1LCPA

Bovine lens leucine aminopeptidase complexed with l-leucine phosphonic acid
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
484
structure length
484
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE AMINOPEPTIDASE
publication title Transition state analogue L-leucinephosphonic acid bound to bovine lens leucine aminopeptidase: X-ray structure at 1.65 A resolution in a new crystal form.
pubmed doi rcsb
molecule tags Hydrolase (alpha-aminoacylpeptide)
total genus 169
structure length 484
sequence length 484
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lcpA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lcpA02
3RAMA 4MHYA 1LAMA 3IO1A 4ESSA 1R3NA 3NH4A 2IMOA 4JYWA 3GLJA 2XD7A 4TU0A 2CTCA 2V8DA 3D67A 4R6TA 1TKFA 4GM5A 5F09A 3DGVA 1ZG9A 2JBJA 2DEAA 4KYBA 5D8NA 2Q51A 1ZR3A 2ZEDA 3SJXA 4P4FA 2POKA 1LCPA 2EWBA 5JGFA 2PJ8A 3D66A 1AMPA 2PJ7A 4KSIA 3ETIA 3SIGA 1Z5RA 1ARLA 4G1PA 4NJQA 3GQEA 4DYOA 4P4JA 2XEFA 2RFHA 4OIDA 1ZLIA 3PBBA 4R7MA 3PB9X 4MRIA 5HXDA 1YW6A 4AXVA 1SPVA 1HDUA 5E3BA 3T8WA 4NGTA 4UF4A 5DUSA 2GLFA 3PEIA 4OC4A 3S9MA 1LOKA 4PXBA 3V38A 1RTQA 2FXKA 4OKOA 5LYIA 5FSVA 3CT9A 3EKEA 3KQXA 4ZY1A 1LANA 5HVFA 3FH4A 5THWA 3B3VA 4IK2A 3SI2A 2FVGA 1JQGA 2VL1A 8CPAA 3D7GA 3BI1A 2NYQA 1IGBA 1IY7A 3WC6A 2ZEOA 4OC1A 2CTBA 5J1QA 3K2KA 5HVGA 1XMBA 4H2KA 3RZAA 2OOTA 1EE3P 4P45A 1YLOA 3QNVA 5LRKA 4FWUA 3PRTA 5FSUA 2EK9A 3SI1A 2PVWA 2AFMA 4OMEA 3KZWA 4UMLA 4A37A 2GREA 2I3CA 3IIFA 3ISZA 3MRUA 4JZ0A 3GPOA 3PB6X 3EW5A 1TXZA 1YSJA 3B3SA 1YMEA 2O4HA 4DUKA 5I4MA 4W9YA 1ZR5A 5DS0A 1VHUA 3RBUA 2WZNA 4ZX8A 3GB0A 1HEEA 4WJBA 1BAVA 5K8MA 2Q4ZA 1CP6A 5K8OA 4NGRA 5CPAA 1TKHA 1Y0RA 4UIBA 5HVHA 1Z8LA 3V45A 2IQ6A 2XEIA 3S9NA 3I1UA 4NGPA 1XJOA 1Z2LA 1CX8A 4OP4A 2PIYA 4TWEA 1LAPA 4NJRA 3BXMA 4JCAA 1BLLE 3K9TA 5LRJA 1CG2A 1QQ9A 3PB4X 1ZG7A 4LQGA 5CB5A 2VRIA 5FSXA 