2QJ8A 5K8NA 2PJ3A 4X3RA 1HDUA 3IIDA 1SPVA 5CPAA 2Q51A 4JYWA 4D86A 3WC5A 4ZY0A 1VGYA 3FH4A 2EK8A 8CPAA 2WYRA 3PB4X 3KR4A 1TY8A 2ZEOA 5E3BA 2XEJA 4EWTA 4YU9A 3GQEA 2CF4A 5IB9A 4R7MA 4A38A 3PB9X 1IY7A 2XD7A 4NGQA 4JCAA 1VIXA 3BI0A 1UWYA 4ABKA 1QQ9A 3L2NA 3NFZA 4OP4A 4P4DA 3SIHA 5J1QA 1CBXA 4BD9A 1YSJA 4NGPA 1EE3P 1Q7LA 3H8GA 2AFSA 4NGSA 2V77A 1ZG8A 3FMCA 1TKFA 3GB0A 2C6PA 3PB6X 4PXCA 4J5SA 4F9UA 3CDXA 4GVWA 2FVGA 3Q6ZA 4TNUA 2PVVA 3KHXA 5I4MA 2PJ4A 2PJ7A 2ANPA 3GPOA 2QYVA 5CMSA 3D7HA 5DS0A 1NJRA 5AILA 3TC8A 3KQZA 1ZG9A 1XBUA 2V8VA 2XEFA 3B3CA 2EK9A 1F57A 4P4JA 4P4IA 5K8OA 2ZELA 1YW4A 2G9DA 1LAPA 2EEEA 3QNVA 2CIJA 3V45A 2IQ6A 2ZEFA 2ZEGA 1TXZA 3K9TA 2PJCA 4MCRA 2I3CA 2AFMA 4JVVA 2PJ9A 2HC9A 4Z65A 3BHXA 4A37A 2EWBA 3RAMA 4P4EA 1DTDA 2ZEHA 4EFDA 4UMLA 5JGFA 4OC1A 1BAVA 4J4ZA 4MXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YME A;  2ABZ A;  4FAI A;  2Q4Z A;  3SIJ A;  2IJZ A;  4KSI A;  4X8I A;  4IQY A;  5JH9 A;  4Q7A A;  3IIB A;  3PB7 X;  5HVF A;  4MMO A;  1ARM A;  3V2B A;  1Y7E A;  5FSV A;  3KZW A;  1FT7 A;  1HEE A;  2AFO A;  4ONW A;  4PXE A;  3V7Z A;  1CX8 A;  3PRT A;  5D8N A;  3HUV A;  1TKJ A;  2PJ0 A;  2ZED A;  3IEH A;  4JLL A;  1YLO A;  4MCS A;  1LAM A;  4MCP A;  1LFW A;  2ZEM A;  5FSY A;  4P44 A;  4P4F A;  3V38 A;  1ZR5 A;  3D66 A;  1ELM P;  1HDQ A;  5LRG A;  2BCO A;  4GM5 A;  4ZI6 A;  3NA6 A;  1CPS A;  3B3S A;  3S9M A;  1ZR3 A;  4ETK A;  3Q71 A;  2RB7 A;  3WAB A;  3IIF A;  4FBE A;  3H8F A;  4MHN A;  3ISZ A;  3EWO A;  4GUA A;  3FED A;  4OIW A;  4OKO A;  2AFC A;  4UF4 A;  4FWU A;  4IAV A;  1YW6 A;  5THW A;  2AFU A;  1TF8 A;  2PJ2 A;  2BO9 A;  4ZX9 A;  2PJ5 A;  1F2O A;  2ZEP A;  4PXB A;  4TU0 A;  1XFO A;  3B7I A;  4B6Z A;  2PJ6 A;  3B2Y A;  3BXM A;  4NGN A;  1Y0Y A;  2ZOG A;  4WJB A;  3GPQ A;  3KR5 A;  5D29 A;  2GU2 A;  2JBJ A;  4NGR A;  2ZEE A;  5F09 A;  4ZY1 A;  3VFQ A;  4NGM A;  2LGR A;  4H2K A;  3HLP A;  1LOK A;  4P6Y A;  3KQX A;  2PIZ A;  3FVL A;  1YD9 A;  2OOT A;  1TF9 A;  5LYD A;  4ZYQ A;  2V8H A;  3FEC A;  3IFE A;  1LAN A;  3PEI A;  1PYT B;  3FJU A;  1BPN A;  3WC7 A;  4A39 A;  3LWU A;  2PJB A;  4PXD A;  5LRK A;  4MCQ A;  5FSU A;  4IK2 A;  3KHZ A;  3IO1 A;  2GLF A;  1PCA A;  1VHE A;  3VAR A;  3BI1 A;  4R6T A;  1LCP A;  3EW5 A;  2C6C A;  3KI9 A;  3GPG A;  1CG2 A;  2AFZ A;  1HJZ A;  4OC4 A;  1R43 A;  4OID A;  3EWP A;  3D4U A;  4OC0 A;  1ELL P;  3EJF A;  4RUH A;  3CT9 A;  5HOL A;  3CPA A;  5CB5 A;  3WT4 A;  3PFE A;  3EJG A;  3SJE A;  1NSA A;  3D68 A;  3SJF A;  1XMB A;  2FXK A;  4OC2 A;  3SI1 A;  5HVH A;  1GYT A;  1ZG7 A;  5FSZ A;  5DUS A;  3DGV A;  4JZ0 A;  3EKE A;  2JEW A;  2VRI A;  4EME A;  2PJA A;  