3H8FA

High ph native structure of leucine aminopeptidase from pseudomonas putida
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
497
structure length
497
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cytosol aminopeptidase
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 168
structure length 497
sequence length 497
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8fA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8fA02
3HUVA 4P45A 3B3WA 1QMUA 4MCQA 2ZEFA 2IQ6A 4ZYQA 3VARA 1NJRA 3PB9X 2GU2A 3CPAA 5HVHA 2PIYA 5K8MA 4NJRA 3FF3A 4CPAA 2FVGA 4A37A 2ZENA 2ZEMA 4W9YA 1HDQA 4D86A 3VH9A 4DUKA 3S9LA 1YW6A 1AYEA 5D8NA 5LRJA 4MHZA 2Q51A 3GUXA 5K8OA 4P6YA 3SIJA 4K3NA 1KWMA 3GPQA 2JBKA 4F8ZA 1Y7EA 4ZY2A 1CP7A 4KYBA 2ZOFA 1TKFA 2V77A 5JM6A 3D7HA 3T8WA 3RZAA 3SIHA 1BLLE 4MCRA 3IIFA 4DJLA 4J5RA 1IY7A 1LCPA 1ZR3A 3GQOA 2AFOA 2ZELA 4UEEA 8CPAA 3SJGA 1GYTA 3TC8A 5CMSA 1ARMA 2PCUA 1Y0RA 3SJEA 1YMEA 3ISXA 1HEEA 4ETJA 2C1CA 3K9TA 1BAVA 5DUSA 1CP6A 3IEHA 4IAVA 2RB7A 2BO9A 2PJ2A 4UIBA 3FX6A 4A38A 3PBEA 3KZWA 4OKOA 2J9AA 4YWYA 2PJ3A 3FH4A 1TF8A 3CDXA 4JGKA 2I3CA 2AFCA 1VHUA 4GVVA 4JLLA 1TY8A 4Z65A 1ELMP 1OBRA 3IJ3A 3BXMA 2XEFA 4MHPA 4NFRA 2CIJA 2ANPA 4OC3A 4PQAA 4FUUA 4R8FA 3LMSA 2DEAA 2GREA 3SI2A 3B2YA 3EWOA 3SIIA 3IC1A 5I4MA 4H2KA 2EK9A 2EWBA 2WYRA 3D66A 3FJUA 4P4BA 3H8EA 2HC9A 3GPOA 5FSYA 3JRUA 2ZEGA 2RFHA 1M4LA 5FSZA 5CB5A 3PEIA 3Q71A 4NGMA 3NA6A 2V8VA 4P4EA 3V7ZA 2FAVA 5CBMA 2IMOA 1Z5RA 2NYQA 4J5SA 4TWEA 3L2NA 2PJ6A 1ZR5A 3TX8A 2PJ5A 4OP4A 3GLJA 4X3RA 4IK2A 2F7VA 2FXKA 4R76A 2C6GA 2PVVA 3BHXA 1AMPA 2Q43A 1F2PA 2ZEDA 4ONWA 4OC2A 1CPSA 3EJGA 3B7IA 4YU9A 5D29A 3WC5A 2ZEOA 1VHOA 5FSVA 4G1PA 4KSIA 5FSUA 5LRKA 4P4JA 2EK8A 3SJFA 4OC0A 3SIGA 4A94A 5LYLA 2PJ1A 3NH4A 2ZEHA 4R7MA 3QNVA 1YD9A 2AFUA 2PJ0A 1R43A 4JYWA 5K8NA 2XEGA 3B3TA 1NSAA 3B35A 3D67A 4IHMA 3SI1A 2WZNA 1XRYA 3EWPA 2FG1A 2ACFA 4PXEA 5LYDA 5HVFA 1F2OA 3K2KA 5HIHA 3NFZA 1ARLA 3VFQA 1ZG9A 3RBUA 2V8DA 3KR4A 1PCAA 1YSJA 1Z2LA 3PFEA 4JCAA 4OC1A 3EWQA 4O23A 5LRGA 1CX8A 3H8GA 2X47A 4MRIA 1LAMA 2V8GA 1CBXA 2XEJA 4ESSA 2PIZA 1QQ9A 5LYIA 4GUAA 1VHEA 4TNUA 3PFOA 1CG2A 5HOLA 5HXDA 3MRUA 2XD7A 3SJXA 5CB3A 2EEEA 3N5FA 3CT9A 5K8PA 3D4UA 2GLFA 3NH8A 4ABLA 1F57A 3ETIA 3EW5A 2CF4A 1TKJA 4GVWA 1LFWA 3S9MA 4UEFA 1BPMA 4ZX8A 4JZ0A 4P4FA 2XEIA 3MN8A 5LYFA 2PJ8A 1XBUA 7CPAA 5HVGA 4GM5A 3ISZA 2ZOGA 4R6TA 3PB6X 2L8RA 3D7FA 2ZEEA 4UMLA 4F9UA 4F9VA 1FT7A 2CTBA 4ETKA 3H8FA 1VIXA 2PJ9A 4ZY1A 4WWVA 3FMCA 2AFXA 2V8HA 3PB7X 4MHYA 2BOAA 3DGVA 1CPXA 4AXVA 3KQXA 3B3VA 4NGSA 4NGQA 1TKHA 3IFEA 1ZG7A 4FAIA 4ZX9A 2OOTA 5JGFA 2PJ7A 2BFRA 3DLJA 4P4IA 1JQGA 2F8HA 3S9NA 3GB0A 3CPXA 3NH5A 3HLPA 2QJ8A 2LGRA 2O4HA 1PYTB 3KI9A 2BCOA 4MCSA 3IIDA 4PXCA 1DTDA 3B3CA 2QVPA 3KL9A 3LWUA 2HB6A 3FEDA 1BPNA 4ZI6A 1VGYA 4UEZA 3V38A 3WC6A 4WJBA 3D68A 4OIDA 2NSMA 1ELLP 3KQZA 4J5QA 1IGBA 2ABZA 2PVWA 1YLOA 3WT4A 2PRQA 1UWYA 3EJFA 4EMEA 1HJZA 1TF9A 4PXBA 3Q6ZA 3EWRA 3IIBA 1TXZA 4MMOA 1ZLIA 3IWWA 3IO1A 1TXRA 4IQYA 2GLJA 1LOKA 2PJ4A 2C6CA 2BFQA 3V45A 3BI0A 4RUHA 3I1UA 1XFOA 5E3BA 2POKA 5ELYA 4PPZA 1Z8LA 3KR5A 4NGNA 4TU0A 3KHXA 2CTCA 3GPGA 3FVLA 3FECA 3KASA 4P4DA 3V2BA 3FEEA 3VATA 4DYOA 1FNOA 4OIWA 6CPAA 2PJCA 4UF4A 3BI1A 2AFWA 4NGRA 4X2TA 3B3SA 4OMEA 3WC7A 1Q7LA 2VL1A 3D7DA 2C6PA 4K0CA 4FWUA 3PB4X 5CPAA 4EFDA 1H8LA 1EE3P 2OR4A 2PJAA 3JZTA 5AILA 4A39A 1XMBA 3PB8X 1HDUA 2JEWA 1Y0YA 1SPVA 4PXDA 1XJOA 3D7GA 3WABA 4EWTA 2QYVA 4ABKA 1YW4A 5F09A 4MHNA 4NJQA 2IJZA 2AFZA 4JVVA 5DS0A 4Q7AA 3SI0A 1DE4C 2PJBA 1ZLHA 4P44A 4MCPA 2O53A 4OC5A 4J4ZA 1ZG8A 3KGQA 5J1QA 2JBJA 4B6ZA 1LANA 5IB9A 3RAMA 4NGTA 2VRIA 4BD9A 4UIAA 2Q4ZA 1R3NA 4OC4A 3PRTA 2AFMA 4LQGA 4MXUA 5FSXA 3GQEA 4P10A 4X8IA 2DX6A 3KHZA 1LAPA 2PE3A 3EKEA 4ZY0A 1RTQA 5JH9A 2AFSA 2G9DA 3PBBA 4FBEA 5THWA 4NGPA 2ZEPA
chains in the Genus database with same CATH superfamily
