1LCPA

Bovine lens leucine aminopeptidase complexed with l-leucine phosphonic acid
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
484
structure length
484
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition state analogue L-leucinephosphonic acid bound to bovine lens leucine aminopeptidase: X-ray structure at 1.65 A resolution in a new crystal form.
pubmed doi rcsb
molecule tags Hydrolase (alpha-aminoacylpeptide)
molecule keywords LEUCINE AMINOPEPTIDASE
total genus 169
structure length 484
sequence length 484
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lcpA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lcpA02
4ZY0A 3D7GA 4GM5A 3B3CA 1BAVA 3EWQA 3ETIA 4DYOA 1ZG9A 2ZELA 2HC9A 5JH9A 3Q6ZA 2O53A 2FG1A 1TKJA 3SI1A 4YWYA 3FMCA 3PB4X 4ZI6A 1KWMA 4OC1A 4TNUA 3WC5A 2GLJA 4Z65A 4P10A 4OIDA 5DUSA 2ZEFA 5LYDA 4EFDA 3ISZA 5HOLA 1HDUA 5F09A 3GPGA 3KHZA 3RBUA 5LYLA 4P45A 3B2YA 2IJZA 4AXVA 2ZEHA 1H8LA 3D67A 2O4HA 3KQZA 1F2PA 4PQAA 3FECA 2V8HA 3BHXA 5K8MA 3L2NA 4UIAA 2GREA 2GU2A 1QMUA 4KYBA 3EKEA 4MCPA 2AFWA 3D4UA 4TU0A 2JEWA 4MHNA 1HJZA 3SI0A 1ELLP 1TXRA 4NGQA 1CBXA 3V7ZA 4IHMA 1AYEA 3D7HA 3IJ3A 3NH8A 4CPAA 2PJ9A 2ZEDA 7CPAA 2ZEGA 1XJOA 2CTCA 2RB7A 3IIFA 3VFQA 2PVWA 1LCPA 1YLOA 4ABKA 4NGNA 2CIJA 2PE3A 2PVVA 3TC8A 1BPNA 3WT4A 4P4DA 4MHYA 4P4EA 4MCSA 1ZR5A 1Z5RA 4X2TA 5E3BA 2EK9A 2I3CA 3EWOA 2DEAA 2AFMA 2JBKA 1Y7EA 2QJ8A 4UEZA 4R7MA 4UEFA 1HDQA 2PJ7A 3EW5A 1VIXA 3HLPA 1ELMP 5K8NA 4Q7AA 2DX6A 3KGQA 4MCQA 3WC6A 4P4IA 1LFWA 4PXBA 4PXEA 5IB9A 4A37A 2PJ2A 1CX8A 4FBEA 3B35A 3SIHA 4F9UA 5D29A 1M4LA 4NJQA 1VHEA 1XRYA 3RZAA 4J5RA 3S9NA 1YW4A 4MHZA 1TY8A 3T8WA 1PYTB 3EWPA 2FXKA 4JZ0A 1XMBA 4EMEA 3KI9A 5CB3A 3SJFA 4A39A 2EK8A 3KHXA 3SIGA 1GYTA 4IK2A 4ZYQA 1UWYA 4OC4A 4OC5A 3IIBA 5HVHA 2PJBA 4MHPA 1TF8A 3H8EA 3EJFA 1Y0RA 3FEEA 2C6CA 2BFRA 4R8FA 3SI2A 4OMEA 3KZWA 1Q7LA 1F57A 1ARLA 4H2KA 2JBJA 3VH9A 4IQYA 1QQ9A 4A38A 3ISXA 3V2BA 4P6YA 3FX6A 4NGMA 5I4MA 4JVVA 1PCAA 4G1PA 4OKOA 4OC0A 3NH4A 4BD9A 4PPZA 2IQ6A 5CPAA 3D7DA 3SIJA 1YD9A 3PB8X 5HVFA 5LRGA 4ABLA 3EJGA 2AFSA 2RFHA 3HUVA 1ARMA 1YW6A 3PEIA 4ZY2A 5JM6A 4NFRA 2AFCA 1TKHA 8CPAA 4DJLA 1TXZA 4ETKA 3QNVA 2PCUA 1NSAA 4NGPA 3PFOA 1VHOA 4A94A 3IC1A 4WWVA 1VGYA 5AILA 2ZOGA 3B3VA 3Q71A 1YSJA 2PJ8A 3B3WA 3GPQA 3S9MA 4P4BA 3H8GA 4P4JA 2J9AA 1CPSA 5HIHA 1R3NA 2ANPA 3FJUA 4JCAA 4FWUA 5THWA 3PFEA 2IMOA 2F8HA 3S9LA 3CPXA 3GPOA 2NSMA 1AMPA 2V8DA 2GLFA 3FEDA 1Z8LA 4YU9A 3MN8A 1LAPA 3MRUA 1LOKA 4ETJA 2CTBA 1DTDA 4JGKA 2XEGA 2AFZA 3IFEA 1TF9A 2V8VA 2XEIA 5FSZA 2BFQA 4MCRA 3PBBA 1LAMA 2PJ3A 2PJ0A 2V8GA 2EEEA 4NGRA 5LYIA 5LRJA 2ZENA 5CB5A 4ONWA 2ZEEA 2PJ6A 2L8RA 4O23A 4MRIA 4FUUA 2G9DA 3IO1A 3FH4A 3K9TA 4F9VA 3DGVA 2PJAA 3D66A 4GVWA 1XBUA 3CPAA 2PJCA 1ZR3A 3KR5A 1CP7A 2C1CA 5HVGA 2ABZA 1CG2A 3D68A 3SJGA 2X47A 3NFZA 3SJEA 1ZLHA 3GQEA 5CMSA 1F2OA 5K8PA 2F7VA 5LYFA 4NJRA 3JZTA 3LWUA 1JQGA 1R43A 1IY7A 6CPAA 1FT7A 1EE3P 4PXDA 2NYQA 3B7IA 3N5FA 4OC2A 1ZLIA 3NH5A 2V77A 3CDXA 2CF4A 4R6TA 1ZG8A 3SJXA 1OBRA 1HEEA 4NGTA 4X3RA 3VARA 2OOTA 3IWWA 3BI0A 2PIZA 1IGBA 5K8OA 3FF3A 2AFXA 2ZEMA 3VATA 4ESSA 5JGFA 3GUXA 5DS0A 3KASA 4UEEA 4JLLA 4OC3A 1Z2LA 4EWTA 4UIBA 1BLLE 3EWRA 1FNOA 2PJ5A 2PIYA 3WABA 3K2KA 2C6PA 2WZNA 1VHUA 4NGSA 5D8NA 2Q4ZA 3FVLA 5CBMA 3KL9A 3B3TA 4B6ZA 3D7FA 5ELYA 3PBEA 3PB9X 5FSVA 2PJ4A 1LANA 4MMOA 2XEFA 2AFOA 2HB6A 1DE4C 4RUHA 4GVVA 2OR4A 3BXMA 4LQGA 4W9YA 3IIDA 2FAVA 1XFOA 4OIWA 4OP4A 2XEJA 1BPMA 3PB7X 4KSIA 4WJBA 3KR4A 2QYVA 3WC7A 3CT9A 4MXUA 4JYWA 4GUAA 3DLJA 3NA6A 2PJ1A 4J5SA 1CPXA 2BOAA 4R76A 2VL1A 5LRKA 2FVGA 2BO9A 5J1QA 2XD7A 1SPVA 3KQXA 1YMEA 2PRQA 1ZG7A 3IEHA 4PXCA 1TKFA 5HXDA 4DUKA 2ZEOA 2AFUA 3GLJA 2EWBA 3BI1A 4K3NA 5FSXA 2ACFA 3GB0A 4IAVA 4FAIA 3V38A 2VRIA 2Q51A 3I1UA 4ZY1A 3V45A 3TX8A 3PRTA 3GQOA 1NJRA 1CP6A 2C6GA 4F8ZA 4P44A 4ZX9A 2BCOA 2POKA 2WYRA 3JRUA 3LMSA 1Y0YA 3PB6X 3RAMA 2ZEPA 2ZOFA 4TWEA 4ZX8A 4P4FA 2QVPA 4K0CA 5FSYA 4UMLA 3H8FA 2Q43A 4X8IA 3B3SA 4D86A 4J5QA 2LGRA 3SIIA 4J4ZA 1RTQA 4UF4A 5FSUA
chains in the Genus database with same CATH superfamily