2F8HA 1Y0YA 4O23A 2C6PA 2ACFA 2C6GA 3NFZA 4MHZA 4PPZA 1TXRA 4PXCA 3IC1A 3PB7X 4RUHA 2V77A 4F9VA 3ISXA 1R43A 1TF9A 2V8GA 3SJFA 3FJUA 2BO9A 1M4LA 2C6CA 4IAVA 3BI0A 2PCUA 3NH8A 4P4DA 2CIJA 3B3CA 3FX6A 4D86A 1ELMP 1DTDA 3EWQA 2ZELA 3KHXA 4OC5A 4PQAA 3L2NA 4OC2A 4NFRA 4IQYA 3PFOA 1CP7A 4P4BA 4UEZA 5JH9A 1CPSA 4MXUA 1HDQA 1UWYA 5CB3A 4PXDA 3SI0A 3FEEA 4X3RA 3EWRA 3IIDA 2PE3A 4MHPA 3BHXA 4P44A 1LFWA 3KR5A 4GUAA 2ZOGA 4EFDA 3EJFA 1F57A 3H8EA 1ZLHA 2O53A 2AFUA 2AFXA 3WC7A 3D7FA 3KASA 1F2OA 1BPMA 2AFOA 4NGQA 2ZEGA 3JZTA 1NJRA 2CF4A 2AFSA 3SIJA 2ZEPA 4R8FA 2QVPA 3B2YA 3IWWA 4CPAA 2OR4A 5FSZA 1QMUA 1TKJA 3FEDA 1GYTA 4ONWA 3VARA 3KGQA 2GLJA 4FUUA 4ZY2A 3KL9A 2LGRA 3D7HA 3VFQA 1VIXA 3NA6A 4FBEA 3H8FA 4YWYA 3SJGA 2JBKA 5CMSA 3CDXA 3KI9A 4OIWA 5K8NA 2IJZA 4IHMA 4MMOA 3FVLA 2ZEHA 3WC5A 3PB8X 2HC9A 3FF3A 3MN8A 3SIHA 2AFZA 3B3WA 1TF8A 3VH9A 5LYFA 4A94A 4OC0A 1Y7EA 5D29A 3GPQA 1CBXA 3B3TA 4YU9A 4JLLA 5HIHA 3WABA 4MCSA 4GVVA 4J4ZA 3KQZA 2PJCA 2ABZA 4P4EA 7CPAA 1VHOA 2QJ8A 4OC3A 4ETKA 3CPXA 4J5RA 4JVVA 2ZEEA 4NGNA 3SIIA 3GPGA 2EEEA 2AFWA 1VGYA 2V8HA 3DLJA 2WYRA 4A38A 3IIBA 2BFRA 1XBUA 3LMSA 6CPAA 4F8ZA 5ELYA 2ZOFA 5HOLA 1ARMA 5JM6A 2BFQA 3VATA 1FT7A 2ANPA 2F7VA 1TY8A 3Q6ZA 2XEGA 1Q7LA 5LYLA 5IB9A 1PCAA 4P6YA 4DJLA 4PXEA 1FNOA 2EK8A 3B7IA 3PBEA 4A39A 1CPXA 2X47A 3V2BA 1VHEA 3HLPA 3B35A 4MCRA 3S9LA 2FAVA 1XFOA 4WWVA 2G9DA 3D68A 4ETJA 1H8LA 2PJAA 4JGKA 5LRGA 4X2TA 5K8PA 1PYTB 4R76A 1ELLP 2PJ6A 4UEEA 4GVWA 3N5FA 4X8IA 2L8RA 3H8GA 3D7DA 3EWPA 2PJ5A 2PJ3A 1F2PA 2GU2A 1OBRA 4BD9A 3GUXA 3Q71A 1HJZA 4FAIA 2PVVA 4NGMA 2PJBA 4MHNA 4ABLA 2V8VA 3IFEA 3V7ZA 2PJ1A 4TNUA 2DX6A 3LWUA 4J5SA 2PIZA 3HUVA 4Q7AA 4F9UA 1KWMA 3PFEA 4Z65A 3KHZA 2FG1A 3TX8A 3EWOA 1NSAA 5AILA 4MCQA 3JRUA 1DE4C 2QYVA 4J5QA 5FSYA 2BOAA 1YW4A 2ZEMA 3EJGA 4ZYQA 3GQOA 2PJ9A 2J9AA 2BCOA 3IJ3A 4EMEA 4P10A 2NSMA 1ZG8A 4UIAA 3SJEA 2ZEFA 3FMCA 4B6ZA 3NH5A 2JEWA 2PJ4A 3FECA 3IEHA 2XEJA 2PRQA 5CBMA 4ZX9A 4P4IA 1YD9A 3CPAA 4ABKA 4ZI6A 4ZY0A 4UEFA 1XRYA 4EWTA 4MCPA 1AYEA 4K0CA 3WT4A 2C1CA 3D4UA 3KR4A 4K3NA 2PJ2A 3TC8A 2RB7A 4NGSA 1BPNA 2AFCA 2PJ0A 2Q43A 2ZENA 5LYDA 2HB6A