2VEZA 4LQ6A 2Q0YA 3HUVA 4A2ZA 4P45A 3B3WA 4JXQA 4UCMA 2JZFA 1QMUA 4FD6A 4MCQA 2ZEFA 4HKFA 2WCTA 3GYAA 2IQ6A 1Z9UA 4CAVA 4F0YA 4ZYQA 3VARA 1NJRA 3PB9X 2R98A 2Z10A 2GU2A 3CPAA 4MFJA 4B12A 2YGWA 5HVHA 4C2ZA 1BOBA 2PIYA 2W2GA 4NJRA 5K8MA 5C88A 4EVYA 3FF3A 5JQ4A 4CPAA 2FVGA 4A37A 5A28A 2ZENA 2ZEMA 2Z0ZA 3FB3A 4W9YA 1HDQA 5EBVA 4D86A 1XE4A 3VH9A 4DUKA 3S9LA 4IF5A 1YW6A 1AUGA 1AYEA 5D8NA 5LRJA 1XIXA 4MHZA 2Q51A 3GUXA 4KOXA 4FD5A 2Z3PA 3TOAA 5K8OA 1CJWA 2B5GB 3SIJA 4P6YA 5E96A 4K3NA 5ISVA 2BSWA 1KWMA 3GPQA 4NCZA 2JBKA 5AG6A 1Y7EA 4F8ZA 4ZY2A 2PSWA 1CP7A 5CNPA 4KYBA 2CNTA 2FSRA 2ZOFA 4XNHC 1TKFA 2V77A 4M6IA 5JM6A 2Z3OA 3D7HA 3T8WA 3RZAA 3SIHA 1BLLE 4MCRA 3IIFA 4DJLA 2JZDA 4J5RA 2EO8A 1B6BA 1IY7A 5G20A 1IU8A 5G1ZA 3P2HA 4NXYA 1Z4RA 2AE6A 3QAHA 3R9GA 1LCPA 1ZR3A 1S7LA 2IL4A 4CGOA 3GQOA 1S7FA 2AFOA 2R8VA 2ZELA 4UEEA 8CPAA 3SJGA 1GYTA 4UCPA 3TC8A 5CMSA 2QECA 1ARMA 2VBQA 1XMTA 3D3SA 2PCUA 1Y0RA 3FYNA 3SJEA 1YMEA 1KUXA 3ISXA 4AG9A 1HEEA 4ETJA 2C1CA 3K9TA 1BAVA 5DUSA 3PP9A 1CM0A 1P4NA 1CP6A 3IEHA 1NSLA 4IAVA 2REFA 2RB7A 3B8GA 1XEBA 2BO9A 2PJ2A 1YX0A 3S6KA 1Y9WA 4UIBA 7CPAA 3FX6A 3DR6A 4FD4A 4A38A 1V0CA 3R9FA 3NE7A 3IWEA 3PBEA 3KZWA 4OKOA 3ZZIA 2J9AA 2D4PA 4KS9A 4YWYA 1LRZA 2PJ3A 4QC6A 3FH4A 3BJ7A 1TF8A 3CDXA 4CYNA 4OAEA 4CGPA 4JGKA 2I3CA 3TX8A 4E2AA 2AFCA 4C2YA 2BUEA 3CZXA 1VHUA 4GVVA 4JLLA 2VXKA 1TY8A 4Z65A 1ELMP 3TO7A 2RC4A 1M4GA 1OBRA 3IJ3A 5F48A 2OZGA 2G0BA 3BXMA 1I12A 1MJBA 2XEFA 4MHPA 4NEXA 4NFRA 4AVCA 2CIJA 3VWEA 5DWNA 4KUBA 3W6SA 4CYQA 1KUVA 4U9ZA 3GIUA 2ANPA 4A31A 4OC3A 4PQAA 4FUUA 1GHEA 3R1KA 4R8FA 1YLEA 4KVXA 3LMSA 4Y49C 3LACA 1Q2DA 2DEAA 2B58A 2GREA 3B2YA 3SI2A 3EWOA 3SIIA 1IICA 4ZGYB 3IC1A 4CGMA 5I4MA 4H2KA 1OZPA 3SXOA 3S6FA 4C7HA 2EK9A 2EWBA 2K5TA 2WYRA 3D66A 2ZXVA 3FJUA 4P4BA 3H8EA 5KTAA 2HC9A 3GPOA 2B4DA 1RXTA 2ATRA 5FSYA 2G3TA 3JRUA 3W6XA 2ZEGA 5F47A 2RFHA 1M4LA 3RYOA 4F6AA 3F0AA 3IU1A 5FSZA 5CB5A 3PEIA 3Q71A 2FE7A 4LUAA 4NGMA 2ODFA 3NA6A 1Z8XA 2FS5A 2V8VA 4P4EA 1M4IA 3GKRA 3V7ZA 2FAVA 5CBMA 2HUZA 2VZZA 1YK3A 2IMOA 1Z5RA 2NYQA 3JVNA 4GXHA 4UCNA 4A30A 3FXTA 4J5SA 4RS2A 4TWEA 3L2NA 2PJ6A 2PRBA 1ZR5A 2HV2A 2PQ8A 2Z3MA 5EC4A 2PJ5A 4H6UA 2JEVA 3GLJA 4IK2A 2F7VA 4OP4A 4X3RA 3TOBA 5KTCA 2YNDA 2GFQA 2FXKA 4R76A 2C6GA 2PVVA 4MFPA 3BHXA 4CRYB 1AMPA 1XF8A 2Q43A 4DNCA 4ONUA 4KOYA 1F2PA 2ZEDA 4ONWA 2B3VA 1M4DA 1P0HA 3ZJ0A 4OC2A 1CPSA 3EJGA 3B7IA 4YU9A 5D29A 3WC5A 4PSWA 1BO4A 1VHOA 2R7HA 5FSVA 2ZEOA 1B87A 4OLLA 2B3UA 1KUYA 4G1PA 4KSIA 5FSUA 5LRKA 4P4JA 2EK8A 2REEA 1QSMA 4OC0A 2CNMA 3SJFA 5A27A 3H4QA 4ORFA 3SIGA 4A94A 1X10A 2P6GA 3OWCA 5LYLA 2PJ1A 4PV6A 2Z11A 2EVNA 3NH4A 2ZEHA 4R7MA 3QNVA 1Z8TA 1YD9A 2AFUA 2PJ0A 4BBHA 4CAEA 1R43A 3E0KA 1N71A 1S60A 4JYWA 4X5KA 2I00A 2R1IA 4PK3A 4UFVA 2OB0A 5K8NA 2ZW5A 2XEGA 4YGOA 3B3TA 2JDCA 1NSAA 4HNYB 4A33A 1QSRA 2ZW6A 4GS4A 4M3SA 1IYKA 2WPXA 3B35A 4MHDA 3D67A 3FRMA 4XPDB 4IHMA 3SI1A 2QIRA 2WZNA 3PGPA 1XRYA 5KTDA 3EWPA 1Z4EA 2FG1A 2ACFA 4NF1A 4PXEA 1M1DA 5LYDA 2J8NA 4KOUA 4B5OA 5HVFA 3SXNA 4M85A 1F2OA 4QUSA 4A32A 3K2KA 5HIHA 3NFZA 5FVJA 4UFXA 3CXQA 3FIXA 1ARLA 3TTHA 3VFQA 3RO0A 2KQVA 4H89A 1ZG9A 2F5IA 2GANA 2YNCC 4JD6A 2V8DA 3RBUA 3SHPA 4HPSA 3IU2A 2ZW4A 2Q4YA 3D8PA 1NE9A 1S3ZA 3IGRA 3KR4A 1PCAA 1YSJA 4CGNA 4CAXA 1Z2LA 3PFEA 2FL4A 3FNCA 4JCAA 4KOTA 3IWGA 3TCVA 4M6HA 4MFQA 4OC1A 3EWQA 5G22A 4O23A 3T90A 5LRGA 1CX8A 1TIQA 4F0XA 3R9EA 4JLYA 4MJ8A 3H8GA 2X47A 4MRIA 4B10A 4YFJA 1LAMA 2V8GA 1CBXA 5IX3A 2XEJA 4ESSA 2DPTA 1YREA 2KCWA 2PIZA 1Y7RA 1S7KA 1QQ9A 5LYIA 1IIDA 4E0AA 4GUAA 4JXRA 5AG7A 1VHEA 4B5PA 4MBUA 4U9YA 4TNUA 3PFOA 1CG2A 5HOLA 5HXDA 3MRUA 4BINA 5I0CA 3TFYA 3BJ8A 2XD7A 3SJXA 3V8IA 5CB3A 2EEEA 3N5FA 4XPDC 3TO9A 3CT9A 4KZTA 5K8PA 3D4UA 2GLFA 4B11A 2GE3A 1L0CA 3NH8A 4ZBGA 4ABLA 1F57A 1YVOA 3ETIA 2DF5A 2VQYA 3EW5A 2CF4A 1TKJA 4GVWA 1LFWA 4MFLA 3S9MA 4UEFA 2RNKA 2Q44A 1BPMA 4ZX8A 4JZ0A 3UY5A 4P4FA 2CNSA 2XEIA 4MY0A 3MN8A 2FT0A 5LYFA 3TE4A 1J4JA 2PC1A 1XBUA 2PJ8A 2PR8A 2Z3KA 4GM5A 3ISZA 5HH1A 3QAYA 3R96A 5HVGA 2ZOGA 4R6TA 3CXPA 2FIAA 3PB6X 1VHSA 4FD7A 4KLWA 4U5YA 2L8RA 1ZO0A 3D7FA 3PZJA 3MGDA 2ZEEA 4UMLA 3CXSA 4F9UA 1ON0A 4F9VA 4Q38A 1FT7A 1MK4A 2ARHA 3DR8A 4KORA 2QMLA 3NE8A 4HNXB 4M6GA 2P0WA 2CTBA 2ZW7A 4ETKA 1FY7A 3H8FA 1VIXA 2PJ9A 4ZY1A 4WWVA 4XPLA 3FMCA 4CS0B 4R87A 2AFXA 2V8HA 3PB7X 4MHYA 1S5KA 2Q4VA 2BOAA 2BL1A 3S6GA 1IYLA 3I3GA 3VWDA 3DGVA 1CPXA 4AXVA 3KQXA 3B3VA 4XNHB 4CAWA 4NGSA 4NGQA 4C68A 1TKHA 3IFEA 2P6EA 2WPWA 2J8RA 1Y9KA 4YRHA 1Q2CA 2JZEA 1ZG7A 4FAIA 4ZX9A 4R57A 2OOTA 5JGFA 2PJ7A 2JDDA 3TO6A 3H5ZA 2B4DB 2AJ6A 2BFRA 1YR0A 4I49A 3DLJA 5HMNA 1S7NA 4KOWA 3RNZA 5GCNA 4P4IA 1JQGA 1PU9A 2F8HA 3S9NA 4L8AA 2CY2A 4L89A 3F5BA 3GB0A 1PUAA 2A4NA 3CPXA 4AVAA 3NH5A 4KOVA 4AVBA 4HNWB 3HLPA 2PR1A 1IB1E 2B5GA 3GY9A 2BEIA 2QJ8A 2LGRA 2O4HA 1PYTB 3KI9A 3EC4A 4LX9A 4MFZA 2I79A 2ZPAA 4UBRA 1YGHA 2FIWA 1QSTA 3A9LA 2BCOA 