1B87A 2Q7SA 4C68A 4UFWA 4ZY0A 1K4JA 4CS0B 3D7GA 3FIXA 4GM5A 3B3CA 1BAVA 3EWQA 2EUIA 4MI4A 2PSWA 3ETIA 4DYOA 2CNTA 1Y7RA 4A32A 1ZG9A 2HQYA 2ZELA 1RO5A 2FE7A 2HC9A 4KVXA 3TE4A 2YNDA 4A95A 4ZGYB 5JH9A 2AJ6A 3Q6ZA 2EBJA 2O53A 2FG1A 1TKJA 2B58A 5G20A 3SI1A 4YWYA 4A33A 3FMCA 4C2ZA 3PB4X 4ZI6A 1KWMA 4OC1A 4FD5A 4TNUA 2GLJA 3WC5A 4Z65A 4P10A 4OIDA 4CGNA 2DPSA 2VXKA 1S3ZA 5DUSA 2ZEFA 2WCTA 5LYDA 4EFDA 1Y9WA 2FIWA 2B4BA 2WSAA 3ISZA 5HOLA 1HDUA 3EXNA 5F09A 3GPGA 4L8AA 5KTDA 3KHZA 3RBUA 5LYLA 4P45A 5F47A 4KLWA 2FT0A 1IYLA 3B2YA 2IJZA 3GIUA 1QSTA 2ZEHA 4U5YA 1H8LA 2GE3A 3D67A 5AG5A 2O4HA 4C7HA 3KQZA 1F2PA 2H5MA 4PQAA 4K30A 4CAEA 3FECA 4M3SA 4L89A 4CGMA 2V8HA 3BHXA 3D2PA 2OB0A 1Z8XA 4JXQA 5K8MA 4KSAA 3L2NA 1XMTA 4UIAA 2GREA 2GU2A 1QMUA 5GCNA 4KYBA 3EKEA 4MCPA 2AFWA 3D4UA 4BMHA 4TU0A 2Q04A 2JEWA 3EY5A 4MHNA 1HJZA 3SI0A 3ZZIA 4JD6A 1ELLP 1TXRA 2OU2A 2OZHA 4NGQA 4NSQA 1CBXA 3V7ZA 4KZTA 4IHMA 1AYEA 3R95A 4PSXA 3IWGA 3D7HA 2BUEA 3IJ3A 4YFJA 3NH8A 1IOFA 3S6GA 4CPAA 2PJ9A 2ZEDA 7CPAA 2ZEGA 1XJOA 4CGOA 2Z3NA 2CTCA 2RB7A 4M6IA 3IIFA 1MK4A 3VFQA 2PVWA 3JUWA 2ZW7A 5AG4A 1LCPA 1YLOA 2QECA 1S60A 4ABKA 3R1KA 1Q2CA 4UWIA 4NGNA 2CIJA 3K9UA 1NE9A 4Q38A 3TOAA 2PE3A 2Q0YA 2PVVA 1IYKA 4NCZA 3TC8A 1BPNA 3WT4A 4KLVA 4P4DA 5AGEA 2QIRA 4OADA 4MHYA 4P4EA 1Z4RA 4MCSA 4MBUA 5EMIA 1ZR5A 1Z5RA 4X2TA 5E3BA 1BOBA 2EK9A 2I3CA 3FNCA 3OWCA 4A30A 3EWOA 2DEAA 3LODA 3P2FA 4AVAA 2AFMA 2JBKA 1Y7EA 2Q44A 2QJ8A 5C82A 2J8MA 1KUXA 4UEZA 2QMLA 4R7MA 4UEFA 1HDQA 1WK4A 4U9YA 3H4QA 2YNEA 2PJ7A 3EW5A 1VIXA 4UA3A 1P4NA 1ELMP 2FSRA 3HLPA 1SQHA 4RS2A 4Q7AA 5K8NA 2DX6A 3KGQA 4B5PA 4MCQA 3WC6A 2P6FA 3F0AA 4P4IA 5CNPA 1LFWA 2KQVA 4KOYA 4PXEA 4PXBA 5IB9A 2X7BA 1X12A 2IL4A 2PJ2A 4A37A 4XPDB 4CRYB 1CX8A 2EVNA 2FL4A 4HNYB 3B35A 4FBEA 3SIHA 4MFLA 4F9UA 3BLNA 5D29A 4KVME 1M4LA 5G22A 2YGWA 4NJQA 1VHEA 1XRYA 3RZAA 4BINA 4CRZB 4E0AA 4J5RA 3MGDA 4AG7A 3S9NA 1YW4A 4MHZA 4J3GA 5I0CA 1TY8A 3T8WA 1PYTB 3LACA 2FIAA 2JZEA 3EWPA 2FXKA 4II9A 4PK2A 3DR6A 4JZ0A 1XMBA 4EMEA 2A4NA 4Y49B 3KI9A 5CB3A 3SJFA 3GY9A 4JJXA 4NF1A 2EK8A 4A39A 4IF5A 1QSOA 4F6AA 2PDOA 3KHXA 3SIGA 1YREA 1L0CA 1GYTA 4IK2A 4ZYQA 1UWYA 2Z3OA 4OC4A 1S7LA 4OC5A 3T9YA 3IIBA 5F48A 3CZXA 3FYNA 5HVHA 2PJBA 4MHPA 2D4PA 3H5ZA 1TF8A 3D3SA 3H8EA 2ZPAA 3R9EA 1IOIA 4E2AA 4GS4A 3EJFA 2JLMA 1Y0RA 2FCKA 3F5BA 3FEEA 5G1ZA 5C88A 3W6XA 2C6CA 5F49A 3TT2A 2BFRA 3B8GA 1NSLA 3I9SA 4R8FA 3SI2A 4AXVA 1IICA 4OMEA 3CXSA 2W2GA 3KZWA 1M4GA 2R1IA 4KOXA 1Q7LA 4UCMA 3RYOA 1F57A 4MY0A 2Z10A 1ARLA 4H2KA 2JBJA 3VH9A 2R7HA 4IQYA 1QQ9A 4A38A 3CXPA 2REFA 3ISXA 1CM0A 2Z3PA 2BSWA 1Z4EA 3V2BA 4P6YA 2FXFA 1S5KA 3FX6A 1M1DA 4NGMA 1IU8A 5I4MA 2PC1A 4JVVA 1KZFA 1PCAA 1TIQA 1Y9KA 4G1PA 4OKOA 4QB9A 3RNZA 1KUYA 3NE8A 4OC0A 3NH4A 5EC4A 4CYNA 4BD9A 4PPZA 2IQ6A 5H84A 5CPAA 2OZGA 4U9ZA 3D7DA 4MJ8A 3SIJA 1YD9A 3PB8X 5HVFA 5LRGA 4ABLA 3TFYA 3EJGA 1YVKA 2AFSA 2RFHA 3HUVA 1MJBA 2PRBA 5JPHA 1ARMA 2DXQA 4LQ6A 1YW6A 3PEIA 2ZW6A 2B3VA 4ZY2A 1QSRA 3GKRA 5JM6A 5JQ4A 4NFRA 2AFCA 1TKHA 2R8VA 4DJLA 2J8NA 8CPAA 1TXZA 1KUVA 4ETKA 4M85A 3FBUA 4F0YA 1M4IA 2VZZA 3QNVA 3IU1A 2PCUA 4Q36A 1NSAA 2Q4YA 4NGPA 3PFOA 2JZFA 1VHOA 4CGLA 2RNKA 2ZW5A 4A94A 3IC1A 4C7IA 4WWVA 5IV0A 1VGYA 5AILA 2GANA 2B4DA 2ZOGA 4KUAA 4MFZA 3TO9A 3FB3A 3B3VA 3Q71A 1YSJA 2ODFA 2PJ8A 3B3WA 3GPQA 3PGPA 3S9MA 4P4BA 3H8GA 4QC6A 4P4JA 4CYQA 2J9AA 1CPSA 5HIHA 1R3NA 2ANPA 3A9LA 3FJUA 3FXTA 4JCAA 2Z3MA 4FD6A 4FWUA 3F8KA 5THWA 3PFEA 3QAYA 2IMOA 1YR0A 3RO0A 1XF8A 2F5IA 2F8HA 3D2MA 1JWQA 2B5GB 3G3SA 4KOUA 3CPXA 3GPOA 1AMPA 2I00A 1NMTA 2NSMA 2V8DA 3S9LA 4B13A 2GLFA 3N7ZA 2P6EA 3FEDA 3GYAA 3EC4A 1Z8LA 3TOBA 4AVBA 3S6KA 4YU9A 3MN8A 3FRMA 1LAPA 4B14A 3JTKA 4OAEA 1B6BA 2VZYA 1GHEA 3MRUA 4UCNA 1LOKA 4ETJA 1U6MA 4A31A 2CNMA 2CTBA 1DTDA 4JGKA 1R57A 1RXTA 2B5GA 2XEGA 2AFZA 3R9GA 3IFEA 1TF9A 2V8VA 5IB0A 2XEIA 5FSZA 2BFQA 4MCRA 1FY7A 3PBBA 5E96A 1LAMA 4I49A 1I21A 2PJ3A 2PJ0A 2NMTA 2V8GA 2EEEA 5KTCA 4NGRA 5LYIA 5LRJA 2D4OA 2B3UA 2ZENA 5CB5A 4ONWA 2YNCC 4LUAA 2ZEEA 5J8CA 2PJ6A 2L8RA 3QB8A 4C2YA 4O23A 4MFPA 4MRIA 4NEXA 4KS9A 4FUUA 1WWZA 2G9DA 4UFVA 3S6HA 3IO1A 3FH4A 2Q7BA 3K9TA 4KUBA 3ZJ0A 4CYPA 4F9VA 4XPDC 3DGVA 2PJAA 3D66A 4GVWA 4B12A 4KOWA 4NXYA 4GXHA 1Q2YA 1XBUA 5DWMA 4UWJA 3R96A 4JWPA 1M4DA 4R3LA 3CPAA 2ARHA 2PJCA 1ZR3A 2B4DB 3KR5A 2PR1A 4QBJA 1CP7A 4ORFA 2C1CA 5HVGA 2G3AA 2ABZA 2BL1A 1CG2A 3D68A 2OZUA 1MJAA 1ON0A 3SJGA 2X47A 4XPLA 3NFZA 3SJEA 1ZLHA 3DR8A 3GQEA 5CMSA 1F2OA 2VBQA 4E8OA 5A27A 5K8PA 3C26A 2F7VA 2JEVA 5LYFA 4NJRA 3JZTA 2OH1A 3LWUA 1JQGA 1R43A 1IY7A 5G21A 4KOTA 6CPAA 1FT7A 4QUSA 4DNCA 1EE3P 3BJ7A 1V0CA 4PXDA 2NYQA 4UBRA 2BEIA 3B7IA 4CAVA 4R3KA 2Q4VA 2Y0MA 4PSWA 4JLYA 4B11A 4H6UA 4CAWA 3N5FA 1YGHA 3DNSA 4H89A 4OC2A 1ZLIA 4C2XA 3NH5A 2V77A 3T90A 3CDXA 1XIXA 2CF4A 4R6TA 1ZG8A 2ATRA 4H6ZA 3SJXA 1OBRA 4MFKA 1HEEA 4NGTA 2Z3LA 4X3RA 1UFHA 2WUUA 3VARA 4QVTA 4CYOA 5BWAB 2HUZA 4M6HA 1PU9A 1X10A 1XE4A 3W91A 2OOTA 4X5KA 3IWWA 1J4JA 3BI0A 2CXAA 4A2ZA 4LX9A 3CXQA 2PIZA 1IGBA 4HPSA 5K8OA 2G0BA 2JDDA 2HV2A 2PR8A 3FF3A 3PZJA 4EVYA 2AFXA 2ZEMA 3VATA 4ESSA 5DWNA 4B5OA 5JGFA 1YQEA 2Z11A 2DPTA 4YRHA 3GUXA 1MJ9A 1A2ZA 4MHDA 3KASA 5DS0A 4HNXB 4UEEA 4JLLA 3UY5A 1IB1E 1Z2LA 3JVNA 4OC3A 4EWTA 1YVOA 3SXNA 4UIBA 1S7FA 1BLLE 3EWRA 4JXRA 1FNOA 2PJ5A 2PIYA 3WABA 5EBVA 4FD4A 3K2KA 2C6PA 2K5TA 2WZNA 4M6GA 3SXOA 1VHUA 1I12A 3DDDA 4MFQA 5HMNA 4NGSA 1Z9UA 4ONUA 5D8NA 4R87A 4R9MA 2Q4ZA 3FVLA 5CBMA 2AE6A 3KL9A 3B3TA 4B6ZA 4BBHA 3D7FA 5ELYA 3PBEA 2VQYA 1M44A 2ZW4A 3P2HA 3PB9X 5FSVA 4PV6A 3V8IA 2PJ4A 1YLEA 1LANA 2Z3KA 5FVJA 2P6GA 4MMOA 3WR7A 2XEFA 2AFOA 3PP9A 2HB6A 1DE4C 2KCWA 1Z8WA 4RUHA 4GVVA 4RI1A 2OR4A 3BXMA 4HKFA 4LQGA 4W9YA 4ZBGA 3IIDA 3KKWA 2FAVA 1XFOA 4OIWA 5J8FA 4OP4A 1LRZA 2XEJA 1BPMA 3PB7X 4KSIA 2DF5A 4WJBA 3KR4A 2QYVA 3WC7A 1VKCA 4FD7A 2J8RA 4OLLA 3CT9A 4MXUA 3TCVA 4JYWA 2VI7A 2C27A 4GUAA 2G3TA 3DLJA 4F0XA 5F46A 3NA6A 2PJ1A 2ZXVA 2R98A 4PK3A 2BOAA 4J5SA 1CPXA 4R76A 2VL1A 3QAHA 2FVGA 5LRKA 1P0HA 2WPXA 2BO9A 3I3GA 5J1QA 3VWEA 2XD7A 1SPVA 4RN7A 5A28A 3KQXA 1YMEA 2PRQA 1ZO0A 2JDCA 3G8WA 1ZG7A 3R9FA 1I1DA 1PUAA 3IEHA 3TO7A 4PXCA 1Z8TA 3VWDA 2REEA 4B10A 1TKFA 5HXDA 4KOVA 2CY2A 2GIVA 4DUKA 2GFQA 2FS5A 4CGPA 2ZEOA 1S7KA 4MFJA 5AG7A 2AFUA 1QSNA 3GLJA 3W6SA 2EWBA 5ISVA 3IU2A 4CAFA 1YK3A 5AG6A 3BI1A 3S6FA 4K3NA 5FSXA 2ACFA 3GB0A 4IAVA 4XNHC 4FAIA 4CAXA 3EO4A 1N71A 3V38A 2VRIA 2Q51A 4KVOE 1AUGA 3I1UA 2I79A 4ZY1A 3V45A 3TX8A 1IIDA 2RC4A 1VHSA 4XPKA 3PRTA 3GQOA 2PQ8A 1NJRA 1CP6A 2C6GA 4F8ZA 4UCPA 4P44A 3TO6A 5HH1A 1BO4A 2VEZA 4ZX9A 2BCOA 4R57A 5KTAA 2POKA 2P0WA 4KOSA 4Y49C 4KSFA 3SHPA 2WYRA 4XNHB 4UFXA 3JRUA 3LMSA 4MY3A 1Y0YA 2O28A 3NE7A 4KORA 3E0KA 3PB6X 3TTHA 3RAMA 4AG9A 5IX3A 3LD2A 4YGOA 4AB7A 1XEBA 3D8PA 2ZEPA 2ZOFA 3EFAA 1S7NA 4TWEA 1YX0A 1Q2DA 4HNWB 4ZX8A 1OZPA 4P4FA 2QVPA 4K0CA 5FSYA 3H8FA 4UMLA 1CJWA 1QSMA 3DSBA 2Z0ZA 2Q43A 3IWEA 2WPWA 5H86A 4X8IA 3BJ8A 3B3SA 4AVCA 4D86A 4J5QA 4B5PB 2JZDA 2LGRA 2CNSA 3SIIA 1XOVA 2EO8A 3IGRA 4J4ZA 2YNCA 1RTQA 4UF4A 4IUSA 5FSUA
chains in the Genus database with same CATH topology
4ZY0A 3D7GA 4GM5A 3B3CA 1BAVA 3EWQA 3ETIA 4DYOA 1ZG9A 2ZELA 2HC9A 5JH9A 3Q6ZA 2O53A 2FG1A 1TKJA 3SI1A 4YWYA 3FMCA 3PB4X 4ZI6A 1KWMA 4OC1A 4TNUA 3WC5A 2GLJA 4Z65A 4P10A 4OIDA 5DUSA 2ZEFA 5LYDA 4EFDA 3ISZA 5HOLA 1HDUA 5F09A 3GPGA 3KHZA 3RBUA 5LYLA 4P45A 3B2YA 2IJZA 4AXVA 2ZEHA 1H8LA 3D67A 2O4HA 3KQZA 1F2PA 4PQAA 3FECA 2V8HA 3BHXA 5K8MA 3L2NA 4UIAA 2GREA 2GU2A 1QMUA 4KYBA 3EKEA 4MCPA 2AFWA 3D4UA 4TU0A 2JEWA 4MHNA 1HJZA 3SI0A 1ELLP 1TXRA 4NGQA 1CBXA 3V7ZA 4IHMA 1AYEA 3D7HA 3IJ3A 3NH8A 4CPAA 2PJ9A 2ZEDA 7CPAA 2ZEGA 1XJOA 2CTCA 2RB7A 3IIFA 3VFQA 2PVWA 1LCPA 1YLOA 4ABKA 4NGNA 2CIJA 2PE3A 2PVVA 3TC8A 1BPNA 3WT4A 4P4DA 4MHYA 4P4EA 4MCSA 1ZR5A 1Z5RA 4X2TA 5E3BA 2EK9A 2I3CA 3EWOA 2DEAA 2AFMA 2JBKA 1Y7EA 2QJ8A 4UEZA 4R7MA 4UEFA 1HDQA 2PJ7A 3EW5A 1VIXA 3HLPA 1ELMP 5K8NA 4Q7AA 2DX6A 3KGQA 4MCQA 3WC6A 4P4IA 1LFWA 4PXBA 4PXEA 5IB9A 4A37A 2PJ2A 1CX8A 4FBEA 3B35A 3SIHA 4F9UA 5D29A 1M4LA 4NJQA 1VHEA 1XRYA 3RZAA 4J5RA 3S9NA 1YW4A 4MHZA 1TY8A 3T8WA 1PYTB 3EWPA 2FXKA 4JZ0A 1XMBA 4EMEA 3KI9A 5CB3A 3SJFA 4A39A 2EK8A 3KHXA 3SIGA 1GYTA 4IK2A 4ZYQA 1UWYA 4OC4A 4OC5A 3IIBA 5HVHA 2PJBA 4MHPA 1TF8A 3H8EA 3EJFA 1Y0RA 3FEEA 2C6CA 2BFRA 4R8FA 3SI2A 4OMEA 3KZWA 1Q7LA 1F57A 1ARLA 4H2KA 2JBJA 3VH9A 4IQYA 1QQ9A 4A38A 3ISXA 3V2BA 4P6YA 3FX6A 4NGMA 5I4MA 4JVVA 1PCAA 4G1PA 4OKOA 4OC0A 3NH4A 4BD9A 4PPZA 2IQ6A 5CPAA 3D7DA 3SIJA 1YD9A 3PB8X 5HVFA 5LRGA 4ABLA 3EJGA 2AFSA 2RFHA 3HUVA 1ARMA 1YW6A 3PEIA 4ZY2A 5JM6A 4NFRA 2AFCA 1TKHA 8CPAA 4DJLA 1TXZA 4ETKA 3QNVA 2PCUA 1NSAA 4NGPA 3PFOA 1VHOA 4A94A 3IC1A 4WWVA 1VGYA 5AILA 2ZOGA 3B3VA 3Q71A 1YSJA 2PJ8A 3B3WA 3GPQA 3S9MA 4P4BA 3H8GA 4P4JA 2J9AA 1CPSA 5HIHA 1R3NA 2ANPA 3FJUA 4JCAA 4FWUA 5THWA 3PFEA 2IMOA 2F8HA 3S9LA 3CPXA 3GPOA 2NSMA 1AMPA 2V8DA 2GLFA 3FEDA 1Z8LA 4YU9A 3MN8A 1LAPA 3MRUA 1LOKA 4ETJA 2CTBA 1DTDA 4JGKA 2XEGA 2AFZA 3IFEA 1TF9A 2V8VA 2XEIA 5FSZA 2BFQA 4MCRA 3PBBA 1LAMA 2PJ3A 2PJ0A 2V8GA 2EEEA 4NGRA 5LYIA 5LRJA 2ZENA 5CB5A 4ONWA 2ZEEA 2PJ6A 2L8RA 4O23A 4MRIA 4FUUA 2G9DA 3IO1A 3FH4A 3K9TA 4F9VA 3DGVA 2PJAA 3D66A 4GVWA 