4KYB A;  4ESS A;  3TX8 A;  7CPA A;  3VH9 A;  4GVV A;  5LYI A;  4MHZ A;  1OBR A;  2Q43 A;  3PFO A;  5LRJ A;  1XJO A;  3PBE A;  1AMP A;  1Z5R A;  2F7V A;  5LYF A;  2GLJ A;  3MN8 A;  4AXV A;  2IMO A;  3ETI A;  3WC6 A;  3T8W A;  4LQG A;  4UEZ A;  3B3T A;  3IC1 A;  1IGB A;  3RZA A;  4MRI A;  4WWV A;  4P10 A;  2XEI A;  4PPZ A;  5CBM A;  3FX6 A;  5JM6 A;  3PB8 X;  2JBK A;  2POK A;  2RFH A;  3KAS A;  4P45 A;  3SI2 A;  5K8P A;  3GUX A;  2C6G A;  4MHP A;  2BFQ A;  4R76 A;  1R3N A;  1TKH A;  1Z2L A;  2PJ8 A;  3MRU A;  3H8E A;  2CTC A;  3IWW A;  3SJG A;  2FG1 A;  3B35 A;  4ZX8 A;  4YWY A;  4DUK A;  2CTB A;  4G1P A;  3K2K A;  2AFW A;  3FF3 A;  4UIB A;  4NFR A;  1F2P A;  4X2T A;  4ETJ A;  2BFR A;  4UEE A;  3SJX A;  4A94 A;  1BPM A;  4R8F A;  2PCU A;  4F9V A;  2PE3 A;  3FEE A;  1VHU A;  2BOA A;  1KWM A;  2XEG A;  1VHO A;  3EWQ A;  1DE4 C;  4F8Z A;  2OR4 A;  1RTQ A;  4J5Q A;  1FNO A;  4NGT A;  2VL1 A;  2DEA A;  4NJR A;  4K0C A;  1JQG A;  1XRY A;  3N5F A;  2C1C A;  2QVP A;  3JZT A;  4ZY2 A;  3B3W A;  2J9A A;  3SI0 A;  3VAT A;  1TXR A;  3SIG A;  2O4H A;  4K3N A;  2NYQ A;  2AFX A;  5LYL A;  3RBU A;  4ABL A;  2PJ1 A;  4OME A;  5HXD A;  3D7D A;  3NH5 A;  2WZN A;  1CP7 A;  2ZOF A;  3CPX A;  3D7G A;  1ZLH A;  3LMS A;  2PVW A;  3NH4 A;  1ARL A;  3I1U A;  3NH8 A;  2ACF A;  5HIH A;  2V8G A;  4TWE A;  3GQO A;  2F8H A;  2X47 A;  6CPA A;  3PBB A;  1H8L A;  1Z8L A;  2ZEN A;  4IHM A;  4PQA A;  2HB6 A;  5CB3 A;  2PIY A;  4OC3 A;  1M4L A;  5K8M A;  4DJL A;  1Y0R A;  3GLJ A;  3KGQ A;  4J5R A;  3IJ3 A;  1AYE A;  4O23 A;  4DYO A;  3DLJ A;  3ISX A;  1BLL E;  4FUU A;  4P4B A;  4UEF A;  3JRU A;  2NSM A;  4CPA A;  2GRE A;  3EWR A;  3KL9 A;  4NJQ A;  2DX6 A;  1QMU A;  3D67 A;  4JGK A;  2PRQ A;  3D7F A;  3S9L A;  4UIA A;  1CPX A;  2O53 A;  5ELY A;  5FSX A;  5HVG A;  4W9Y A;  3S9N A;  3B3V A;  2FAV A;  3SII A;  2L8R A;  4MHY A;  4OC5 A;  2V8D A;  1CP6 A;  1ZLI A;  2QJ8 A;  5K8N A;  2PJ3 A;  4X3R A;  1HDU A;  3IID A;  1SPV A;  5CPA A;  2Q51 A;  4JYW A;  4D86 A;  3WC5 A;  4ZY0 A;  1VGY A;  3FH4 A;  2EK8 A;  8CPA A;  2WYR A;  3PB4 X;  3KR4 A;  1TY8 A;  2ZEO A;  5E3B A;  2XEJ A;  4EWT A;  4YU9 A;  3GQE A;  2CF4 A;  5IB9 A;  4R7M A;  4A38 A;  3PB9 X;  1IY7 A;  2XD7 A;  4NGQ A;  4JCA A;  1VIX A;  3BI0 A;  1UWY A;  4ABK A;  1QQ9 A;  3L2N A;  3NFZ A;  4OP4 A;  4P4D A;  3SIH A;  5J1Q A;  1CBX A;  4BD9 A;  1YSJ A;  4NGP A;  1EE3 P;  1Q7L A;  3H8G A;  2AFS A;  4NGS A;  2V77 A;  1ZG8 A;  3FMC A;  1TKF A;  3GB0 A;  2C6P A;  3PB6 X;  4PXC A;  4J5S A;  4F9U A;  3CDX A;  4GVW A;  2FVG A;  3Q6Z A;  4TNU A;  2PVV A;  3KHX A;  5I4M A;  2PJ4 A;  2PJ7 A;  2ANP A;  3GPO A;  