4MCSA 1WWZA 4OADA 3IIDA 3S6HA 2WUUA 5H84A 4PXCA 1DTDA 2J8MA 3B3CA 2QVPA 3KL9A 3LWUA 2HB6A 3P2FA 2DPSA 5G21A 3DSBA 1NMTA 2Q7SA 3FEDA 4AG7A 1BPNA 5F49A 1MJAA 1SQHA 5BWAB 4ZI6A 1VGYA 4H6ZA 4IUSA 4UEZA 3V38A 3WC6A 4WJBA 4CAFA 4R3KA 3D68A 4OIDA 2NSMA 3LODA 1ELLP 3KQZA 4J5QA 1QSOA 4PK2A 5J8CA 3C26A 1R57A 1IGBA 1VKCA 2ABZA 4AB7A 2PVWA 2VI7A 1YLOA 1YQEA 2VZYA 3DNSA 3WT4A 2PRQA 2YNEA 4QVTA 4KVOE 2PDOA 1UWYA 5DWMA 2OH1A 3KKWA 3EY5A 4UA3A 4XPKA 4II9A 3EJFA 4EMEA 1HJZA 1TF9A 4PXBA 3Q6ZA 3EWRA 3IIBA 1TXZA 4MMOA 1ZLIA 3IWWA 4UWIA 3IO1A 1TXRA 2OU2A 4IQYA 3F8KA 4J3GA 4Y49B 3EO4A 3JUWA 1U6MA 2EBJA 2GLJA 4QBJA 5J8FA 1LOKA 2PJ4A 2BFQA 2C6CA 3V45A 3R95A 1QSNA 3BI0A 3D2MA 3I1UA 4RUHA 1XFOA 5E3BA 5H86A 2FCKA 2POKA 2C27A 5ELYA 3DDDA 4PPZA 3G8WA 1Z8LA 4JWPA 3KR5A 4MY3A 2FXFA 4NGNA 4TU0A 4KLVA 3KHXA 2CTCA 3GPGA 3FVLA 3FECA 3KASA 4NSQA 1I21A 4P4DA 3V2BA 2Z3NA 3EFAA 3FEEA 3VATA 1FNOA 4OIWA 4DYOA 6CPAA 2PJCA 4UF4A 4RN7A 3BI1A 1X12A 3BLNA 4CYPA 2AFWA 4MI4A 4NGRA 4PSXA 1KZFA 3T9YA 4X2TA 3B3SA 4OMEA 3WR7A 3WC7A 1Q7LA 2VL1A 1I1DA 3D7DA 2C6PA 3LD2A 4K0CA 4FWUA 3PB4X 3FBUA 4C7IA 2GIVA 5CPAA 4EFDA 2WSAA 1H8LA 4BMHA 1EE3P 2B4BA 2PJAA 3JZTA 2OR4A 5AILA 2Z3LA 4A39A 1XMBA 3PB8X 1HDUA 4UFWA 4CRZB 3K9UA 1XOVA 2JEWA 3JTKA 3QB8A 5IV0A 3D2PA 5F46A 1Z8WA 4KVME 1Y0YA 3N7ZA 1SPVA 4PXDA 1XJOA 2HQYA 5IB0A 2G3AA 1IOFA 3D7GA 4JJXA 3TT2A 3WABA 4B5PB 4EWTA 2QYVA 4ABKA 2Q7BA 1RO5A 1YW4A 4QB9A 5F09A 5AG5A 4B14A 4KUAA 4RI1A 5JPHA 4MHNA 4NJQA 1A2ZA 2IJZA 2OZHA 2AFZA 1UFHA 4JVVA 5DS0A 4Q7AA 5AG4A 2Y0MA 1IOIA 3SI0A 4UWJA 3EXNA 1DE4C 2PJBA 4KOSA 1ZLHA 2YNCA 4P44A 4MCPA 2O53A 4OC5A 4J4ZA 5AGEA 1ZG8A 3KGQA 5J1QA 2Q04A 2EUIA 2JBJA 1M44A 5C82A 4B6ZA 1LANA 4R9MA 2H5MA 1MJ9A 5IB9A 2P6FA 3RAMA 2DXQA 4C2XA 4NGTA 2VRIA 4BD9A 4UIAA 5EMIA 2Q4ZA 1R3NA 4OC4A 3G3SA 1Q2YA 1WK4A 2OZUA 3PRTA 4K30A 2AFMA 4Q36A 4LQGA 4MXUA 5FSXA 2X7BA 4MFKA 1JWQA 4R3LA 3GQEA 4A95A 2O28A 4P10A 4X8IA 2DX6A 3I9SA 2JLMA 2NMTA 2D4OA 3KHZA 4KSFA 4B13A 1LAPA 3EKEA 4ZY0A 1RTQA 2CXAA 2PE3A 2AFSA 4CGLA 5JH9A 2G9DA 3W91A 4E8OA 3PBBA 4KSAA 4FBEA 4CYOA 5THWA 1K4JA 1YVKA 4NGPA 2ZEPA
chains in the Genus database with same CATH topology
3HUVA 4P45A 3B3WA 1QMUA 4MCQA 2ZEFA 2IQ6A 4ZYQA 3VARA 1NJRA 3PB9X 2GU2A 3CPAA 5HVHA 2PIYA 5K8MA 4NJRA 3FF3A 4CPAA 2FVGA 4A37A 2ZENA 2ZEMA 4W9YA 1HDQA 4D86A 3VH9A 4DUKA 3S9LA 1YW6A 1AYEA 5D8NA 5LRJA 4MHZA 2Q51A 3GUXA 5K8OA 4P6YA 3SIJA 4K3NA 1KWMA 3GPQA 2JBKA 4F8ZA 1Y7EA 4ZY2A 1CP7A 4KYBA 2ZOFA 1TKFA 2V77A 5JM6A 3D7HA 3T8WA 3RZAA 3SIHA 1BLLE 4MCRA 3IIFA 4DJLA 4J5RA 1IY7A 1LCPA 1ZR3A 3GQOA 2AFOA 2ZELA 4UEEA 8CPAA 3SJGA 1GYTA 3TC8A 5CMSA 1ARMA 2PCUA 1Y0RA 3SJEA 1YMEA 3ISXA 1HEEA 4ETJA 2C1CA 3K9TA 1BAVA 5DUSA 1CP6A 3IEHA 4IAVA 2RB7A 2BO9A 2PJ2A 4UIBA 3FX6A 4A38A 3PBEA 3KZWA 4OKOA 2J9AA 4YWYA 2PJ3A 3FH4A 1TF8A 3CDXA 4JGKA 2I3CA 2AFCA 1VHUA 4GVVA 4JLLA 1TY8A 4Z65A 1ELMP 1OBRA 3IJ3A 3BXMA 2XEFA 4MHPA 4NFRA 2CIJA 2ANPA 4OC3A 4PQAA 4FUUA 4R8FA 3LMSA 2DEAA 2GREA 3SI2A 3B2YA 3EWOA 3SIIA 3IC1A 5I4MA 4H2KA 2EK9A 2EWBA 2WYRA 3D66A 3FJUA 4P4BA 3H8EA 2HC9A 3GPOA 5FSYA 3JRUA 2ZEGA 2RFHA 1M4LA 5FSZA 5CB5A 3PEIA 3Q71A 4NGMA 3NA6A 2V8VA 4P4EA 3V7ZA 2FAVA 5CBMA 2IMOA 1Z5RA 2NYQA 4J5SA 4TWEA 3L2NA 2PJ6A 1ZR5A 3TX8A 2PJ5A 4OP4A 3GLJA 4X3RA 4IK2A 2F7VA 2FXKA 4R76A 2C6GA 2PVVA 3BHXA 1AMPA 2Q43A 1F2PA 2ZEDA 4ONWA 4OC2A 1CPSA 3EJGA 3B7IA 4YU9A 5D29A 3WC5A 2ZEOA 1VHOA 5FSVA 4G1PA 4KSIA 5FSUA 5LRKA 4P4JA 2EK8A 3SJFA 4OC0A 3SIGA 4A94A 5LYLA 2PJ1A 3NH4A 2ZEHA 4R7MA 3QNVA 1YD9A 2AFUA 2PJ0A 1R43A 4JYWA 5K8NA 2XEGA 3B3TA 1NSAA 3B35A 3D67A 4IHMA 3SI1A 2WZNA 1XRYA 3EWPA 2FG1A 2ACFA 4PXEA 5LYDA 5HVFA 1F2OA 3K2KA 5HIHA 3NFZA 1ARLA 3VFQA 1ZG9A 3RBUA 2V8DA 3KR4A 1PCAA 1YSJA 1Z2LA 3PFEA 4JCAA 4OC1A 3EWQA 4O23A 5LRGA 1CX8A 3H8GA 2X47A 4MRIA 1LAMA 2V8GA 1CBXA 2XEJA 4ESSA 2PIZA 1QQ9A 5LYIA 4GUAA 1VHEA 4TNUA 3PFOA 1CG2A 5HOLA 5HXDA 3MRUA 2XD7A 3SJXA 5CB3A 2EEEA 3N5FA 3CT9A 5K8PA 3D4UA 2GLFA 3NH8A 4ABLA 1F57A 3ETIA 3EW5A 2CF4A 1TKJA 4GVWA 1LFWA 3S9MA 4UEFA 1BPMA 4ZX8A 4JZ0A 4P4FA 2XEIA 3MN8A 5LYFA 2PJ8A 1XBUA 7CPAA 5HVGA 4GM5A 3ISZA 2ZOGA 4R6TA 3PB6X 2L8RA 3D7FA 2ZEEA 4UMLA 4F9UA 4F9VA 1FT7A 2CTBA 4ETKA 3H8FA 1VIXA 2PJ9A 4ZY1A 4WWVA 3FMCA 2AFXA 2V8HA 3PB7X 4MHYA 2BOAA 3DGVA 1CPXA 4AXVA 3KQXA 3B3VA 4NGSA 4NGQA 1TKHA 3IFEA 1ZG7A 4FAIA 4ZX9A 2OOTA 5JGFA 2PJ7A 2BFRA 3DLJA 4P4IA 1JQGA 2F8HA 3S9NA 3GB0A 