1XBUA 3CPAA 2PJCA 1ZR3A 3KR5A 1CP7A 2C1CA 5HVGA 2ABZA 1CG2A 3D68A 3SJGA 2X47A 3NFZA 3SJEA 1ZLHA 3GQEA 5CMSA 1F2OA 5K8PA 2F7VA 5LYFA 4NJRA 3JZTA 3LWUA 1JQGA 1R43A 1IY7A 6CPAA 1FT7A 1EE3P 4PXDA 2NYQA 3B7IA 3N5FA 4OC2A 1ZLIA 3NH5A 2V77A 3CDXA 2CF4A 4R6TA 1ZG8A 3SJXA 1OBRA 1HEEA 4NGTA 4X3RA 3VARA 2OOTA 3IWWA 3BI0A 2PIZA 1IGBA 5K8OA 3FF3A 2AFXA 2ZEMA 3VATA 4ESSA 5JGFA 3GUXA 5DS0A 3KASA 4UEEA 4JLLA 4OC3A 1Z2LA 4EWTA 4UIBA 1BLLE 3EWRA 1FNOA 2PJ5A 2PIYA 3WABA 3K2KA 2C6PA 2WZNA 1VHUA 4NGSA 5D8NA 2Q4ZA 3FVLA 5CBMA 3KL9A 3B3TA 4B6ZA 3D7FA 5ELYA 3PBEA 3PB9X 5FSVA 2PJ4A 1LANA 4MMOA 2XEFA 2AFOA 2HB6A 1DE4C 4RUHA 4GVVA 2OR4A 3BXMA 4LQGA 4W9YA 3IIDA 2FAVA 1XFOA 4OIWA 4OP4A 2XEJA 1BPMA 3PB7X 4KSIA 4WJBA 3KR4A 2QYVA 3WC7A 3CT9A 4MXUA 4JYWA 4GUAA 3DLJA 3NA6A 2PJ1A 4J5SA 1CPXA 2BOAA 4R76A 2VL1A 5LRKA 2FVGA 2BO9A 5J1QA 2XD7A 1SPVA 3KQXA 1YMEA 2PRQA 1ZG7A 3IEHA 4PXCA 1TKFA 5HXDA 4DUKA 2ZEOA 2AFUA 3GLJA 2EWBA 3BI1A 4K3NA 5FSXA 2ACFA 3GB0A 4IAVA 4FAIA 3V38A 2VRIA 2Q51A 3I1UA 4ZY1A 3V45A 3TX8A 3PRTA 3GQOA 1NJRA 1CP6A 2C6GA 4F8ZA 4P44A 4ZX9A 2BCOA 2POKA 2WYRA 3JRUA 3LMSA 1Y0YA 3PB6X 3RAMA 2ZEPA 2ZOFA 4TWEA 4ZX8A 4P4FA 2QVPA 4K0CA 5FSYA 4UMLA 3H8FA 2Q43A 4X8IA 3B3SA 4D86A 4J5QA 2LGRA 3SIIA 4J4ZA 1RTQA 4UF4A 5FSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZY0 A;  3D7G A;  4GM5 A;  3B3C A;  1BAV A;  3EWQ A;  3ETI A;  4DYO A;  1ZG9 A;  2ZEL A;  2HC9 A;  5JH9 A;  3Q6Z A;  2O53 A;  2FG1 A;  1TKJ A;  3SI1 A;  4YWY A;  3FMC A;  3PB4 X;  4ZI6 A;  1KWM A;  4OC1 A;  4TNU A;  3WC5 A;  2GLJ A;  4Z65 A;  4P10 A;  4OID A;  5DUS A;  2ZEF A;  5LYD A;  4EFD A;  3ISZ A;  5HOL A;  1HDU A;  5F09 A;  3GPG A;  3KHZ A;  3RBU A;  5LYL A;  4P45 A;  3B2Y A;  2IJZ A;  4AXV A;  2ZEH A;  1H8L A;  3D67 A;  2O4H A;  3KQZ A;  1F2P A;  4PQA A;  3FEC A;  2V8H A;  3BHX A;  5K8M A;  3L2N A;  4UIA A;  2GRE A;  2GU2 A;  1QMU A;  4KYB A;  3EKE A;  4MCP A;  2AFW A;  3D4U A;  4TU0 A;  2JEW A;  4MHN A;  1HJZ A;  3SI0 A;  1ELL P;  1TXR A;  4NGQ A;  1CBX A;  3V7Z A;  4IHM A;  1AYE A;  3D7H A;  3IJ3 A;  3NH8 A;  4CPA A;  2PJ9 A;  2ZED A;  7CPA A;  2ZEG A;  1XJO A;  2CTC A;  2RB7 A;  3IIF A;  3VFQ A;  2PVW A;  1LCP A;  1YLO A;  4ABK A;  4NGN A;  2CIJ A;  2PE3 A;  2PVV A;  3TC8 A;  1BPN A;  3WT4 A;  4P4D A;  4MHY A;  4P4E A;  4MCS A;  1ZR5 A;  1Z5R A;  4X2T A;  5E3B A;  2EK9 A;  2I3C A;  3EWO A;  2DEA A;  2AFM A;  2JBK A;  1Y7E A;  2QJ8 A;  4UEZ A;  4R7M A;  4UEF A;  1HDQ A;  2PJ7 A;  3EW5 A;  1VIX A;  3HLP A;  1ELM P;  5K8N A;  4Q7A A;  2DX6 A;  3KGQ A;  4MCQ A;  3WC6 A;  4P4I A;  1LFW A;  4PXB A;  4PXE A;  5IB9 A;  4A37 A;  2PJ2 A;  1CX8 A;  4FBE A;  3B35 A;  3SIH A;  4F9U A;  5D29 A;  1M4L A;  4NJQ A;  1VHE A;  1XRY A;  3RZA A;  4J5R A;  3S9N A;  1YW4 A;  4MHZ A;  1TY8 A;  3T8W A;  1PYT B;  3EWP A;  2FXK A;  4JZ0 A;  1XMB A;  4EME A;  3KI9 A;  5CB3 A;  3SJF A;  4A39 A;  2EK8 A;  3KHX A;  3SIG A;  1GYT A;  4IK2 A;  4ZYQ A;  1UWY A;  4OC4 A;  4OC5 A;  3IIB A;  5HVH A;  2PJB A;  4MHP A;  1TF8 A;  3H8E A;  3EJF A;  1Y0R A;  3FEE A;  2C6C A;  2BFR A;  4R8F A;  3SI2 A;  4OME A;  3KZW A;  1Q7L A;  1F57 A;  1ARL A;  4H2K A;  2JBJ A;  3VH9 A;  4IQY A;  1QQ9 A;  4A38 A;  3ISX A;  3V2B A;  4P6Y A;  3FX6 A;  4NGM A;  5I4M A;  4JVV A;  1PCA A;  4G1P A;  4OKO A;  4OC0 A;  3NH4 A;  4BD9 A;  4PPZ A;  2IQ6 A;  5CPA A;  3D7D A;  3SIJ A;  1YD9 A;  3PB8 X;  5HVF A;  5LRG A;  4ABL A;  3EJG A;  2AFS A;  2RFH A;  3HUV A;  1ARM A;  1YW6 A;  3PEI A;  4ZY2 A;  5JM6 A;  4NFR A;  2AFC A;  1TKH A;  8CPA A;  4DJL A;  1TXZ A;  4ETK A;  3QNV A;  2PCU A;  1NSA A;  4NGP A;  3PFO A;  1VHO A;  4A94 A;  3IC1 A;  4WWV A;  1VGY A;  5AIL A;  2ZOG A;  3B3V A;  3Q71 A;  1YSJ A;  2PJ8 A;  3B3W A;  3GPQ A;  3S9M A;  4P4B A;  3H8G A;  4P4J A;  2J9A A;  1CPS A;  5HIH A;  1R3N A;  2ANP A;  3FJU A;  4JCA A;  4FWU A;  5THW A;  3PFE A;  2IMO A;  2F8H A;  3S9L A;  3CPX A;  3GPO A;  2NSM A;  1AMP A;  2V8D A;  2GLF A;  3FED A;  1Z8L A;  4YU9 A;  3MN8 A;  1LAP A;  3MRU A;  1LOK A;  4ETJ A;  2CTB A;  1DTD A;  4JGK A;  2XEG A;  2AFZ A;  3IFE A;  1TF9 A;  2V8V A;  2XEI A;  5FSZ A;  2BFQ A;  4MCR A;  3PBB A;  1LAM A;  2PJ3 A;  2PJ0 A;  2V8G A;  2EEE A;  4NGR A;  5LYI A;  5LRJ A;  2ZEN A;  5CB5 A;  4ONW A;  2ZEE A;  2PJ6 A;  2L8R A;  4O23 A;  4MRI A;  4FUU A;  2G9D A;  3IO1 A;  3FH4 A;  3K9T A;  4F9V A;  3DGV A;  