2QYV A;  5CMS A;  3D7H A;  5DS0 A;  1NJR A;  5AIL A;  3TC8 A;  3KQZ A;  1ZG9 A;  1XBU A;  2V8V A;  2XEF A;  3B3C A;  2EK9 A;  1F57 A;  4P4J A;  4P4I A;  5K8O A;  2ZEL A;  1YW4 A;  2G9D A;  1LAP A;  2EEE A;  3QNV A;  2CIJ A;  3V45 A;  2IQ6 A;  2ZEF A;  2ZEG A;  1TXZ A;  3K9T A;  2PJC A;  4MCR A;  2I3C A;  2AFM A;  4JVV A;  2PJ9 A;  2HC9 A;  4Z65 A;  3BHX A;  4A37 A;  2EWB A;  3RAM A;  4P4E A;  1DTD A;  2ZEH A;  4EFD A;  4UML A;  5JGF A;  4OC1 A;  1BAV A;  4J4Z A;  4MXU A; 
#chains in the Genus database with same CATH topology
 1YME A;  4R3L A;  2ABZ A;  4FAI A;  2Q4Z A;  4KOW A;  2R7H A;  3DSB A;  3SIJ A;  3IGR A;  3R9G A;  1PU9 A;  3S6G A;  1X12 A;  2IJZ A;  3EO4 A;  2CXA A;  3NE8 A;  4KOR A;  3IU1 A;  1S60 A;  4KSI A;  4NCZ A;  4Q36 A;  4X8I A;  4IQY A;  5JH9 A;  3LOD A;  4Q7A A;  2PC1 A;  5F49 A;  3IIB A;  3PB7 X;  2GIV A;  2REE A;  2D4P A;  5HVF A;  5G1Z A;  5KTD A;  4NEX A;  4MMO A;  2RNK A;  1ARM A;  3V2B A;  1Y7E A;  5FSV A;  3KZW A;  1FT7 A;  2R8V A;  2HV2 A;  5IB0 A;  1HEE A;  3RZA A;  1Q2Y A;  2AFO A;  4ONW A;  1P0H A;  4U9Y A;  4PXE A;  4B5P B;  3GIU A;  3V7Z A;  2H5M A;  4LX9 A;  1CX8 A;  2CNM A;  2VQY A;  5D8N A;  3HUV A;  1XIX A;  3PRT A;  2JZD A;  1TKJ A;  2PJ0 A;  1IU8 A;  3RYO A;  3H4Q A;  2ZED A;  3IEH A;  2DPS A;  4JLL A;  1YLO A;  1IID A;  4CGO A;  2OZG A;  4MCS A;  4UA3 A;  3D3S A;  1LAM A;  5AGE A;  5KTC A;  4MCP A;  3PZJ A;  1LFW A;  2ZEM A;  4KOT A;  4RS2 A;  5FSY A;  1I12 A;  4P44 A;  4P4F A;  3V38 A;  5KTA A;  1ZR5 A;  3D66 A;  4KLW A;  1ELM P;  1HDQ A;  1IYK A;  2P6F A;  2BCO A;  2YNC A;  5LRG A;  4GM5 A;  4ZI6 A;  1YX0 A;  3NA6 A;  1CPS A;  4GS4 A;  1Y7R A;  3B3S A;  4R87 A;  4KSA A;  3S9M A;  2G3A A;  4B14 A;  1ZR3 A;  4ETK A;  2A4N A;  2CY2 A;  3Q71 A;  2RB7 A;  3WAB A;  2FIA A;  3IIF A;  4KVO E;  4MFJ A;  4FBE A;  1Z9U A;  3H8F A;  4MHN A;  3ISZ A;  1P4N A;  2JDC A;  4QUS A;  2Z3N A;  4U9Z A;  3EWO A;  4M3S A;  3TO9 A;  4GUA A;  2DXQ A;  3FED A;  2HUZ A;  2KQV A;  1XE4 A;  4OIW A;  4OKO A;  2AFC A;  4UF4 A;  3R96 A;  4FWU A;  4KUA A;  4IAV A;  1M44 A;  1YW6 A;  2QEC A;  2Z0Z A;  2AFU A;  5THW A;  2OB0 A;  1TF8 A;  4A33 A;  2PJ2 A;  1K4J A;  3BLN A;  2BUE A;  4AG9 A;  2BO9 A;  4A2Z A;  4ZX9 A;  2FS5 A;  3EXN A;  2PJ5 A;  1F2O A;  5C82 A;  4FD4 A;  3JVN A;  4KSF A;  2ZEP A;  4PXB A;  4TU0 A;  1XFO A;  3B7I A;  4B6Z A;  2PJ6 A;  3B2Y A;  3BXM A;  4NGN A;  1Y0Y A;  1QSR A;  2ZOG A;  4WJB A;  4KVX A;  3GPQ A;  4CAV A;  3R9E A;  3KR5 A;  2HQY A;  1ZO0 A;  5D29 A;  2GU2 A;  2JBJ A;  4CGP A;  4NGR A;  2ZEE A;  2VXK A;  2DF5 A;  2D4O A;  2ZW6 A;  5F09 A;  4C2X A;  4ZY1 A;  2WCT A;  3VFQ A;  1L0C A;  2B58 A;  1QST A;  3FXT A;  4KOX A;  4NGM A;  3TT2 A;  4L89 A;  2LGR A;  4H2K A;  5JQ4 A;  3B8G A;  3HLP A;  1LOK A;  4P6Y A;  4UFV A;  1A2Z A;  2VEZ A;  3KQX A;  1YK3 A;  2PIZ A;  3FVL A;  4KZT A;  1YD9 A;  2OOT A;  3GYA A;  2B4D B;  1TF9 A;  2F5I A;  2Z3O A;  5LYD A;  2ZXV A;  3C26 A;  4ZYQ A;  2C27 A;  2V8H A;  3FEC A;  4MFK A;  3FRM A;  3IFE A;  1IB1 E;  5F46 A;  3TOA A;  1LAN A;  5BWA B;  5IV0 A;  1S7N A;  3PEI A;  1PYT B;  2VBQ A;  1BPN A;  3FJU A;  4AB7 A;  3FNC A;  3WC7 A;  4A39 A;  2Q44 A;  3TOB A;  2B4B A;  3LWU A;  2PJB A;  4PXD A;  5LRK A;  1WK4 A;  4MCQ A;  5FSU A;  4IK2 A;  4EVY A;  1RO5 A;  2KCW A;  3KHZ A;  2ZPA A;  4XPD B;  2GAN A;  3IO1 A;  2GLF A;  3EY5 A;  4UCP A;  1PCA A;  5AG7 A;  1Z8X A;  3PP9 A;  2Z3M A;  4JWP A;  1VHE A;  3VAR A;  1BO4 A;  3BI1 A;  5GCN A;  4R6T A;  3S6K A;  1XOV A;  3JUW A;  2FL4 A;  1LCP A;  3EW5 A;  1CM0 A;  2C6C A;  3KI9 A;  2B5G A;  4AVB A;  4MFZ A;  3GPG A;  1I1D A;  3DR8 A;  1CG2 A;  2AFZ A;  2X7B A;  4C68 A;  1HJZ A;  1Y9K A;  2RC4 A;  1XEB A;  4K30 A;  3PGP A;  4OC4 A;  1R43 A;  4OID A;  3EWP A;  3D4U A;  4OC0 A;  1N71 A;  4FD5 A;  1ELL P;  1M1D A;  1M4I A;  4MFL A;  4XPL A;  3EJF A;  2R98 A;  4RUH A;  1QSO A;  3CT9 A;  4PSX A;  5HOL A;  3CPA A;  5CB5 A;  4PK2 A;  3PFE A;  3EJG A;  3SJE A;  3WT4 A;  1NSA A;  3D68 A;  4H6Z A;  2P6G A;  2P0W A;  1M4G A;  4U5Y A;  4BIN A;  1IOI A;  3SJF A;  4CYP A;  1XMB A;  2FXK A;  2B3U A;  4OC2 A;  3SI1 A;  5HVH A;  1GYT A;  4H89 A;  4QBJ A;  4HNX B;  2JZF A;  1ZG7 A;  5FSZ A;  2ZW5 A;  5DUS A;  3DGV A;  3I9S A;  3KKW A;  4I49 A;  4JZ0 A;  5EC4 A;  3P2H A;  3EKE A;  2JEW A;  3D7H A;  1NSL A;  3SHP A;  4FD6 A;  4ZBG A;  4B5O A;  2VRI A;  2QML A;  4EME A;  3R95 A;  5FVJ A;  3F0A A;  4PV6 A;  3LD2 A;  2PJA A;  1VKC A;  4YRH A;  2EBJ A;  5ISV A;  2JZE A;  4KYB A;  4ESS A;  3TX8 A;  7CPA A;  3VH9 A;  4GVV A;  3RO0 A;  5LYI A;  4MHZ A;  3TE4 A;  1OBR A;  2I79 A;  4JXR A;  2JLM A;  2Q43 A;  3PFO A;  3CZX A;  1LRZ A;  4B5P A;  5LRJ A;  1XJO A;  4M6H A;  5HMN A;  3PBE A;  2ZW7 A;  4ORF A;  3WR7 A;  4MBU A;  4C2Z A;  3F8K A;  5E96 A;  1AMP A;  4IF5 A;  1Z5R A;  1PUA A;  4NXY A;  1NMT A;  2F7V A;  1I21 A;  2GLJ A;  3MN8 A;  4AXV A;  2IMO A;  5LYF A;  3S6F A;  3ETI A;  3WC6 A;  3T8W A;  2FIW A;  4LQG A;  2WSA A;  4UEZ A;  1MJ9 A;  3B3T A;  3IC1 A;  1IGB A;  3EFA A;  1Z8W A;  3QAH A;  2REF A;  4MRI A;  4WWV A;  5G22 A;  4P10 A;  2XEI A;  3D2M A;  5CBM A;  1AUG A;  3FX6 A;  4PPZ A;  3W6S A;  5JM6 A;  3T9Y A;  2OZH A;  2YNC C;  3D8P A;  3PB8 X;  2JBK A;  2POK A;  2RFH A;  3KAS A;  4P45 A;  3SI2 A;  5K8P A;  1MJA A;  3GUX A;  5H86 