3CPXA 3NH5A 3HLPA 2QJ8A 2LGRA 2O4HA 1PYTB 3KI9A 2BCOA 4MCSA 3IIDA 4PXCA 1DTDA 3B3CA 2QVPA 3KL9A 3LWUA 2HB6A 3FEDA 1BPNA 4ZI6A 1VGYA 4UEZA 3V38A 3WC6A 4WJBA 3D68A 4OIDA 2NSMA 1ELLP 3KQZA 4J5QA 1IGBA 2ABZA 2PVWA 1YLOA 3WT4A 2PRQA 1UWYA 3EJFA 4EMEA 1HJZA 1TF9A 4PXBA 3Q6ZA 3EWRA 3IIBA 1TXZA 4MMOA 1ZLIA 3IWWA 3IO1A 1TXRA 4IQYA 2GLJA 1LOKA 2PJ4A 2C6CA 2BFQA 3V45A 3BI0A 4RUHA 3I1UA 1XFOA 5E3BA 2POKA 5ELYA 4PPZA 1Z8LA 3KR5A 4NGNA 4TU0A 3KHXA 2CTCA 3GPGA 3FVLA 3FECA 3KASA 4P4DA 3V2BA 3FEEA 3VATA 4DYOA 1FNOA 4OIWA 6CPAA 2PJCA 4UF4A 3BI1A 2AFWA 4NGRA 4X2TA 3B3SA 4OMEA 3WC7A 1Q7LA 2VL1A 3D7DA 2C6PA 4K0CA 4FWUA 3PB4X 5CPAA 4EFDA 1H8LA 1EE3P 2OR4A 2PJAA 3JZTA 5AILA 4A39A 1XMBA 3PB8X 1HDUA 2JEWA 1Y0YA 1SPVA 4PXDA 1XJOA 3D7GA 3WABA 4EWTA 2QYVA 4ABKA 1YW4A 5F09A 4MHNA 4NJQA 2IJZA 2AFZA 4JVVA 5DS0A 4Q7AA 3SI0A 1DE4C 2PJBA 1ZLHA 4P44A 4MCPA 2O53A 4OC5A 4J4ZA 1ZG8A 3KGQA 5J1QA 2JBJA 4B6ZA 1LANA 5IB9A 3RAMA 4NGTA 2VRIA 4BD9A 4UIAA 2Q4ZA 1R3NA 4OC4A 3PRTA 2AFMA 4LQGA 4MXUA 5FSXA 3GQEA 4P10A 4X8IA 2DX6A 3KHZA 1LAPA 2PE3A 3EKEA 4ZY0A 1RTQA 5JH9A 2AFSA 2G9DA 3PBBA 4FBEA 5THWA 4NGPA 2ZEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUV A;  4P45 A;  3B3W A;  1QMU A;  4MCQ A;  2ZEF A;  2IQ6 A;  4ZYQ A;  3VAR A;  1NJR A;  3PB9 X;  2GU2 A;  3CPA A;  5HVH A;  2PIY A;  5K8M A;  4NJR A;  3FF3 A;  4CPA A;  2FVG A;  4A37 A;  2ZEN A;  2ZEM A;  4W9Y A;  1HDQ A;  4D86 A;  3VH9 A;  4DUK A;  3S9L A;  1YW6 A;  1AYE A;  5D8N A;  5LRJ A;  4MHZ A;  2Q51 A;  3GUX A;  5K8O A;  4P6Y A;  3SIJ A;  4K3N A;  1KWM A;  3GPQ A;  2JBK A;  4F8Z A;  1Y7E A;  4ZY2 A;  1CP7 A;  4KYB A;  2ZOF A;  1TKF A;  2V77 A;  5JM6 A;  3D7H A;  3T8W A;  3RZA A;  3SIH A;  1BLL E;  4MCR A;  3IIF A;  4DJL A;  4J5R A;  1IY7 A;  1LCP A;  1ZR3 A;  3GQO A;  2AFO A;  2ZEL A;  4UEE A;  8CPA A;  3SJG A;  1GYT A;  3TC8 A;  5CMS A;  1ARM A;  2PCU A;  1Y0R A;  3SJE A;  1YME A;  3ISX A;  1HEE A;  4ETJ A;  2C1C A;  3K9T A;  1BAV A;  5DUS A;  1CP6 A;  3IEH A;  4IAV A;  2RB7 A;  2BO9 A;  2PJ2 A;  4UIB A;  3FX6 A;  4A38 A;  3PBE A;  3KZW A;  4OKO A;  2J9A A;  4YWY A;  2PJ3 A;  3FH4 A;  1TF8 A;  3CDX A;  4JGK A;  2I3C A;  2AFC A;  1VHU A;  4GVV A;  4JLL A;  1TY8 A;  4Z65 A;  1ELM P;  1OBR A;  3IJ3 A;  3BXM A;  2XEF A;  4MHP A;  4NFR A;  2CIJ A;  2ANP A;  4OC3 A;  4PQA A;  4FUU A;  4R8F A;  3LMS A;  2DEA A;  2GRE A;  3SI2 A;  3B2Y A;  3EWO A;  3SII A;  3IC1 A;  5I4M A;  4H2K A;  2EK9 A;  2EWB A;  2WYR A;  3D66 A;  3FJU A;  4P4B A;  3H8E A;  2HC9 A;  3GPO A;  5FSY A;  3JRU A;  2ZEG A;  2RFH A;  1M4L A;  5FSZ A;  5CB5 A;  3PEI A;  3Q71 A;  4NGM A;  3NA6 A;  2V8V A;  4P4E A;  3V7Z A;  2FAV A;  5CBM A;  2IMO A;  1Z5R A;  2NYQ A;  4J5S A;  4TWE A;  3L2N A;  2PJ6 A;  1ZR5 A;  3TX8 A;  2PJ5 A;  4OP4 A;  3GLJ A;  4X3R A;  4IK2 A;  2F7V A;  2FXK A;  4R76 A;  2C6G A;  2PVV A;  3BHX A;  1AMP A;  2Q43 A;  1F2P A;  2ZED A;  4ONW A;  4OC2 A;  1CPS A;  3EJG A;  3B7I A;  4YU9 A;  5D29 A;  3WC5 A;  2ZEO A;  1VHO A;  5FSV A;  4G1P A;  4KSI A;  5FSU A;  5LRK A;  4P4J A;  2EK8 A;  3SJF A;  4OC0 A;  3SIG A;  4A94 A;  5LYL A;  2PJ1 A;  3NH4 A;  2ZEH A;  4R7M A;  3QNV A;  1YD9 A;  2AFU A;  2PJ0 A;  1R43 A;  4JYW A;  5K8N A;  2XEG A;  3B3T A;  1NSA A;  3B35 A;  3D67 A;  4IHM A;  3SI1 A;  2WZN A;  1XRY A;  3EWP A;  2FG1 A;  2ACF A;  4PXE A;  5LYD A;  5HVF A;  1F2O A;  3K2K A;  5HIH A;  3NFZ A;  1ARL A;  3VFQ A;  1ZG9 A;  3RBU A;  2V8D A;  3KR4 A;  1PCA A;  1YSJ A;  1Z2L A;  3PFE A;  4JCA A;  4OC1 A;  3EWQ A;  4O23 A;  5LRG A;  1CX8 A;  3H8G A;  2X47 A;  4MRI A;  1LAM A;  2V8G A;  1CBX A;  2XEJ A;  4ESS A;  2PIZ A;  1QQ9 A;  5LYI A;  4GUA A;  1VHE A;  4TNU A;  3PFO A;  1CG2 A;  5HOL A;  5HXD A;  3MRU A;  2XD7 A;  3SJX A;  5CB3 A;  2EEE A;  3N5F A;  3CT9 A;  5K8P A;  3D4U A;  2GLF A;  3NH8 A;  4ABL A;  1F57 A;  3ETI A;  3EW5 A;  2CF4 A;  1TKJ A;  4GVW A;  1LFW A;  3S9M A;  4UEF A;  1BPM A;  4ZX8 A;  4JZ0 A;  4P4F A;  2XEI A;  3MN8 A;  5LYF A;  2PJ8 A;  1XBU A;  7CPA A;  5HVG A;  4GM5 A;  3ISZ A;  2ZOG A;  4R6T A;  3PB6 X;  2L8R A;  3D7F A;  2ZEE A;  4UML A;  4F9U A;  4F9V A;  1FT7 A;  2CTB A;  4ETK A;  3H8F A;  1VIX A;  2PJ9 A;  4ZY1 A;  4WWV A;  3FMC A;  2AFX A;  2V8H A;  3PB7 X;  4MHY A;  2BOA A;  3DGV A;  1CPX A;  4AXV A;  3KQX A;  3B3V A;  4NGS A;  4NGQ A;  1TKH A;  3IFE A;  