2PJA A;  3D66 A;  4GVW A;  1XBU A;  3CPA A;  2PJC A;  1ZR3 A;  3KR5 A;  1CP7 A;  2C1C A;  5HVG A;  2ABZ A;  1CG2 A;  3D68 A;  3SJG A;  2X47 A;  3NFZ A;  3SJE A;  1ZLH A;  3GQE A;  5CMS A;  1F2O A;  5K8P A;  2F7V A;  5LYF A;  4NJR A;  3JZT A;  3LWU A;  1JQG A;  1R43 A;  1IY7 A;  6CPA A;  1FT7 A;  1EE3 P;  4PXD A;  2NYQ A;  3B7I A;  3N5F A;  4OC2 A;  1ZLI A;  3NH5 A;  2V77 A;  3CDX A;  2CF4 A;  4R6T A;  1ZG8 A;  3SJX A;  1OBR A;  1HEE A;  4NGT A;  4X3R A;  3VAR A;  2OOT A;  3IWW A;  3BI0 A;  2PIZ A;  1IGB A;  5K8O A;  3FF3 A;  2AFX A;  2ZEM A;  3VAT A;  4ESS A;  5JGF A;  3GUX A;  5DS0 A;  3KAS A;  4UEE A;  4JLL A;  4OC3 A;  1Z2L A;  4EWT A;  4UIB A;  1BLL E;  3EWR A;  1FNO A;  2PJ5 A;  2PIY A;  3WAB A;  3K2K A;  2C6P A;  2WZN A;  1VHU A;  4NGS A;  5D8N A;  2Q4Z A;  3FVL A;  5CBM A;  3KL9 A;  3B3T A;  4B6Z A;  3D7F A;  5ELY A;  3PBE A;  3PB9 X;  5FSV A;  2PJ4 A;  1LAN A;  4MMO A;  2XEF A;  2AFO A;  2HB6 A;  1DE4 C;  4RUH A;  4GVV A;  2OR4 A;  3BXM A;  4LQG A;  4W9Y A;  3IID A;  2FAV A;  1XFO A;  4OIW A;  4OP4 A;  2XEJ A;  1BPM A;  3PB7 X;  4KSI A;  4WJB A;  3KR4 A;  2QYV A;  3WC7 A;  3CT9 A;  4MXU A;  4JYW A;  4GUA A;  3DLJ A;  3NA6 A;  2PJ1 A;  4J5S A;  1CPX A;  2BOA A;  4R76 A;  2VL1 A;  5LRK A;  2FVG A;  2BO9 A;  5J1Q A;  2XD7 A;  1SPV A;  3KQX A;  1YME A;  2PRQ A;  1ZG7 A;  3IEH A;  4PXC A;  1TKF A;  5HXD A;  4DUK A;  2ZEO A;  2AFU A;  3GLJ A;  2EWB A;  3BI1 A;  4K3N A;  5FSX A;  2ACF A;  3GB0 A;  4IAV A;  4FAI A;  3V38 A;  2VRI A;  2Q51 A;  3I1U A;  4ZY1 A;  3V45 A;  3TX8 A;  3PRT A;  3GQO A;  1NJR A;  1CP6 A;  2C6G A;  4F8Z A;  4P44 A;  4ZX9 A;  2BCO A;  2POK A;  2WYR A;  3JRU A;  3LMS A;  1Y0Y A;  3PB6 X;  3RAM A;  2ZEP A;  2ZOF A;  4TWE A;  4ZX8 A;  4P4F A;  2QVP A;  4K0C A;  5FSY A;  4UML A;  3H8F A;  2Q43 A;  4X8I A;  3B3S A;  4D86 A;  4J5Q A;  2LGR A;  3SII A;  4J4Z A;  1RTQ A;  4UF4 A;  5FSU A; 
#chains in the Genus database with same CATH topology
 1B87 A;  2Q7S A;  4C68 A;  4UFW A;  4ZY0 A;  1K4J A;  4CS0 B;  3D7G A;  3FIX A;  4GM5 A;  3B3C A;  1BAV A;  3EWQ A;  2EUI A;  4MI4 A;  2PSW A;  3ETI A;  4DYO A;  2CNT A;  1Y7R A;  4A32 A;  1ZG9 A;  2HQY A;  2ZEL A;  1RO5 A;  2FE7 A;  2HC9 A;  4KVX A;  3TE4 A;  2YND A;  4A95 A;  4ZGY B;  5JH9 A;  2AJ6 A;  3Q6Z A;  2EBJ A;  2O53 A;  2FG1 A;  1TKJ A;  2B58 A;  5G20 A;  3SI1 A;  4YWY A;  4A33 A;  3FMC A;  4C2Z A;  3PB4 X;  4ZI6 A;  1KWM A;  4OC1 A;  4FD5 A;  4TNU A;  2GLJ A;  3WC5 A;  4Z65 A;  4P10 A;  4OID A;  4CGN A;  2DPS A;  2VXK A;  1S3Z A;  5DUS A;  2ZEF A;  2WCT A;  5LYD A;  4EFD A;  1Y9W A;  2FIW A;  2B4B A;  2WSA A;  3ISZ A;  5HOL A;  1HDU A;  3EXN A;  5F09 A;  3GPG A;  4L8A A;  5KTD A;  3KHZ A;  3RBU A;  5LYL A;  4P45 A;  5F47 A;  4KLW A;  2FT0 A;  1IYL A;  3B2Y A;  2IJZ A;  3GIU A;  1QST A;  2ZEH A;  4U5Y A;  1H8L A;  2GE3 A;  3D67 A;  5AG5 A;  2O4H A;  4C7H A;  3KQZ A;  1F2P A;  2H5M A;  4PQA A;  4K30 A;  4CAE A;  3FEC A;  4M3S A;  4L89 A;  4CGM A;  2V8H A;  3BHX A;  3D2P A;  2OB0 A;  1Z8X A;  4JXQ A;  5K8M A;  4KSA A;  3L2N A;  1XMT A;  4UIA A;  2GRE A;  2GU2 A;  1QMU A;  5GCN A;  4KYB A;  3EKE A;  4MCP A;  2AFW A;  3D4U A;  4BMH A;  4TU0 A;  2Q04 A;  2JEW A;  3EY5 A;  4MHN A;  1HJZ A;  3SI0 A;  3ZZI A;  4JD6 A;  1ELL P;  1TXR A;  2OU2 A;  2OZH A;  4NGQ A;  4NSQ A;  1CBX A;  3V7Z A;  4KZT A;  4IHM A;  1AYE A;  3R95 A;  4PSX A;  3IWG A;  3D7H A;  2BUE A;  3IJ3 A;  4YFJ A;  3NH8 A;  1IOF A;  3S6G A;  4CPA A;  2PJ9 A;  2ZED A;  7CPA A;  2ZEG A;  1XJO A;  4CGO A;  2Z3N A;  2CTC A;  2RB7 A;  4M6I A;  3IIF A;  1MK4 A;  3VFQ A;  2PVW A;  3JUW A;  2ZW7 A;  5AG4 A;  1LCP A;  1YLO A;  2QEC A;  1S60 A;  4ABK A;  3R1K A;  1Q2C A;  4UWI A;  4NGN A;  2CIJ A;  3K9U A;  1NE9 A;  4Q38 A;  3TOA A;  2PE3 A;  2Q0Y A;  2PVV A;  1IYK A;  4NCZ A;  3TC8 A;  1BPN A;  3WT4 A;  4KLV A;  4P4D A;  5AGE A;  2QIR A;  4OAD A;  4MHY A;  4P4E A;  1Z4R A;  4MCS A;  4MBU A;  5EMI A;  1ZR5 A;  1Z5R A;  4X2T A;  5E3B A;  1BOB A;  2EK9 A;  2I3C A;  3FNC A;  3OWC A;  4A30 A;  3EWO A;  2DEA A;  3LOD A;  3P2F A;  4AVA A;  2AFM A;  2JBK A;  1Y7E A;  2Q44 A;  2QJ8 A;  5C82 A;  2J8M A;  1KUX A;  4UEZ A;  2QML A;  4R7M A;  4UEF A;  1HDQ A;  1WK4 A;  4U9Y A;  3H4Q A;  2YNE A;  2PJ7 A;  3EW5 A;  1VIX A;  4UA3 A;  1P4N A;  1ELM P;  2FSR A;  3HLP A;  1SQH A;  4RS2 A;  4Q7A A;  5K8N