chains in the Genus database with same CATH superfamily
3FNCA 3RAMA 4KVME 4MHYA 1I12A 4HNXB 1LAMA 3IO1A 4CGMA 2CY2A 4ESSA 1R3NA 1XMTA 1YK3A 2IMOA 2F5IA 3GLJA 3NH4A 2XD7A 4TU0A 3QB8A 2CTCA 2V8DA 3D67A 4R6TA 2Q4VA 1TKFA 4GM5A 5F09A 3DGVA 1ZG9A 1S3ZA 1QSNA 1MJ9A 2J8NA 2JBJA 3P2HA 4C7IA 2EVNA 2DEAA 4KYBA 4JWPA 5D8NA 2Q51A 3IWEA 2ODFA 2ZW5A 4CAWA 2C27A 4HNYB 1ZR3A 2RNKA 4JLYA 1PU9A 1L0CA 2ZEDA 2FIWA 3S6FA 3SJXA 5KTDA 2JDDA 2VQYA 4P4FA 2POKA 1S7LA 1LCPA 2WPWA 2Z3KA 4A2ZA 2EWBA 2VZYA 2O28A 3A9LA 3D3SA 3TO9A 2WUUA 5DWNA 2PJ8A 3D66A 4CYOA 5JGFA 1AMPA 2PJ7A 3GYAA 4FD6A 4KSIA 2D4PA 4UCPA 4PV6A 1IOIA 1ZO0A 2ZPAA 3ETIA 3SIGA 2REFA 1Z5RA 4MBUA 1ARLA 2PSWA 4G1PA 4PK3A 4NJQA 4QUSA 3UY5A 4K30A 3GQEA 1Y9KA 1YVOA 4DYOA 1QSRA 4P4JA 1ON0A 2XEFA 2RFHA 3BJ7A 3W6SA 5I0CA 3S6HA 4B13A 4OIDA 1ZLIA 3PBBA 4U9ZA 2HQYA 5EBVA 5ISVA 4R7MA 1CJWA 1KUXA 3PB9X 4MRIA 4A30A 5HXDA 1YW6A 4AXVA 1SPVA 1HDUA 4CRZB 5E3BA 3T8WA 4NGTA 4QBJA 2YGWA 2R1IA 1YGHA 2ZXVA 2OZUA 2W2GA 5DUSA 4H6ZA 4UF4A 4AVBA 4E0AA 2GLFA 3FIXA 3PEIA 4QC6A 4QB9A 4Y49B 4ZGYB 2B4BA 4OC4A 3S9MA 1LOKA 2B5GA 2K5TA 4PXBA 3V38A 1RTQA 2FXKA 4OKOA 3R9GA 2QIRA 5LYIA 5FSVA 3CT9A 3EKEA 3KQXA 1P4NA 4ZY1A 2B5GB 4KOUA 2Q7BA 1LANA 2KQVA 3PGPA 3FH4A 4Y49C 2FS5A 5HVFA 5THWA 3B3VA 3LACA 4IK2A 3SI2A 2DPTA 4KORA 4AG7A 5HH1A 2FVGA 1JQGA 1NE9A 2VL1A 4MFLA 8CPAA 3NE7A 4MJ8A 3IU1A 3D7GA 3PZJA 3BI1A 2NYQA 3JUWA 1IGBA 2P6GA 2PR8A 4ONUA 4XPDB 3FYNA 1IY7A 3EC4A 5G20A 3WC6A 2ZEOA 4OC1A 5GCNA 4KSFA 2CTBA 4C2ZA 5J1QA 1UFHA 3K2KA 4KS9A 4KOSA 5HVGA 4MFPA 4B5OA 2GIVA 1XMBA 4H2KA 3RZAA 3B8GA 1V0CA 2OOTA 1EE3P 1IB1E 4CYNA 