1ZG7 A;  4FAI A;  4ZX9 A;  2OOT A;  5JGF A;  2PJ7 A;  2BFR A;  3DLJ A;  4P4I A;  1JQG A;  2F8H A;  3S9N A;  3GB0 A;  3CPX A;  3NH5 A;  3HLP A;  2QJ8 A;  2LGR A;  2O4H A;  1PYT B;  3KI9 A;  2BCO A;  4MCS A;  3IID A;  4PXC A;  1DTD A;  3B3C A;  2QVP A;  3KL9 A;  3LWU A;  2HB6 A;  3FED A;  1BPN A;  4ZI6 A;  1VGY A;  4UEZ A;  3V38 A;  3WC6 A;  4WJB A;  3D68 A;  4OID A;  2NSM A;  1ELL P;  3KQZ A;  4J5Q A;  1IGB A;  2ABZ A;  2PVW A;  1YLO A;  3WT4 A;  2PRQ A;  1UWY A;  3EJF A;  4EME A;  1HJZ A;  1TF9 A;  4PXB A;  3Q6Z A;  3EWR A;  3IIB A;  1TXZ A;  4MMO A;  1ZLI A;  3IWW A;  3IO1 A;  1TXR A;  4IQY A;  2GLJ A;  1LOK A;  2PJ4 A;  2C6C A;  2BFQ A;  3V45 A;  3BI0 A;  4RUH A;  3I1U A;  1XFO A;  5E3B A;  2POK A;  5ELY A;  4PPZ A;  1Z8L A;  3KR5 A;  4NGN A;  4TU0 A;  3KHX A;  2CTC A;  3GPG A;  3FVL A;  3FEC A;  3KAS A;  4P4D A;  3V2B A;  3FEE A;  3VAT A;  4DYO A;  1FNO A;  4OIW A;  6CPA A;  2PJC A;  4UF4 A;  3BI1 A;  2AFW A;  4NGR A;  4X2T A;  3B3S A;  4OME A;  3WC7 A;  1Q7L A;  2VL1 A;  3D7D A;  2C6P A;  4K0C A;  4FWU A;  3PB4 X;  5CPA A;  4EFD A;  1H8L A;  1EE3 P;  2OR4 A;  2PJA A;  3JZT A;  5AIL A;  4A39 A;  1XMB A;  3PB8 X;  1HDU A;  2JEW A;  1Y0Y A;  1SPV A;  4PXD A;  1XJO A;  3D7G A;  3WAB A;  4EWT A;  2QYV A;  4ABK A;  1YW4 A;  5F09 A;  4MHN A;  4NJQ A;  2IJZ A;  2AFZ A;  4JVV A;  5DS0 A;  4Q7A A;  3SI0 A;  1DE4 C;  2PJB A;  1ZLH A;  4P44 A;  4MCP A;  2O53 A;  4OC5 A;  4J4Z A;  1ZG8 A;  3KGQ A;  5J1Q A;  2JBJ A;  4B6Z A;  1LAN A;  5IB9 A;  3RAM A;  4NGT A;  2VRI A;  4BD9 A;  4UIA A;  2Q4Z A;  1R3N A;  4OC4 A;  3PRT A;  2AFM A;  4LQG A;  4MXU A;  5FSX A;  3GQE A;  4P10 A;  4X8I A;  2DX6 A;  3KHZ A;  1LAP A;  2PE3 A;  3EKE A;  4ZY0 A;  1RTQ A;  5JH9 A;  2AFS A;  2G9D A;  3PBB A;  4FBE A;  5THW A;  4NGP A;  2ZEP A; 
#chains in the Genus database with same CATH topology
 2VEZ A;  4LQ6 A;  2Q0Y A;  3HUV A;  4A2Z A;  4P45 A;  3B3W A;  4JXQ A;  4UCM A;  2JZF A;  1QMU A;  4FD6 A;  4MCQ A;  2ZEF A;  4HKF A;  2WCT A;  3GYA A;  2IQ6 A;  1Z9U A;  4CAV A;  4F0Y A;  4ZYQ A;  3VAR A;  1NJR A;  3PB9 X;  2R98 A;  2Z10 A;  2GU2 A;  3CPA A;  4MFJ A;  4B12 A;  2YGW A;  5HVH A;  4C2Z A;  1BOB A;  2PIY A;  2W2G A;  4NJR A;  5K8M A;  5C88 A;  4EVY A;  3FF3 A;  5JQ4 A;  4CPA A;  2FVG A;  4A37 A;  5A28 A;  2ZEN A;  2ZEM A;  2Z0Z A;  3FB3 A;  4W9Y A;  1HDQ A;  5EBV A;  4D86 A;  1XE4 A;  3VH9 A;  4DUK A;  3S9L A;  4IF5 A;  1YW6 A;  1AUG A;  1AYE A;  5D8N A;  5LRJ A;  1XIX A;  4MHZ A;  2Q51 A;  3GUX A;  4KOX A;  4FD5 A;  2Z3P A;  3TOA A;  5K8O A;  1CJW A;  2B5G B;  3SIJ A;  4P6Y A;  5E96 A;  4K3N A;  5ISV A;  2BSW A;  1KWM A;  3GPQ A;  4NCZ A;  2JBK A;  5AG6 A;  1Y7E A;  4F8Z A;  4ZY2 A;  2PSW A;  1CP7 A;  5CNP A;  4KYB A;  2CNT A;  2FSR A;  2ZOF A;  4XNH C;  1TKF A;  2V77 A;  4M6I A;  5JM6 A;  2Z3O A;  3D7H A;  3T8W A;  3RZA A;  3SIH A;  1BLL E;  4MCR A;  3IIF A;  4DJL A;  2JZD A;  4J5R A;  2EO8 A;  1B6B A;  1IY7 A;  5G20 A;  1IU8 A;  5G1Z A;  3P2H A;  4NXY A;  1Z4R A;  2AE6 A;  3QAH A;  3R9G A;  1LCP A;  1ZR3 A;  1S7L A;  2IL4 A;  4CGO A;  3GQO A;  1S7F A;  2AFO A;  2R8V A;  2ZEL A;  4UEE A;  8CPA A;  3SJG A;  1GYT A;  4UCP A;  3TC8 A;  5CMS A;  2QEC A;  1ARM A;  2VBQ A;  1XMT A;  3D3S A;  2PCU A;  1Y0R A;  3FYN A;  3SJE A;  1YME A;  1KUX A;  3ISX A;  4AG9 A;  1HEE A;  4ETJ A;  2C1C A;  3K9T A;  1BAV A;  5DUS A;  3PP9 A;  1CM0 A;  1P4N A;  1CP6 A;  3IEH A;  1NSL A;  4IAV A;  2REF A;  2RB7 A;  3B8G A;  1XEB A;  2BO9 A;  2PJ2 A;  1YX0 A;  3S6K A;  1Y9W A;  4UIB A;  7CPA A;  3FX6 A;  3DR6 A;  4FD4 A;  4A38 A;  1V0C A;  3R9F A;  3NE7 A;  3IWE A;  3PBE A;  3KZW A;  4OKO A;  3ZZI A;  2J9A A;  2D4P A;  4KS9 A;  4YWY A;  1LRZ A;  2PJ3 A;  4QC6 A;  3FH4 A;  3BJ7 A;  1TF8 A;  3CDX A;  4CYN A;  4OAE A;  4CGP A;  4JGK A;  2I3C A;  3TX8 A;  4E2A A;  2AFC A;  4C2Y A;  2BUE A;  3CZX A;  1VHU A;  4GVV A;  4JLL A;  2VXK A;  1TY8 A;  4Z65 A;  1ELM P;  3TO7 A;  2RC4 A;  1M4G A;  1OBR A;  3IJ3 A;  5F48 A;  2OZG A;  2G0B A;  3BXM A;  1I12 A;  1MJB A;  2XEF A;  4MHP A;  4NEX A;  4NFR A;  4AVC A;  2CIJ A;  3VWE A;  5DWN A;  4KUB A;  3W6S A;  4CYQ A;  1KUV A;  4U9Z A;  3GIU A;  2ANP A;  4A31 A;  4OC3 A;  4PQA A;  4FUU A;  1GHE A;  3R1K A;  4R8F A;  1YLE A;  4KVX A;  3LMS A;  4Y49 C;  3LAC A;  1Q2D A;  2DEA A;  2B58 A;  2GRE