A;  2DX6 A;  3KGQ A;  4B5P A;  4MCQ A;  3WC6 A;  2P6F A;  3F0A A;  4P4I A;  5CNP A;  1LFW A;  2KQV A;  4KOY A;  4PXE A;  4PXB A;  5IB9 A;  2X7B A;  1X12 A;  2IL4 A;  2PJ2 A;  4A37 A;  4XPD B;  4CRY B;  1CX8 A;  2EVN A;  2FL4 A;  4HNY B;  3B35 A;  4FBE A;  3SIH A;  4MFL A;  4F9U A;  3BLN A;  5D29 A;  4KVM E;  1M4L A;  5G22 A;  2YGW A;  4NJQ A;  1VHE A;  1XRY A;  3RZA A;  4BIN A;  4CRZ B;  4E0A A;  4J5R A;  3MGD A;  4AG7 A;  3S9N A;  1YW4 A;  4MHZ A;  4J3G A;  5I0C A;  1TY8 A;  3T8W A;  1PYT B;  3LAC A;  2FIA A;  2JZE A;  3EWP A;  2FXK A;  4II9 A;  4PK2 A;  3DR6 A;  4JZ0 A;  1XMB A;  4EME A;  2A4N A;  4Y49 B;  3KI9 A;  5CB3 A;  3SJF A;  3GY9 A;  4JJX A;  4NF1 A;  2EK8 A;  4A39 A;  4IF5 A;  1QSO A;  4F6A A;  2PDO A;  3KHX A;  3SIG A;  1YRE A;  1L0C A;  1GYT A;  4IK2 A;  4ZYQ A;  1UWY A;  2Z3O A;  4OC4 A;  1S7L A;  4OC5 A;  3T9Y A;  3IIB A;  5F48 A;  3CZX A;  3FYN A;  5HVH A;  2PJB A;  4MHP A;  2D4P A;  3H5Z A;  1TF8 A;  3D3S A;  3H8E A;  2ZPA A;  3R9E A;  1IOI A;  4E2A A;  4GS4 A;  3EJF A;  2JLM A;  1Y0R A;  2FCK A;  3F5B A;  3FEE A;  5G1Z A;  5C88 A;  3W6X A;  2C6C A;  5F49 A;  3TT2 A;  2BFR A;  3B8G A;  1NSL A;  3I9S A;  4R8F A;  3SI2 A;  4AXV A;  1IIC A;  4OME A;  3CXS A;  2W2G A;  3KZW A;  1M4G A;  2R1I A;  4KOX A;  1Q7L A;  4UCM A;  3RYO A;  1F57 A;  4MY0 A;  2Z10 A;  1ARL A;  4H2K A;  2JBJ A;  3VH9 A;  2R7H A;  4IQY A;  1QQ9 A;  4A38 A;  3CXP A;  2REF A;  3ISX A;  1CM0 A;  2Z3P A;  2BSW A;  1Z4E A;  3V2B A;  4P6Y A;  2FXF A;  1S5K A;  3FX6 A;  1M1D A;  4NGM A;  1IU8 A;  5I4M A;  2PC1 A;  4JVV A;  1KZF A;  1PCA A;  1TIQ A;  1Y9K A;  4G1P A;  4OKO A;  4QB9 A;  3RNZ A;  1KUY A;  3NE8 A;  4OC0 A;  3NH4 A;  5EC4 A;  4CYN A;  4BD9 A;  4PPZ A;  2IQ6 A;  5H84 A;  5CPA A;  2OZG A;  4U9Z A;  3D7D A;  4MJ8 A;  3SIJ A;  1YD9 A;  3PB8 X;  5HVF A;  5LRG A;  4ABL A;  3TFY A;  3EJG A;  1YVK A;  2AFS A;  2RFH A;  3HUV A;  1MJB A;  2PRB A;  5JPH A;  1ARM A;  2DXQ A;  4LQ6 A;  1YW6 A;  3PEI A;  2ZW6 A;  2B3V A;  4ZY2 A;  1QSR A;  3GKR A;  5JM6 A;  5JQ4 A;  4NFR A;  2AFC A;  1TKH A;  2R8V A;  4DJL A;  2J8N A;  8CPA A;  1TXZ A;  1KUV A;  4ETK A;  4M85 A;  3FBU A;  4F0Y A;  1M4I A;  2VZZ A;  3QNV A;  3IU1 A;  2PCU A;  4Q36 A;  1NSA A;  2Q4Y A;  4NGP A;  3PFO A;  2JZF A;  1VHO A;  4CGL A;  2RNK A;  2ZW5 A;  4A94 A;  3IC1 A;  4C7I A;  4WWV A;  5IV0 A;  1VGY A;  5AIL A;  2GAN A;  2B4D A;  2ZOG A;  4KUA A;  4MFZ A;  3TO9 A;  3FB3 A;  3B3V A;  3Q71 A;  1YSJ A;  2ODF A;  2PJ8 A;  3B3W A;  3GPQ A;  3PGP A;  3S9M A;  4P4B A;  3H8G A;  4QC6 A;  4P4J A;  4CYQ A;  2J9A A;  1CPS A;  5HIH A;  1R3N A;  2ANP A;  3A9L A;  3FJU A;  3FXT A;  4JCA A;  2Z3M A;  4FD6 A;  4FWU A;  3F8K A;  5THW A;  3PFE A;  3QAY A;  2IMO A;  1YR0 A;  3RO0 A;  1XF8 A;  2F5I A;  2F8H A;  3D2M A;  1JWQ A;  2B5G B;  3G3S A;  4KOU A;  3CPX A;  3GPO A;  1AMP A;  2I00 A;  1NMT A;  2NSM A;  2V8D A;  3S9L A;  4B13 A;  2GLF A;  3N7Z A;  2P6E A;  3FED A;  3GYA A;  3EC4 A;  1Z8L A;  3TOB A;  4AVB A;  3S6K A;  4YU9 A;  3MN8 A;  3FRM A;  1LAP A;  4B14 A;  3JTK A;  4OAE A;  1B6B A;  2VZY A;  1GHE A;  3MRU A;  4UCN A;  1LOK A;  4ETJ A;  1U6M A;  4A31 A;  2CNM A;  2CTB A;  1DTD A;  4JGK A;  1R57 A;  1RXT A;  2B5G A;  2XEG A;  2AFZ A;  3R9G A;  3IFE A;  1TF9 A;  2V8V A;  5IB0 A;  2XEI A;  5FSZ A;  2BFQ A;  4MCR A;  1FY7 A;  3PBB A;  5E96 A;  1LAM A;  4I49 A;  1I21 A;  2PJ3 A;  2PJ0 A;  2NMT A;  2V8G A;  2EEE A;  5KTC A;  4NGR A;  5LYI A;  5LRJ A;  2D4O A;  2B3U A;  2ZEN A;  5CB5 A;  4ONW A;  2YNC C;  4LUA A;  2ZEE A;  5J8C A;  2PJ6 A;  2L8R A;  3QB8 A;  4C2Y A;  4O23 A;  4MFP A;  4MRI A;  4NEX A;  4KS9 A;  4FUU A;  1WWZ A;  2G9D A;  4UFV A;  3S6H A;  3IO1 A;  3FH4 A;  2Q7B A;  3K9T A;  4KUB A;  3ZJ0 A;  4CYP A;  4F9V A;  4XPD C;  3DGV A;  2PJA A;  3D66 A;  4GVW A;  4B12 A;  4KOW A;  4NXY A;  4GXH A;  1Q2Y A;  1XBU A;  5DWM A;  4UWJ A;  3R96 A;  4JWP A;  1M4D A;  4R3L A;  3CPA A;  2ARH A;  2PJC A;  1ZR3 A;  2B4D B;  3KR5 A;  2PR1 A;  4QBJ A;  1CP7 A;  4ORF A;  2C1C A;  5HVG A;  2G3A A;  2ABZ A;  2BL1 A;  1CG2 A;  3D68 A;  2OZU A;  1MJA A;  1ON0 A;  3SJG A;  2X47 A;  4XPL A;  3NFZ A;  3SJE A;  1ZLH A;  3DR8 A;  3GQE A;  5CMS A;  1F2O A;  2VBQ A;  4E8O A;  5A27 A;  5K8P A;  3C26 A;  2F7V A;  2JEV A;  5LYF A;  4NJR A;  3JZT A;  2OH1 A;  3LWU A;  1JQG A;  1R43 A;  1IY7 A;  