A;  2P6E A;  4PK3 A;  4JJX A;  2C6G A;  4MHP A;  2BFQ A;  4A30 A;  5G21 A;  4ZGY B;  4R76 A;  1R3N A;  1TKH A;  2G0B A;  2Z3P A;  1Z2L A;  2PJ8 A;  4MJ8 A;  3MRU A;  3CXS A;  4PSW A;  4KLV A;  3NE7 A;  4A31 A;  3H8E A;  1KUV A;  4Y49 C;  2CTC A;  3IWW A;  3SJG A;  2FG1 A;  4M6G A;  3B35 A;  4ZX8 A;  4UWJ A;  4YWY A;  1CJW A;  1KUX A;  4DUK A;  1B87 A;  2CTB A;  4G1P A;  1MJB A;  3S6H A;  3K2K A;  2CNS A;  2AFW A;  2VZZ A;  2GFQ A;  2W2G A;  3DDD A;  3FF3 A;  4UIB A;  4F0Y A;  1J4J A;  4NFR A;  1FY7 A;  3ZZI A;  1YVK A;  4UCN A;  1F2P A;  2AJ6 A;  3CXQ A;  4NF1 A;  1GHE A;  1YR0 A;  4X2T A;  3FYN A;  3SXN A;  4ETJ A;  2BFR A;  2BSW A;  4UEE A;  3SJX A;  3CXP A;  4AG7 A;  4A94 A;  4B10 A;  3TTH A;  1BPM A;  4R8F A;  4XNH C;  2PCU A;  4CGN A;  4F9V A;  2PE3 A;  3FEE A;  4R3K A;  4B11 A;  1VHU A;  2BOA A;  1KWM A;  2CNT A;  2XEG A;  2PSW A;  1VHO A;  3T90 A;  1YRE A;  1Y9W A;  1XF8 A;  1S7F A;  4CAX A;  3EWQ A;  1DE4 C;  2FCK A;  3BJ7 A;  2OR4 A;  4F8Z A;  1RTQ A;  4J5Q A;  1FNO A;  4NGT A;  2VL1 A;  2VZY A;  1RXT A;  2DEA A;  3G8W A;  4CGM A;  4NJR A;  3JTK A;  4K0C A;  1JQG A;  1KUY A;  1XRY A;  3N5F A;  5EMI A;  4XPK A;  3TO6 A;  5C88 A;  2C1C A;  2QVP A;  3JZT A;  3K9U A;  4ZY2 A;  3B3W A;  1Q2C A;  2J9A A;  5J8F A;  4JD6 A;  4KVM E;  4LUA A;  3SI0 A;  3VAT A;  1TXR A;  2J8N A;  3SIG A;  1B6B A;  2Y0M A;  2O4H A;  4K3N A;  2NYQ A;  4RI1 A;  3TO7 A;  5A27 A;  2AFX A;  5LYL A;  4II9 A;  3RBU A;  4CS0 B;  4ABL A;  1NE9 A;  4FD7 A;  1QSN A;  4J3G A;  2PJ1 A;  3GY9 A;  1Z4R A;  4OME A;  2ODF A;  1BOB A;  5HXD A;  2OZU A;  2QIR A;  4H6U A;  3D7D A;  3NH5 A;  4JLY A;  2WZN A;  2Z11 A;  1CP7 A;  2ZOF A;  3CPX A;  2GE3 A;  3D7G A;  1ZLH A;  5IX3 A;  1YQE A;  3F5B A;  3TCV A;  3LMS A;  2PVW A;  1S5K A;  3NH4 A;  4YGO A;  1ARL A;  3I1U A;  1X10 A;  3NH8 A;  4CYO A;  4F6A A;  2JEV A;  2Q4V A;  4MI4 A;  2YNE A;  2ACF A;  1QSM A;  3W6X A;  4AVA A;  5HIH A;  2V8G A;  3FBU A;  3GQO A;  2EO8 A;  4HNW B;  2F8H A;  4TWE A;  5DWN A;  4YFJ A;  1S7K A;  2X47 A;  4MFQ A;  2B3V A;  6CPA A;  3PBB A;  1H8L A;  1Z8L A;  3DNS A;  4HNY B;  4QVT A;  3E0K A;  2FT0 A;  2WUU A;  3VWD A;  4CYN A;  4IUS A;  3UY5 A;  2DPT A;  2ZEN A;  4IHM A;  4C2Y A;  2Q04 A;  4PQA A;  2HB6 A;  5CB3 A;  1UFH A;  2PIY A;  4BMH A;  4C7H A;  1U6M A;  2IL4 A;  4B12 A;  4OC3 A;  2FSR A;  2FE7 A;  1M4L A;  2ATR A;  4OAD A;  5K8M A;  3R9F A;  4LQ6 A;  4DJL A;  4KOS A;  3GKR A;  1Y0R A;  3GLJ A;  3KGQ A;  4J5R A;  3IJ3 A;  1AYE A;  3N7Z A;  4O23 A;  3QAY A;  4DYO A;  3A9L A;  4MFP A;  3DLJ A;  3ISX A;  1BLL E;  2Q0Y A;  4FUU A;  4P4B A;  4E8O A;  4M6I A;  4UEF A;  