A;  3B2Y A;  3SI2 A;  3EWO A;  3SII A;  1IIC A;  4ZGY B;  3IC1 A;  4CGM A;  5I4M A;  4H2K A;  1OZP A;  3SXO A;  3S6F A;  4C7H A;  2EK9 A;  2EWB A;  2K5T A;  2WYR A;  3D66 A;  2ZXV A;  3FJU A;  4P4B A;  3H8E A;  5KTA A;  2HC9 A;  3GPO A;  2B4D A;  1RXT A;  2ATR A;  5FSY A;  2G3T A;  3JRU A;  3W6X A;  2ZEG A;  5F47 A;  2RFH A;  1M4L A;  3RYO A;  4F6A A;  3F0A A;  3IU1 A;  5FSZ A;  5CB5 A;  3PEI A;  3Q71 A;  2FE7 A;  4LUA A;  4NGM A;  2ODF A;  3NA6 A;  1Z8X A;  2FS5 A;  2V8V A;  4P4E A;  1M4I A;  3GKR A;  3V7Z A;  2FAV A;  5CBM A;  2HUZ A;  2VZZ A;  1YK3 A;  2IMO A;  1Z5R A;  2NYQ A;  3JVN A;  4GXH A;  4UCN A;  4A30 A;  3FXT A;  4J5S A;  4RS2 A;  4TWE A;  3L2N A;  2PJ6 A;  2PRB A;  1ZR5 A;  2HV2 A;  2PQ8 A;  2Z3M A;  5EC4 A;  2PJ5 A;  4H6U A;  2JEV A;  3GLJ A;  4IK2 A;  2F7V A;  4OP4 A;  4X3R A;  3TOB A;  5KTC A;  2YND A;  2GFQ A;  2FXK A;  4R76 A;  2C6G A;  2PVV A;  4MFP A;  3BHX A;  4CRY B;  1AMP A;  1XF8 A;  2Q43 A;  4DNC A;  4ONU A;  4KOY A;  1F2P A;  2ZED A;  4ONW A;  2B3V A;  1M4D A;  1P0H A;  3ZJ0 A;  4OC2 A;  1CPS A;  3EJG A;  3B7I A;  4YU9 A;  5D29 A;  3WC5 A;  4PSW A;  1BO4 A;  1VHO A;  2R7H A;  5FSV A;  2ZEO A;  1B87 A;  4OLL A;  2B3U A;  1KUY A;  4G1P A;  4KSI A;  5FSU A;  5LRK A;  4P4J A;  2EK8 A;  2REE A;  1QSM A;  4OC0 A;  2CNM A;  3SJF A;  5A27 A;  3H4Q A;  4ORF A;  3SIG A;  4A94 A;  1X10 A;  2P6G A;  3OWC A;  5LYL A;  2PJ1 A;  4PV6 A;  2Z11 A;  2EVN A;  3NH4 A;  2ZEH A;  4R7M A;  3QNV A;  1Z8T A;  1YD9 A;  2AFU A;  2PJ0 A;  4BBH A;  4CAE A;  1R43 A;  3E0K A;  1N71 A;  1S60 A;  4JYW A;  4X5K A;  2I00 A;  2R1I A;  4PK3 A;  4UFV A;  2OB0 A;  5K8N A;  2ZW5 A;  2XEG A;  4YGO A;  3B3T A;  2JDC A;  1NSA A;  4HNY B;  4A33 A;  1QSR A;  2ZW6 A;  4GS4 A;  4M3S A;  1IYK A;  2WPX A;  3B35 A;  4MHD A;  3D67 A;  3FRM A;  4XPD B;  4IHM A;  3SI1 A;  2QIR A;  2WZN A;  3PGP A;  1XRY A;  5KTD A;  3EWP A;  1Z4E A;  2FG1 A;  2ACF A;  4NF1 A;  4PXE A;  1M1D A;  5LYD A;  2J8N A;  4KOU A;  4B5O A;  5HVF A;  3SXN A;  4M85 A;  1F2O A;  4QUS A;  4A32 A;  3K2K A;  5HIH A;  3NFZ A;  5FVJ A;  4UFX A;  3CXQ A;  3FIX A;  1ARL A;  3TTH A;  3VFQ A;  3RO0 A;  2KQV A;  4H89 A;  1ZG9 A;  2F5I A;  2GAN A;  2YNC C;  4JD6 A;  2V8D A;  3RBU A;  3SHP A;  4HPS A;  3IU2 A;  2ZW4 A;  2Q4Y A;  3D8P A;  1NE9 A;  1S3Z A;  3IGR A;  3KR4 A;  1PCA A;  1YSJ A;  4CGN A;  4CAX A;  1Z2L A;  3PFE A;  2FL4 A;  3FNC A;  4JCA A;  4KOT A;  3IWG A;  3TCV A;  4M6H A;  4MFQ A;  4OC1 A;  3EWQ A;  5G22 A;  4O23 A;  3T90 A;  5LRG A;  1CX8 A;  1TIQ A;  4F0X A;  3R9E A;  4JLY A;  4MJ8 A;  3H8G A;  2X47 A;  4MRI A;  4B10 A;  4YFJ A;  1LAM A;  2V8G A;  1CBX A;  5IX3 A;  2XEJ A;  4ESS A;  2DPT A;  1YRE A;  2KCW A;  2PIZ A;  1Y7R A;  1S7K A;  1QQ9 A;  5LYI A;  1IID A;  4E0A A;  4GUA A;  4JXR A;  5AG7 A;  1VHE A;  4B5P A;  4MBU A;  4U9Y A;  4TNU A;  3PFO A;  1CG2 A;  5HOL A;  5HXD A;  3MRU A;  4BIN A;  5I0C A;  3TFY A;  3BJ8 A;  2XD7 A;  3SJX A;  3V8I A;  5CB3 A;  2EEE A;  3N5F A;  4XPD C;  3TO9 A;  3CT9 A;  4KZT A;  5K8P A;  3D4U A;  2GLF A;  4B11 A;  2GE3 A;  1L0C A;  3NH8 A;  4ZBG A;  4ABL A;  1F57 A;  1YVO A;  3ETI A;  2DF5 A;  2VQY A;  3EW5 A;  2CF4 A;  1TKJ A;  4GVW A;  1LFW A;  4MFL A;  3S9M A;  4UEF A;  2RNK A;  2Q44 A;  1BPM A;  4ZX8 A;  4JZ0 A;  3UY5 A;  4P4F A;  2CNS A;  2XEI A;  4MY0 A;  3MN8 A;  2FT0 A;  5LYF A;  3TE4 A;  1J4J A;  2PC1 A;  1XBU A;  2PJ8 A;  2PR8 A;  2Z3K A;  4GM5 A;  3ISZ A;  5HH1 A;  3QAY A;  3R96 A;  5HVG A;  2ZOG A;  4R6T A;  3CXP A;  2FIA A;  3PB6 X;  1VHS A;  4FD7 A;  4KLW A;  4U5Y A;  2L8R A;  1ZO0 A;  3D7F A;  3PZJ A;  3MGD A;  2ZEE A;  4UML A;  3CXS A;  4F9U A;  1ON0 A;  4F9V A;  4Q38 A;  1FT7 A;  1MK4 A;  2ARH A;  3DR8 A;  4KOR A;  2QML A;  3NE8 A;  4HNX B;  4M6G A;  2P0W A;  2CTB A;  2ZW7 A;  4ETK A;  1FY7 A;  3H8F A;  1VIX A;  2PJ9 A;  4ZY1 A;  4WWV A;  4XPL A;  3FMC A;  4CS0 B;  4R87 A;  2AFX A;  2V8H A;  3PB7 X;  4MHY A;  1S5K A;  2Q4V A;  2BOA A;  2BL1 A;  3S6G A;  1IYL A;  3I3G A;  3VWD A;  3DGV A;  1CPX A;  4AXV A;  3KQX A;  3B3V A;  4XNH B;  4CAW A;  4NGS A;  4NGQ A;  4C68 A;  1TKH A;  3IFE A;  2P6E A;  2WPW A;  2J8R A;  1Y9K A;  4YRH A;  1Q2C A;  2JZE A;  1ZG7 A;  4FAI A;  4ZX9 A;  4R57 A;  2OOT A;  5JGF A;  2PJ7 A;  2JDD A;  3TO6 A;  3H5Z A;  2B4D B;  2AJ6 A;  2BFR A;  1YR0 A;  4I49 