5G21 A;  4KOT A;  6CPA A;  1FT7 A;  4QUS A;  4DNC A;  1EE3 P;  3BJ7 A;  1V0C A;  4PXD A;  2NYQ A;  4UBR A;  2BEI A;  3B7I A;  4CAV A;  4R3K A;  2Q4V A;  2Y0M A;  4PSW A;  4JLY A;  4B11 A;  4H6U A;  4CAW A;  3N5F A;  1YGH A;  3DNS A;  4H89 A;  4OC2 A;  1ZLI A;  4C2X A;  3NH5 A;  2V77 A;  3T90 A;  3CDX A;  1XIX A;  2CF4 A;  4R6T A;  1ZG8 A;  2ATR A;  4H6Z A;  3SJX A;  1OBR A;  4MFK A;  1HEE A;  4NGT A;  2Z3L A;  4X3R A;  1UFH A;  2WUU A;  3VAR A;  4QVT A;  4CYO A;  5BWA B;  2HUZ A;  4M6H A;  1PU9 A;  1X10 A;  1XE4 A;  3W91 A;  2OOT A;  4X5K A;  3IWW A;  1J4J A;  3BI0 A;  2CXA A;  4A2Z A;  4LX9 A;  3CXQ A;  2PIZ A;  1IGB A;  4HPS A;  5K8O A;  2G0B A;  2JDD A;  2HV2 A;  2PR8 A;  3FF3 A;  3PZJ A;  4EVY A;  2AFX A;  2ZEM A;  3VAT A;  4ESS A;  5DWN A;  4B5O A;  5JGF A;  1YQE A;  2Z11 A;  2DPT A;  4YRH A;  3GUX A;  1MJ9 A;  1A2Z A;  4MHD A;  3KAS A;  5DS0 A;  4HNX B;  4UEE A;  4JLL A;  3UY5 A;  1IB1 E;  1Z2L A;  3JVN A;  4OC3 A;  4EWT A;  1YVO A;  3SXN A;  4UIB A;  1S7F A;  1BLL E;  3EWR A;  4JXR A;  1FNO A;  2PJ5 A;  2PIY A;  3WAB A;  5EBV A;  4FD4 A;  3K2K A;  2C6P A;  2K5T A;  2WZN A;  4M6G A;  3SXO A;  1VHU A;  1I12 A;  3DDD A;  4MFQ A;  5HMN A;  4NGS A;  1Z9U A;  4ONU A;  5D8N A;  4R87 A;  4R9M A;  2Q4Z A;  3FVL A;  5CBM A;  2AE6 A;  3KL9 A;  3B3T A;  4B6Z A;  4BBH A;  3D7F A;  5ELY A;  3PBE A;  2VQY A;  1M44 A;  2ZW4 A;  3P2H A;  3PB9 X;  5FSV A;  4PV6 A;  3V8I A;  2PJ4 A;  1YLE A;  1LAN A;  2Z3K A;  5FVJ A;  2P6G A;  4MMO A;  3WR7 A;  2XEF A;  2AFO A;  3PP9 A;  2HB6 A;  1DE4 C;  2KCW A;  1Z8W A;  4RUH A;  4GVV A;  4RI1 A;  2OR4 A;  3BXM A;  4HKF A;  4LQG A;  4W9Y A;  4ZBG A;  3IID A;  3KKW A;  2FAV A;  1XFO A;  4OIW A;  5J8F A;  4OP4 A;  1LRZ A;  2XEJ A;  1BPM A;  3PB7 X;  4KSI A;  2DF5 A;  4WJB A;  3KR4 A;  2QYV A;  3WC7 A;  1VKC A;  4FD7 A;  2J8R A;  4OLL A;  3CT9 A;  4MXU A;  3TCV A;  4JYW A;  2VI7 A;  2C27 A;  4GUA A;  2G3T A;  3DLJ A;  4F0X A;  5F46 A;  3NA6 A;  2PJ1 A;  2ZXV A;  2R98 A;  4PK3 A;  2BOA A;  4J5S A;  1CPX A;  4R76 A;  2VL1 A;  3QAH A;  2FVG A;  5LRK A;  1P0H A;  2WPX A;  2BO9 A;  3I3G A;  5J1Q A;  3VWE A;  2XD7 A;  1SPV A;  4RN7 A;  5A28 A;  3KQX A;  1YME A;  2PRQ A;  1ZO0 A;  2JDC A;  3G8W A;  1ZG7 A;  3R9F A;  1I1D A;  1PUA A;  3IEH A;  3TO7 A;  4PXC A;  1Z8T A;  3VWD A;  2REE A;  4B10 A;  1TKF A;  5HXD A;  4KOV A;  2CY2 A;  2GIV A;  4DUK A;  2GFQ A;  2FS5 A;  4CGP A;  2ZEO A;  1S7K A;  4MFJ A;  5AG7 A;  2AFU A;  1QSN A;  3GLJ A;  3W6S A;  2EWB A;  5ISV A;  3IU2 A;  4CAF A;  1YK3 A;  5AG6 A;  3BI1 A;  3S6F A;  4K3N A;  5FSX A;  2ACF A;  3GB0 A;  4IAV A;  4XNH C;  4FAI A;  4CAX A;  3EO4 A;  1N71 A;  3V38 A;  2VRI A;  2Q51 A;  4KVO E;  1AUG A;  3I1U A;  2I79 A;  4ZY1 A;  3V45 A;  3TX8 A;  1IID A;  2RC4 A;  1VHS A;  4XPK A;  3PRT A;  3GQO A;  2PQ8 A;  1NJR A;  1CP6 A;  2C6G A;  4F8Z A;  4UCP A;  4P44 A;  3TO6 A;  5HH1 A;  1BO4 A;  2VEZ A;  4ZX9 A;  2BCO A;  4R57 A;  5KTA A;  2POK A;  2P0W A;  4KOS A;  4Y49 C;  4KSF A;  3SHP A;  2WYR A;  4XNH B;  4UFX A;  3JRU A;  3LMS A;  4MY3 A;  1Y0Y A;  2O28 A;  3NE7 A;  4KOR A;  3E0K A;  3PB6 X;  3TTH A;  3RAM A;  4AG9 A;  5IX3 A;  3LD2 A;  4YGO A;  4AB7 A;  1XEB A;  3D8P A;  2ZEP A;  2ZOF A;  3EFA A;  1S7N A;  4TWE A;  1YX0 A;  1Q2D A;  4HNW B;  4ZX8 A;  1OZP A;  4P4F A;  2QVP A;  4K0C A;  5FSY A;  3H8F A;  4UML A;  1CJW A;  1QSM A;  3DSB A;  2Z0Z A;  2Q43 A;  3IWE A;  2WPW A;  5H86 A;  4X8I A;  3BJ8 A;  3B3S A;  4AVC A;  4D86 A;  4J5Q A;  4B5P B;  2JZD A;  2LGR A;  2CNS A;  3SII A;  1XOV A;  2EO8 A;  3IGR A;  4J4Z A;  2YNC A;  1RTQ A;  4UF4 A;  4IUS A;  5FSU A; 
#chains in the Genus database with same CATH homology
 4ZY0 A;  3D7G A;  4GM5 A;  3B3C A;  1BAV A;  3EWQ A;  3ETI A;  4DYO A;  1ZG9 A;  2ZEL A;  2HC9 A;  5JH9 A;  3Q6Z A;  2O53 A;  2FG1 A;  1TKJ A;  3SI1 A;  4YWY A;  3FMC A;  3PB4 X;  4ZI6 A;  1KWM A;  4OC1 A;  4TNU A;  3WC5 A;  2GLJ A;  4Z65 A;  4P10 A;  4OID A;  5DUS A;  2ZEF A;  5LYD A;  4EFD A;  3ISZ A;  5HOL A;  1HDU A;  5F09 A;  3GPG A;  3KHZ A;  3RBU A;  5LYL A;  4P45 A;  3B2Y A;  2IJZ A;  4AXV A;  2ZEH A;  1H8L A;  3D67 A;  2O4H A;  3KQZ A;  1F2P A;  4PQA A;  3FEC A;  2V8H A;  3BHX A;  5K8M A;  3L2N A;  4UIA A;  2GRE A;  2GU2 A;  1QMU A;  4KYB A;  3EKE A;  4MCP A;  2AFW A;  3D4U A;  4TU0 A;  2JEW A;  4MHN A;  1HJZ A;  