4M85A 4P45A 2FSRA 1YLOA 1KZFA 3D2MA 3QNVA 4OLLA 5LRKA 4FWUA 3PRTA 4KOTA 5FSUA 2EK9A 1S7FA 1BO4A 3BJ8A 3SI1A 2PVWA 2AFMA 4OMEA 4AB7A 4XPLA 3KZWA 4UMLA 1IYKA 4A37A 2GREA 2Q4YA 1LRZA 3H5ZA 4BINA 4MFKA 2WCTA 3IIFA 2I3CA 1MJBA 5EMIA 4B10A 3ISZA 2BEIA 3MRUA 4JZ0A 3GPOA 3PB6X 3IGRA 4CYQA 5CNPA 4E8OA 2CNMA 1YLEA 3KKWA 4CAFA 2NMTA 4MHDA 3EW5A 1B6BA 1TXZA 2I79A 1YSJA 2FL4A 3LODA 1MJAA 3IWGA 3B3SA 2B3UA 5E96A 1YMEA 2O4HA 4DUKA 1Z4RA 4W9YA 5I4MA 4HKFA 5C88A 1ZR5A 5DS0A 1VHUA 2Z3OA 3VWEA 3RBUA 2WZNA 4ZX8A 2G0BA 4ZBGA 3GB0A 1HEEA 5IV0A 1QSTA 4WJBA 1BAVA 5K8MA 3DDDA 2R7HA 2Q4ZA 4H6UA 1CP6A 1I21A 5K8OA 4A33A 2Z3MA 4NGRA 2Q7SA 4NXYA 1TKHA 2JZEA 5CPAA 1Y0RA 3R96A 4JD6A 1YREA 3CXSA 4UIBA 4F6AA 5A28A 5HVHA 2YNDA 1Z8LA 3V45A 2IQ6A 2XEIA 2PR1A 2H5MA 3S9NA 3I1UA 4NGPA 1XJOA 5JQ4A 4NEXA 1Z2LA 1CX8A 3VWDA 4OP4A 3R9EA 1K4JA 1B87A 2WPXA 1S60A 2VXKA 2PIYA 4KZTA 4TWEA 2FIAA 1LAPA 4NJRA 3BXMA 3LD2A 4JCAA 3FXTA 1BLLE 2YNCC 2KCWA 3FRMA 1RO5A 2QECA 3K9TA 1CG2A 2HV2A 1QQ9A 2VBQA 3PB4X 5LRJA 4AG9A 2OZGA 3EY5A 4Q36A 1ZG7A 5G1ZA 4MI4A 2Z3PA 4LQGA 5CB5A 2VRIA 2JDCA 5FSXA 2GFQA 2F8HA 1Y0YA 4O23A 2C6PA 2ACFA 1WK4A 2C6GA 3NFZA 5F47A 4MHZA 4PPZA 1TXRA 4PXCA 3IC1A 3PB7X 4CYPA 1XEBA 2V77A 1YVKA 2AJ6A 3C26A 4UWIA 4F9VA 4RUHA 3TE4A 2P6EA 3T9YA 1XOVA 1S7KA 4MY3A 4IUSA 5AG6A 3F8KA 1SQHA 1Z4EA 3ISXA 1R43A 1TF9A 2B3VA 2V8GA 2ZW4A 2J8MA 4UCNA 1U6MA 3SJFA 4I49A 3FJUA 2BO9A 4KOYA 1M4LA 2C6CA 4IAVA 1S7NA 2QMLA 3BI0A 4C2XA 3TCVA 2PCUA 2A4NA 2DF5A 4U5YA 4YGOA 3NH8A 4P4DA 2CIJA 3B3CA 3FX6A 3IU2A 4FD5A 5BWAB 3TOAA 3RYOA 3MGDA 4D86A 5H86A 1ELMP 1I1DA 5AGEA 2PRBA 1DTDA 1OZPA 4CAEA 4UFWA 3EWQA 2ZELA 3KHXA 4X5KA 4OC5A 4PQAA 2FXFA 3L2NA 5F46A 4OC2A 2ZW7A 4NFRA 3R95A 3T90A 4IQYA 3N7ZA 3PFOA 4C68A 1CP7A 4P4BA 4UEZA 4L8AA 1CPSA 2GANA 4NSQA 5JH9A 5AG7A 4MXUA 3S6GA 1HDQA 1UWYA 5CB3A 4PXDA 3SI0A 3V8IA 1BOBA 1N71A 4RN7A 