4QC6 A;  3P2F A;  3JRU A;  2NSM A;  3R1K A;  4UBR A;  4CPA A;  2ARH A;  2GRE A;  1YLE A;  5A28 A;  3EWR A;  1YGH A;  3KL9 A;  4CAW A;  4NJQ A;  2DX6 A;  1QMU A;  2ZW4 A;  4KOU A;  2JDD A;  3TFY A;  3D67 A;  4JGK A;  2PRQ A;  3D7F A;  2Q4Y A;  4GXH A;  3S9L A;  4UIA A;  1SQH A;  5I0C A;  1TIQ A;  1CPX A;  2O53 A;  5ELY A;  4ONU A;  5FSX A;  4CRZ B;  5HVG A;  4W9Y A;  3W91 A;  5F47 A;  3S9N A;  3B3V A;  4OAE A;  2FAV A;  1OZP A;  3SII A;  2L8R A;  4MHY A;  4OC5 A;  4HKF A;  3VWE A;  5J8C A;  2V8D A;  1CP6 A;  1ZLI A;  2QJ8 A;  5K8N A;  2PJ3 A;  4X3R A;  1HDU A;  3IID A;  2PDO A;  1SPV A;  2WPX A;  5CPA A;  4E0A A;  2J8M A;  5G20 A;  1MK4 A;  2Q51 A;  2O28 A;  4JYW A;  4MY0 A;  4D86 A;  4KUB A;  4UFX A;  3WC5 A;  4ZY0 A;  1VGY A;  3FH4 A;  2EK8 A;  2EUI A;  2PR1 A;  8CPA A;  2WYR A;  1ON0 A;  1YVO A;  3PB4 X;  3KR4 A;  2BL1 A;  1TY8 A;  2ZEO A;  4Y49 B;  5E3B A;  4JXQ A;  5AG4 A;  3V8I A;  2XEJ A;  5CNP A;  4RN7 A;  4EWT A;  4YU9 A;  2R1I A;  3GQE A;  2CF4 A;  3DR6 A;  5IB9 A;  1Z4E A;  4R7M A;  4A38 A;  5AG5 A;  1XMT A;  3PB9 X;  4BBH A;  3LAC A;  1IY7 A;  2Q7S A;  2XD7 A;  3IWG A;  4NGQ A;  4F0X A;  4JCA A;  4R9M A;  1VIX A;  1Z8T A;  5EBV A;  4CRY B;  5JPH A;  2Z3K A;  3BI0 A;  1UWY A;  4ABK A;  2Z3L A;  1QQ9 A;  3L2N A;  2J8R A;  4KOY A;  3NFZ A;  4OP4 A;  4P4D A;  3SIH A;  4E2A A;  5J1Q A;  4KS9 A;  2PR8 A;  2YGW A;  1CBX A;  4QB9 A;  1JWQ A;  1Q2D A;  1S3Z A;  3FB3 A;  1V0C A;  4XNH B;  4AVC A;  4BD9 A;  1YSJ A;  4NGP A;  2YND A;  1EE3 P;  1Q7L A;  4CAE A;  4A32 A;  3H8G A;  1VHS A;  2AFS A;  2PQ8 A;  4NGS A;  1IYL A;  4M85 A;  2V77 A;  1ZG8 A;  3FMC A;  1TKF A;  3GB0 A;  3IU2 A;  4UFW A;  2C6P A;  3PB6 X;  4PXC A;  4J5S A;  2FXF A;  4F9U A;  3CDX A;  4MHD A;  3D2P A;  4MY3 A;  4GVW A;  5H84 A;  2B4D A;  2FVG A;  3Q6Z A;  3QB8 A;  4TNU A;  2PVV A;  3KHX A;  5I4M A;  4R57 A;  2PJ4 A;  1IIC A;  2PJ7 A;  3IWE A;  3ZJ0 A;  2ANP A;  3GPO A;  2OH1 A;  5CMS A;  1R57 A;  2NMT A;  2QYV A;  1NJR A;  5AIL A;  2WPW A;  5DS0 A;  3KQZ A;  3TC8 A;  1ZG9 A;  1XBU A;  2V8V A;  2XEF A;  4OLL A;  2BEI A;  2AE6 A;  3B3C A;  2EK9 A;  1F57 A;  1S7L A;  4P4J A;  4P4I A;  2ZEL A;  5K8O A;  1WWZ A;  4UCM A;  1YW4 A;  2G9D A;  2EVN A;  4KOV A;  1LAP A;  2EEE A;  2Z10 A;  3QNV A;  2Q7B A;  2CIJ A;  3V45 A;  1IOF A;  5DWM A;  4CYQ A;  2IQ6 A;  2ZEF A;  2ZEG A;  4NSQ A;  2VI7 A;  4UWI A;  1M4D A;  2I00 A;  5AG6 A;  1TXZ A;  3FIX A;  3K9T A;  2PJC A;  4Q38 A;  2B5G B;  2K5T A;  4XPD C;  3OWC A;  4X5K A;  4CGL A;  4MCR A;  5F48 A;  2I3C A;  2AFM A;  4DNC A;  3BJ8 A;  4JVV A;  2PRB A;  2OU2 A;  3EC4 A;  4C7I A;  2PJ9 A;  2HC9 A;  4Z65 A;  3RNZ A;  3BHX A;  4A37 A;  2EWB A;  1KZF A;  4L8A A;  3RAM A;  4P4E A;  3SXO A;  2G3T A;  5HH1 A;  3G3S A;  4B13 A;  1DTD A;  2ZEH A;  4EFD A;  4UML A;  5JGF A;  4A95 A;  3MGD A;  3H5Z A;  3I3G A;  4HPS A;  1BAV A;  4OC1 A;  4J4Z A;  4MXU A;  4CAF A; 