A;  3DLJ A;  5HMN A;  1S7N A;  4KOW A;  3RNZ A;  5GCN A;  4P4I A;  1JQG A;  1PU9 A;  2F8H A;  3S9N A;  4L8A A;  2CY2 A;  4L89 A;  3F5B A;  3GB0 A;  1PUA A;  2A4N A;  3CPX A;  4AVA A;  3NH5 A;  4KOV A;  4AVB A;  4HNW B;  3HLP A;  2PR1 A;  1IB1 E;  2B5G A;  3GY9 A;  2BEI A;  2QJ8 A;  2LGR A;  2O4H A;  1PYT B;  3KI9 A;  3EC4 A;  4LX9 A;  4MFZ A;  2I79 A;  2ZPA A;  4UBR A;  1YGH A;  2FIW A;  1QST A;  3A9L A;  2BCO A;  4MCS A;  1WWZ A;  4OAD A;  3IID A;  3S6H A;  2WUU A;  5H84 A;  4PXC A;  1DTD A;  2J8M A;  3B3C A;  2QVP A;  3KL9 A;  3LWU A;  2HB6 A;  3P2F A;  2DPS A;  5G21 A;  3DSB A;  1NMT A;  2Q7S A;  3FED A;  4AG7 A;  1BPN A;  5F49 A;  1MJA A;  1SQH A;  5BWA B;  4ZI6 A;  1VGY A;  4H6Z A;  4IUS A;  4UEZ A;  3V38 A;  3WC6 A;  4WJB A;  4CAF A;  4R3K A;  3D68 A;  4OID A;  2NSM A;  3LOD A;  1ELL P;  3KQZ A;  4J5Q A;  1QSO A;  4PK2 A;  5J8C A;  3C26 A;  1R57 A;  1IGB A;  1VKC A;  2ABZ A;  4AB7 A;  2PVW A;  2VI7 A;  1YLO A;  1YQE A;  2VZY A;  3DNS A;  3WT4 A;  2PRQ A;  2YNE A;  4QVT A;  4KVO E;  2PDO A;  1UWY A;  5DWM A;  2OH1 A;  3KKW A;  3EY5 A;  4UA3 A;  4XPK A;  4II9 A;  3EJF A;  4EME A;  1HJZ A;  1TF9 A;  4PXB A;  3Q6Z A;  3EWR A;  3IIB A;  1TXZ A;  4MMO A;  1ZLI A;  3IWW A;  4UWI A;  3IO1 A;  1TXR A;  2OU2 A;  4IQY A;  3F8K A;  4J3G A;  4Y49 B;  3EO4 A;  3JUW A;  1U6M A;  2EBJ A;  2GLJ A;  4QBJ A;  5J8F A;  1LOK A;  2PJ4 A;  2BFQ A;  2C6C A;  3V45 A;  3R95 A;  1QSN A;  3BI0 A;  3D2M A;  3I1U A;  4RUH A;  1XFO A;  5E3B A;  5H86 A;  2FCK A;  2POK A;  2C27 A;  5ELY A;  3DDD A;  4PPZ A;  3G8W A;  1Z8L A;  4JWP A;  3KR5 A;  4MY3 A;  2FXF A;  4NGN A;  4TU0 A;  4KLV A;  3KHX A;  2CTC A;  3GPG A;  3FVL A;  3FEC A;  3KAS A;  4NSQ A;  1I21 A;  4P4D A;  3V2B A;  2Z3N A;  3EFA A;  3FEE A;  3VAT A;  1FNO A;  4OIW A;  4DYO A;  6CPA A;  2PJC A;  4UF4 A;  4RN7 A;  3BI1 A;  1X12 A;  3BLN A;  4CYP A;  2AFW A;  4MI4 A;  4NGR A;  4PSX A;  1KZF A;  3T9Y A;  4X2T A;  3B3S A;  4OME A;  3WR7 A;  3WC7 A;  1Q7L A;  2VL1 A;  1I1D A;  3D7D A;  2C6P A;  3LD2 A;  4K0C A;  4FWU A;  3PB4 X;  3FBU A;  4C7I A;  2GIV A;  5CPA A;  4EFD A;  2WSA A;  1H8L A;  4BMH A;  1EE3 P;  2B4B A;  2PJA A;  3JZT A;  2OR4 A;  5AIL A;  2Z3L A;  4A39 A;  1XMB A;  3PB8 X;  1HDU A;  4UFW A;  4CRZ B;  3K9U A;  1XOV A;  2JEW A;  3JTK A;  3QB8 A;  5IV0 A;  3D2P A;  5F46 A;  1Z8W A;  4KVM E;  1Y0Y A;  3N7Z A;  1SPV A;  4PXD A;  1XJO A;  2HQY A;  5IB0 A;  2G3A A;  1IOF A;  3D7G A;  4JJX A;  3TT2 A;  3WAB A;  4B5P B;  4EWT A;  2QYV A;  4ABK A;  2Q7B A;  1RO5 A;  1YW4 A;  4QB9 A;  5F09 A;  5AG5 A;  4B14 A;  4KUA A;  4RI1 A;  5JPH A;  4MHN A;  4NJQ A;  1A2Z A;  2IJZ A;  2OZH A;  2AFZ A;  1UFH A;  4JVV A;  5DS0 A;  4Q7A A;  5AG4 A;  2Y0M A;  1IOI A;  3SI0 A;  4UWJ A;  3EXN A;  1DE4 C;  2PJB A;  4KOS A;  1ZLH A;  2YNC A;  4P44 A;  4MCP A;  2O53 A;  4OC5 A;  4J4Z A;  5AGE A;  1ZG8 A;  3KGQ A;  5J1Q A;  2Q04 A;  2EUI A;  2JBJ A;  1M44 A;  5C82 A;  4B6Z A;  1LAN A;  4R9M A;  2H5M A;  1MJ9 A;  5IB9 A;  2P6F A;  3RAM A;  2DXQ A;  4C2X A;  4NGT A;  2VRI A;  4BD9 A;  4UIA A;  5EMI A;  2Q4Z A;  1R3N A;  4OC4 A;  3G3S A;  1Q2Y A;  1WK4 A;  2OZU A;  3PRT A;  4K30 A;  2AFM A;  4Q36 A;  4LQG A;  4MXU A;  5FSX A;  2X7B A;  4MFK A;  1JWQ A;  4R3L A;  3GQE A;  4A95 A;  2O28 A;  4P10 A;  4X8I A;  2DX6 A;  3I9S A;  2JLM A;  2NMT A;  2D4O A;  3KHZ A;  4KSF A;  4B13 A;  1LAP A;  3EKE A;  4ZY0 A;  1RTQ A;  2CXA A;  2PE3 A;  2AFS A;  4CGL A;  5JH9 A;  2G9D A;  3W91 A;  4E8O A;  3PBB A;  4KSA A;  4FBE A;  4CYO A;  5THW A;  1K4J A;  1YVK A;  4NGP A;  2ZEP A; 
#chains in the Genus database with same CATH homology
 3HUV A;  4P45 A;  3B3W A;  1QMU A;  4MCQ A;  2ZEF A;  2IQ6 A;  4ZYQ A;  3VAR A;  1NJR A;  3PB9 X;  2GU2 A;  3CPA A;  5HVH A;  2PIY A;  5K8M A;  4NJR A;  3FF3 A;  4CPA A;  2FVG A;  4A37 A;  2ZEN A;  2ZEM A;  4W9Y A;  1HDQ A;  4D86 A;  3VH9 A;  4DUK A;  3S9L A;  1YW6 A;  1AYE A;  5D8N A;  5LRJ A;  4MHZ A;  2Q51 A;  3GUX A;  5K8O A;  4P6Y A;  3SIJ A;  4K3N A;  1KWM A;  3GPQ A;  2JBK A;  4F8Z A;  1Y7E A;  4ZY2 A;  1CP7 A;  4KYB A;  2ZOF A;  1TKF A;  2V77 A;  5JM6 A;  3D7H A;  3T8W A;  3RZA A;  3SIH A;  1BLL E;  4MCR A;  3IIF A;  4DJL A;  4J5R A;  1IY7 A;  1LCP A;  1ZR3 A;  3GQO A;  2AFO A;  2ZEL A;  4UEE A;  8CPA A;  3SJG A;  1GYT A;  3TC8 A;  5CMS A;  