3SI0 A;  1ELL P;  1TXR A;  4NGQ A;  1CBX A;  3V7Z A;  4IHM A;  1AYE A;  3D7H A;  3IJ3 A;  3NH8 A;  4CPA A;  2PJ9 A;  2ZED A;  7CPA A;  2ZEG A;  1XJO A;  2CTC A;  2RB7 A;  3IIF A;  3VFQ A;  2PVW A;  1LCP A;  1YLO A;  4ABK A;  4NGN A;  2CIJ A;  2PE3 A;  2PVV A;  3TC8 A;  1BPN A;  3WT4 A;  4P4D A;  4MHY A;  4P4E A;  4MCS A;  1ZR5 A;  1Z5R A;  4X2T A;  5E3B A;  2EK9 A;  2I3C A;  3EWO A;  2DEA A;  2AFM A;  2JBK A;  1Y7E A;  2QJ8 A;  4UEZ A;  4R7M A;  4UEF A;  1HDQ A;  2PJ7 A;  3EW5 A;  1VIX A;  3HLP A;  1ELM P;  5K8N A;  4Q7A A;  2DX6 A;  3KGQ A;  4MCQ A;  3WC6 A;  4P4I A;  1LFW A;  4PXB A;  4PXE A;  5IB9 A;  4A37 A;  2PJ2 A;  1CX8 A;  4FBE A;  3B35 A;  3SIH A;  4F9U A;  5D29 A;  1M4L A;  4NJQ A;  1VHE A;  1XRY A;  3RZA A;  4J5R A;  3S9N A;  1YW4 A;  4MHZ A;  1TY8 A;  3T8W A;  1PYT B;  3EWP A;  2FXK A;  4JZ0 A;  1XMB A;  4EME A;  3KI9 A;  5CB3 A;  3SJF A;  4A39 A;  2EK8 A;  3KHX A;  3SIG A;  1GYT A;  4IK2 A;  4ZYQ A;  1UWY A;  4OC4 A;  4OC5 A;  3IIB A;  5HVH A;  2PJB A;  4MHP A;  1TF8 A;  3H8E A;  3EJF A;  1Y0R A;  3FEE A;  2C6C A;  2BFR A;  4R8F A;  3SI2 A;  4OME A;  3KZW A;  1Q7L A;  1F57 A;  1ARL A;  4H2K A;  2JBJ A;  3VH9 A;  4IQY A;  1QQ9 A;  4A38 A;  3ISX A;  3V2B A;  4P6Y A;  3FX6 A;  4NGM A;  5I4M A;  4JVV A;  1PCA A;  4G1P A;  4OKO A;  4OC0 A;  3NH4 A;  4BD9 A;  4PPZ A;  2IQ6 A;  5CPA A;  3D7D A;  3SIJ A;  1YD9 A;  3PB8 X;  5HVF A;  5LRG A;  4ABL A;  3EJG A;  2AFS A;  2RFH A;  3HUV A;  1ARM A;  1YW6 A;  3PEI A;  4ZY2 A;  5JM6 A;  4NFR A;  2AFC A;  1TKH A;  8CPA A;  4DJL A;  1TXZ A;  4ETK A;  3QNV A;  2PCU A;  1NSA A;  4NGP A;  3PFO A;  1VHO A;  4A94 A;  3IC1 A;  4WWV A;  1VGY A;  5AIL A;  2ZOG A;  3B3V A;  3Q71 A;  1YSJ A;  2PJ8 A;  3B3W A;  3GPQ A;  3S9M A;  4P4B A;  3H8G A;  4P4J A;  2J9A A;  1CPS A;  5HIH A;  1R3N A;  2ANP A;  3FJU A;  4JCA A;  4FWU A;  5THW A;  3PFE A;  2IMO A;  2F8H A;  3S9L A;  3CPX A;  3GPO A;  2NSM A;  1AMP A;  2V8D A;  2GLF A;  3FED A;  1Z8L A;  4YU9 A;  3MN8 A;  1LAP A;  3MRU A;  1LOK A;  4ETJ A;  2CTB A;  1DTD A;  4JGK A;  2XEG A;  2AFZ A;  3IFE A;  1TF9 A;  2V8V A;  2XEI A;  5FSZ A;  2BFQ A;  4MCR A;  3PBB A;  1LAM A;  2PJ3 A;  2PJ0 A;  2V8G A;  2EEE A;  4NGR A;  5LYI A;  5LRJ A;  2ZEN A;  5CB5 A;  4ONW A;  2ZEE A;  2PJ6 A;  2L8R A;  4O23 A;  4MRI A;  4FUU A;  2G9D A;  3IO1 A;  3FH4 A;  3K9T A;  4F9V A;  3DGV A;  2PJA A;  3D66 A;  4GVW A;  1XBU A;  3CPA A;  2PJC A;  1ZR3 A;  3KR5 A;  1CP7 A;  2C1C A;  5HVG A;  2ABZ A;  1CG2 A;  3D68 A;  3SJG A;  2X47 A;  3NFZ A;  3SJE A;  1ZLH A;  3GQE A;  5CMS A;  1F2O A;  5K8P A;  2F7V A;  5LYF A;  4NJR A;  3JZT A;  3LWU A;  1JQG A;  1R43 A;  1IY7 A;  6CPA A;  1FT7 A;  1EE3 P;  4PXD A;  2NYQ A;  3B7I A;  3N5F A;  4OC2 A;  1ZLI A;  3NH5 A;  2V77 A;  3CDX A;  2CF4 A;  4R6T A;  1ZG8 A;  3SJX A;  1OBR A;  1HEE A;  4NGT A;  4X3R A;  3VAR A;  2OOT A;  3IWW A;  3BI0 A;  2PIZ A;  1IGB A;  5K8O A;  3FF3 A;  2AFX A;  2ZEM A;  3VAT A;  4ESS A;  5JGF A;  3GUX A;  5DS0 A;  3KAS A;  4UEE A;  4JLL A;  4OC3 A;  1Z2L A;  4EWT A;  4UIB A;  1BLL E;  3EWR A;  1FNO A;  2PJ5 A;  2PIY A;  3WAB A;  3K2K A;  2C6P A;  2WZN A;  1VHU A;  4NGS A;  5D8N A;  2Q4Z A;  3FVL A;  5CBM A;  3KL9 A;  3B3T A;  4B6Z A;  3D7F A;  5ELY A;  3PBE A;  3PB9 X;  5FSV A;  2PJ4 A;  1LAN A;  4MMO A;  2XEF A;  2AFO A;  2HB6 A;  1DE4 C;  4RUH A;  4GVV A;  2OR4 A;  3BXM A;  4LQG A;  4W9Y A;  3IID A;  2FAV A;  1XFO A;  4OIW A;  4OP4 A;  2XEJ A;  1BPM A;  3PB7 X;  4KSI A;  4WJB A;  3KR4 A;  2QYV A;  3WC7 A;  3CT9 A;  4MXU A;  4JYW A;  4GUA A;  3DLJ A;  3NA6 A;  2PJ1 A;  4J5S A;  1CPX A;  2BOA A;  4R76 A;  2VL1 A;  5LRK A;  2FVG A;  2BO9 A;  5J1Q A;  2XD7 A;  1SPV A;  3KQX A;  1YME A;  2PRQ A;  1ZG7 A;  3IEH A;  4PXC A;  1TKF A;  5HXD A;  4DUK A;  2ZEO A;  2AFU A;  3GLJ A;  2EWB A;  3BI1 A;  4K3N A;  5FSX A;  2ACF A;  3GB0 A;  4IAV A;  4FAI A;  3V38 A;  2VRI A;  2Q51 A;  3I1U A;  4ZY1 A;  3V45 A;  3TX8 A;  3PRT A;  3GQO A;  1NJR A;  1CP6 A;  2C6G A;  4F8Z A;  4P44 A;  4ZX9 A;  2BCO A;  2POK A;  2WYR A;  3JRU A;  3LMS A;  1Y0Y A;  3PB6 X;  3RAM A;  2ZEP A;  2ZOF A;  4TWE A;  4ZX8 A;  4P4F A;  2QVP A;  4K0C A;  5FSY A;  4UML A;  3H8F A;  2Q43 A;  4X8I A;  3B3S A;  4D86 A;  4J5Q A;  2LGR A;  3SII A;  4J4Z A;  1RTQ A;  4UF4 A;  5FSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...