#chains in the Genus database with same CATH homology
 1YME A;  2ABZ A;  4FAI A;  2Q4Z A;  3SIJ A;  2IJZ A;  4KSI A;  4X8I A;  4IQY A;  5JH9 A;  4Q7A A;  3IIB A;  3PB7 X;  5HVF A;  4MMO A;  1ARM A;  3V2B A;  1Y7E A;  5FSV A;  3KZW A;  1FT7 A;  1HEE A;  2AFO A;  4ONW A;  4PXE A;  3V7Z A;  1CX8 A;  3PRT A;  5D8N A;  3HUV A;  1TKJ A;  2PJ0 A;  2ZED A;  3IEH A;  4JLL A;  1YLO A;  4MCS A;  1LAM A;  4MCP A;  1LFW A;  2ZEM A;  5FSY A;  4P44 A;  4P4F A;  3V38 A;  1ZR5 A;  3D66 A;  1ELM P;  1HDQ A;  5LRG A;  2BCO A;  4GM5 A;  4ZI6 A;  3NA6 A;  1CPS A;  3B3S A;  3S9M A;  1ZR3 A;  4ETK A;  3Q71 A;  2RB7 A;  3WAB A;  3IIF A;  4FBE A;  3H8F A;  4MHN A;  3ISZ A;  3EWO A;  4GUA A;  3FED A;  4OIW A;  4OKO A;  2AFC A;  4UF4 A;  4FWU A;  4IAV A;  1YW6 A;  5THW A;  2AFU A;  1TF8 A;  2PJ2 A;  2BO9 A;  4ZX9 A;  2PJ5 A;  1F2O A;  2ZEP A;  4PXB A;  4TU0 A;  1XFO A;  3B7I A;  4B6Z A;  2PJ6 A;  3B2Y A;  3BXM A;  4NGN A;  1Y0Y A;  2ZOG A;  4WJB A;  3GPQ A;  3KR5 A;  5D29 A;  2GU2 A;  2JBJ A;  4NGR A;  2ZEE A;  5F09 A;  4ZY1 A;  3VFQ A;  4NGM A;  2LGR A;  4H2K A;  3HLP A;  1LOK A;  4P6Y A;  3KQX A;  2PIZ A;  3FVL A;  1YD9 A;  2OOT A;  1TF9 A;  5LYD A;  4ZYQ A;  2V8H A;  3FEC A;  3IFE A;  1LAN A;  3PEI A;  1PYT B;  3FJU A;  1BPN A;  3WC7 A;  4A39 A;  3LWU A;  2PJB A;  4PXD A;  5LRK A;  4MCQ A;  5FSU A;  4IK2 A;  3KHZ A;  3IO1 A;  2GLF A;  1PCA A;  1VHE A;  3VAR A;  3BI1 A;  4R6T A;  1LCP A;  3EW5 A;  2C6C A;  3KI9 A;  3GPG A;  1CG2 A;  2AFZ A;  1HJZ A;  4OC4 A;  1R43 A;  4OID A;  3EWP A;  3D4U A;  4OC0 A;  1ELL P;  3EJF A;  4RUH A;  3CT9 A;  5HOL A;  3CPA A;  5CB5 A;  3WT4 A;  3PFE A;  3EJG A;  3SJE A;  1NSA A;  3D68 A;  3SJF A;  1XMB A;  2FXK A;  4OC2 A;  3SI1 A;  5HVH A;  1GYT A;  1ZG7 A;  5FSZ A;  5DUS A;  3DGV A;  4JZ0 A;  3EKE A;  2JEW A;  2VRI A;  4EME A;  2PJA A;  4KYB A;  4ESS A;  3TX8 A;  7CPA A;  3VH9 A;  4GVV A;  5LYI A;  4MHZ A;  1OBR A;  2Q43 A;  3PFO A;  5LRJ A;  1XJO A;  3PBE A;  1AMP A;  1Z5R A;  2F7V A;  5LYF A;  2GLJ A;  3MN8 A;  4AXV A;  2IMO A;  3ETI A;  3WC6 A;  3T8W A;  4LQG A;  4UEZ A;  3B3T A;  3IC1 A;  1IGB A;  3RZA A;  4MRI A;  4WWV A;  4P10 A;  2XEI A;  4PPZ A;  5CBM A;  3FX6 A;  5JM6 A;  3PB8 X;  2JBK A;  2POK A;  2RFH A;  3KAS A;  4P45 A;  3SI2 A;  5K8P A;  3GUX A;  2C6G A;  4MHP A;  2BFQ A;  4R76 A;  1R3N A;  1TKH A;  1Z2L A;  2PJ8 A;  3MRU A;  3H8E A;  2CTC