1ARM A;  2PCU A;  1Y0R A;  3SJE A;  1YME A;  3ISX A;  1HEE A;  4ETJ A;  2C1C A;  3K9T A;  1BAV A;  5DUS A;  1CP6 A;  3IEH A;  4IAV A;  2RB7 A;  2BO9 A;  2PJ2 A;  4UIB A;  3FX6 A;  4A38 A;  3PBE A;  3KZW A;  4OKO A;  2J9A A;  4YWY A;  2PJ3 A;  3FH4 A;  1TF8 A;  3CDX A;  4JGK A;  2I3C A;  2AFC A;  1VHU A;  4GVV A;  4JLL A;  1TY8 A;  4Z65 A;  1ELM P;  1OBR A;  3IJ3 A;  3BXM A;  2XEF A;  4MHP A;  4NFR A;  2CIJ A;  2ANP A;  4OC3 A;  4PQA A;  4FUU A;  4R8F A;  3LMS A;  2DEA A;  2GRE A;  3SI2 A;  3B2Y A;  3EWO A;  3SII A;  3IC1 A;  5I4M A;  4H2K A;  2EK9 A;  2EWB A;  2WYR A;  3D66 A;  3FJU A;  4P4B A;  3H8E A;  2HC9 A;  3GPO A;  5FSY A;  3JRU A;  2ZEG A;  2RFH A;  1M4L A;  5FSZ A;  5CB5 A;  3PEI A;  3Q71 A;  4NGM A;  3NA6 A;  2V8V A;  4P4E A;  3V7Z A;  2FAV A;  5CBM A;  2IMO A;  1Z5R A;  2NYQ A;  4J5S A;  4TWE A;  3L2N A;  2PJ6 A;  1ZR5 A;  3TX8 A;  2PJ5 A;  4OP4 A;  3GLJ A;  4X3R A;  4IK2 A;  2F7V A;  2FXK A;  4R76 A;  2C6G A;  2PVV A;  3BHX A;  1AMP A;  2Q43 A;  1F2P A;  2ZED A;  4ONW A;  4OC2 A;  1CPS A;  3EJG A;  3B7I A;  4YU9 A;  5D29 A;  3WC5 A;  2ZEO A;  1VHO A;  5FSV A;  4G1P A;  4KSI A;  5FSU A;  5LRK A;  4P4J A;  2EK8 A;  3SJF A;  4OC0 A;  3SIG A;  4A94 A;  5LYL A;  2PJ1 A;  3NH4 A;  2ZEH A;  4R7M A;  3QNV A;  1YD9 A;  2AFU A;  2PJ0 A;  1R43 A;  4JYW A;  5K8N A;  2XEG A;  3B3T A;  1NSA A;  3B35 A;  3D67 A;  4IHM A;  3SI1 A;  2WZN A;  1XRY A;  3EWP A;  2FG1 A;  2ACF A;  4PXE A;  5LYD A;  5HVF A;  1F2O A;  3K2K A;  5HIH A;  3NFZ A;  1ARL A;  3VFQ A;  1ZG9 A;  3RBU A;  2V8D A;  3KR4 A;  1PCA A;  1YSJ A;  1Z2L A;  3PFE A;  4JCA A;  4OC1 A;  3EWQ A;  4O23 A;  5LRG A;  1CX8 A;  3H8G A;  2X47 A;  4MRI A;  1LAM A;  2V8G A;  1CBX A;  2XEJ A;  4ESS A;  2PIZ A;  1QQ9 A;  5LYI A;  4GUA A;  1VHE A;  4TNU A;  3PFO A;  1CG2 A;  5HOL A;  5HXD A;  3MRU A;  2XD7 A;  3SJX A;  5CB3 A;  2EEE A;  3N5F A;  3CT9 A;  5K8P A;  3D4U A;  2GLF A;  3NH8 A;  4ABL A;  1F57 A;  3ETI A;  3EW5 A;  2CF4 A;  1TKJ A;  4GVW A;  1LFW A;  3S9M A;  4UEF A;  1BPM A;  4ZX8 A;  4JZ0 A;  4P4F A;  2XEI A;  3MN8 A;  5LYF A;  2PJ8 A;  1XBU A;  7CPA A;  5HVG A;  4GM5 A;  3ISZ A;  2ZOG A;  4R6T A;  3PB6 X;  2L8R A;  3D7F A;  2ZEE A;  4UML A;  4F9U A;  4F9V A;  1FT7 A;  2CTB A;  4ETK A;  3H8F A;  1VIX A;  2PJ9 A;  4ZY1 A;  4WWV A;  3FMC A;  2AFX A;  2V8H A;  3PB7 X;  4MHY A;  2BOA A;  3DGV A;  1CPX A;  4AXV A;  3KQX A;  3B3V A;  4NGS A;  4NGQ A;  1TKH A;  3IFE A;  1ZG7 A;  4FAI A;  4ZX9 A;  2OOT A;  5JGF A;  2PJ7 A;  2BFR A;  3DLJ A;  4P4I A;  1JQG A;  2F8H A;  3S9N A;  3GB0 A;  3CPX A;  3NH5 A;  3HLP A;  2QJ8 A;  2LGR A;  2O4H A;  1PYT B;  3KI9 A;  2BCO A;  4MCS A;  3IID A;  4PXC A;  1DTD A;  3B3C A;  2QVP A;  3KL9 A;  3LWU A;  2HB6 A;  3FED A;  1BPN A;  4ZI6 A;  1VGY A;  4UEZ A;  3V38 A;  3WC6 A;  4WJB A;  3D68 A;  4OID A;  2NSM A;  1ELL P;  3KQZ A;  4J5Q A;  1IGB A;  2ABZ A;  2PVW A;  1YLO A;  3WT4 A;  2PRQ A;  1UWY A;  3EJF A;  4EME A;  1HJZ A;  1TF9 A;  4PXB A;  3Q6Z A;  3EWR A;  3IIB A;  1TXZ A;  4MMO A;  1ZLI A;  3IWW A;  3IO1 A;  1TXR A;  4IQY A;  2GLJ A;  1LOK A;  2PJ4 A;  2C6C A;  2BFQ A;  3V45 A;  3BI0 A;  4RUH A;  3I1U A;  1XFO A;  5E3B A;  2POK A;  5ELY A;  4PPZ A;  1Z8L A;  3KR5 A;  4NGN A;  4TU0 A;  3KHX A;  2CTC A;  3GPG A;  3FVL A;  3FEC A;  3KAS A;  4P4D A;  3V2B A;  3FEE A;  3VAT A;  4DYO A;  1FNO A;  4OIW A;  6CPA A;  2PJC A;  4UF4 A;  3BI1 A;  2AFW A;  4NGR A;  4X2T A;  3B3S A;  4OME A;  3WC7 A;  1Q7L A;  2VL1 A;  3D7D A;  2C6P A;  4K0C A;  4FWU A;  3PB4 X;  5CPA A;  4EFD A;  1H8L A;  1EE3 P;  2OR4 A;  2PJA A;  3JZT A;  5AIL A;  4A39 A;  1XMB A;  3PB8 X;  1HDU A;  2JEW A;  1Y0Y A;  1SPV A;  4PXD A;  1XJO A;  3D7G A;  3WAB A;  4EWT A;  2QYV A;  4ABK A;  1YW4 A;  5F09 A;  4MHN A;  4NJQ A;  2IJZ A;  2AFZ A;  4JVV A;  5DS0 A;  4Q7A A;  3SI0 A;  1DE4 C;  2PJB A;  1ZLH A;  4P44 A;  4MCP A;  2O53 A;  4OC5 A;  4J4Z A;  1ZG8 A;  3KGQ A;  5J1Q A;  2JBJ A;  4B6Z A;  1LAN A;  5IB9 A;  3RAM A;  4NGT A;  2VRI A;  4BD9 A;  4UIA A;  2Q4Z A;  1R3N A;  4OC4 A;  3PRT A;  2AFM A;  4LQG A;  4MXU A;  5FSX A;  3GQE A;  4P10 A;  4X8I A;  2DX6 A;  3KHZ A;  1LAP A;  2PE3 A;  3EKE A;  4ZY0 A;  1RTQ A;  5JH9 A;  2AFS A;  2G9D A;  3PBB A;  4FBE A;  5THW A;  4NGP A;  2ZEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...