A;  3IWW A;  3SJG A;  2FG1 A;  3B35 A;  4ZX8 A;  4YWY A;  4DUK A;  2CTB A;  4G1P A;  3K2K A;  2AFW A;  3FF3 A;  4UIB A;  4NFR A;  1F2P A;  4X2T A;  4ETJ A;  2BFR A;  4UEE A;  3SJX A;  4A94 A;  1BPM A;  4R8F A;  2PCU A;  4F9V A;  2PE3 A;  3FEE A;  1VHU A;  2BOA A;  1KWM A;  2XEG A;  1VHO A;  3EWQ A;  1DE4 C;  4F8Z A;  2OR4 A;  1RTQ A;  4J5Q A;  1FNO A;  4NGT A;  2VL1 A;  2DEA A;  4NJR A;  4K0C A;  1JQG A;  1XRY A;  3N5F A;  2C1C A;  2QVP A;  3JZT A;  4ZY2 A;  3B3W A;  2J9A A;  3SI0 A;  3VAT A;  1TXR A;  3SIG A;  2O4H A;  4K3N A;  2NYQ A;  2AFX A;  5LYL A;  3RBU A;  4ABL A;  2PJ1 A;  4OME A;  5HXD A;  3D7D A;  3NH5 A;  2WZN A;  1CP7 A;  2ZOF A;  3CPX A;  3D7G A;  1ZLH A;  3LMS A;  2PVW A;  3NH4 A;  1ARL A;  3I1U A;  3NH8 A;  2ACF A;  5HIH A;  2V8G A;  4TWE A;  3GQO A;  2F8H A;  2X47 A;  6CPA A;  3PBB A;  1H8L A;  1Z8L A;  2ZEN A;  4IHM A;  4PQA A;  2HB6 A;  5CB3 A;  2PIY A;  4OC3 A;  1M4L A;  5K8M A;  4DJL A;  1Y0R A;  3GLJ A;  3KGQ A;  4J5R A;  3IJ3 A;  1AYE A;  4O23 A;  4DYO A;  3DLJ A;  3ISX A;  1BLL E;  4FUU A;  4P4B A;  4UEF A;  3JRU A;  2NSM A;  4CPA A;  2GRE A;  3EWR A;  3KL9 A;  4NJQ A;  2DX6 A;  1QMU A;  3D67 A;  4JGK A;  2PRQ A;  3D7F A;  3S9L A;  4UIA A;  1CPX A;  2O53 A;  5ELY A;  5FSX A;  5HVG A;  4W9Y A;  3S9N A;  3B3V A;  2FAV A;  3SII A;  2L8R A;  4MHY A;  4OC5 A;  2V8D A;  1CP6 A;  1ZLI A;  2QJ8 A;  5K8N A;  2PJ3 A;  4X3R A;  1HDU A;  3IID A;  1SPV A;  5CPA A;  2Q51 A;  4JYW A;  4D86 A;  3WC5 A;  4ZY0 A;  1VGY A;  3FH4 A;  2EK8 A;  8CPA A;  2WYR A;  3PB4 X;  3KR4 A;  1TY8 A;  2ZEO A;  5E3B A;  2XEJ A;  4EWT A;  4YU9 A;  3GQE A;  2CF4 A;  5IB9 A;  4R7M A;  4A38 A;  3PB9 X;  1IY7 A;  2XD7 A;  4NGQ A;  4JCA A;  1VIX A;  3BI0 A;  1UWY A;  4ABK A;  1QQ9 A;  3L2N A;  3NFZ A;  4OP4 A;  4P4D A;  3SIH A;  5J1Q A;  1CBX A;  4BD9 A;  1YSJ A;  4NGP A;  1EE3 P;  1Q7L A;  3H8G A;  2AFS A;  4NGS A;  2V77 A;  1ZG8 A;  3FMC A;  1TKF A;  3GB0 A;  2C6P A;  3PB6 X;  4PXC A;  4J5S A;  4F9U A;  3CDX A;  4GVW A;  2FVG A;  3Q6Z A;  4TNU A;  2PVV A;  3KHX A;  5I4M A;  2PJ4 A;  2PJ7 A;  2ANP A;  3GPO A;  2QYV A;  5CMS A;  3D7H A;  5DS0 A;  1NJR A;  5AIL A;  3TC8 A;  3KQZ A;  1ZG9 A;  1XBU A;  2V8V A;  2XEF A;  3B3C A;  2EK9 A;  1F57 A;  4P4J A;  4P4I A;  5K8O A;  2ZEL A;  1YW4 A;  2G9D A;  1LAP A;  2EEE A;  3QNV A;  2CIJ A;  3V45 A;  2IQ6 A;  2ZEF A;  2ZEG A;  1TXZ A;  3K9T A;  2PJC A;  4MCR A;  2I3C A;  2AFM A;  4JVV A;  2PJ9 A;  2HC9 A;  4Z65 A;  3BHX A;  4A37 A;  2EWB A;  3RAM A;  4P4E A;  1DTD A;  2ZEH A;  4EFD A;  4UML A;  5JGF A;  4OC1 A;  1BAV A;  4J4Z A;  4MXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...