3FEEA 4A31A 4YRHA 4LQ6A 4X3RA 4JYWA 1GHEA 3EWRA 3IIDA 1Z8WA 4KUAA 4AVCA 2Z0ZA 2PE3A 2Y0MA 4NF1A 4MHPA 3TOBA 3BHXA 4P44A 1LFWA 2EBJA 3KR5A 4GUAA 2ZOGA 4EFDA 1FY7A 3EJFA 1F57A 3H8EA 1ZLHA 2R8VA 2O53A 2AFUA 2AFXA 3WC7A 1Y9WA 2Q44A 1F2OA 3D7FA 1BPMA 3KASA 2AFOA 4KOWA 4UA3A 4NGQA 4B11A 2CXAA 1AUGA 3EFAA 2ZEGA 4KOVA 3JZTA 4U9YA 1NJRA 1Z8XA 2CF4A 1WWZA 2AFSA 2G3AA 2HUZA 3SIJA 3I9SA 2ZEPA 4UFXA 2B4DB 3TT2A 3W91A 5F48A 4R8FA 2QVPA 3B2YA 3IWWA 5FVJA 1S5KA 4UCMA 1YR0A 4CPAA 2OR4A 5FSZA 2EUIA 1QMUA 1TKJA 2ATRA 1GYTA 3FEDA 2EO8A 2Z3LA 4ONWA 4KVOE 3VARA 2OH1A 3GY9A 3KGQA 4LX9A 2GLJA 4FUUA 2JZFA 4E2AA 1VHSA 4HPSA 4MFQA 4ZY2A 1NMTA 3KL9A 2LGRA 3CZXA 3D7HA 3VFQA 3TO6A 1VIXA 3SXNA 2FE7A 3NA6A 4C7HA 4FBEA 1Q2DA 4NCZA 4JXRA 5C82A 3H8FA 1R57A 2PC1A 4YWYA 4QVTA 3SJGA 2JBKA 5CMSA 2FT0A 3TTHA 3CDXA 4UBRA 1J4JA 4CS0B 4CAVA 3KI9A 1CM0A 4OIWA 5K8NA 2IJZA 4OAEA 3CXPA 4CGOA 4IHMA 4MMOA 3FVLA 2ZEHA 3WC5A 3PB8X 4GXHA 4PSWA 2I00A 2HC9A 4FD7A 5KTCA 4C2YA 1Q2YA 3OWCA 3FF3A 2YNCA 3MN8A 4GS4A 5G22A 3SIHA 2AFZA 3B3WA 1TF8A 2P0WA 3F0AA 3VH9A 5LYFA 4M6HA 4OC0A 2PQ8A 1Y7EA 5D29A 3GPQA 1CBXA 4A94A 4B5PB 3B3TA 4YU9A 4JLLA 5HIHA 1Z9UA 3WABA 5A27A 1M4GA 4B12A 5IX3A 3K9UA 4MCSA 4CGPA 4M3SA 2OB0A 2JEVA 4GVVA 3TFYA 1QSOA 4J4ZA 3TO7A 1XF8A 3ZZIA 4CAXA 2ARHA 5HMNA 1X12A 3KQZA 1PUAA 2PJCA 1M4IA 2DPSA 2ABZA 2J8RA 3I3GA 3DNSA 4P4EA 7CPAA 1VHOA 2QJ8A 4OC3A 4ETKA 3EXNA 3CPXA 1KUVA 2P6FA 3DR6A 4MFZA 1KUYA 4J5RA 2Q0YA 2VI7A 4JVVA 2CNSA 2ZEEA 4NGNA 3ZJ0A 4R87A 3G8WA 4UFVA 1Y7RA 1JWQA 2FCKA 4Q38A 2Q04A 3SIIA 3GPGA 2EEEA 2AFWA 4KVXA 1VGYA 4LUAA 3F5BA 1P0HA 1Q2CA 2BUEA 2V8HA 2WYRA 3DLJA 4A38A 3IIBA 2BFRA 1XBUA 3LMSA 2OZHA 6CPAA 4PK2A 3GIUA 4F8ZA 5H84A 1XE4A 2VZZA 2OU2A 5ELYA 2ZOFA 5HOLA 1ARMA 5AG5A 5JM6A 1M1DA 4ORFA 2BFQA 2BSWA 3VATA 2WSAA 1FT7A 2ANPA 2F7VA 4XPKA 3RO0A 1TY8A 3Q6ZA 2XEGA 4MY0A 1MK4A 1Q7LA 4CRYB 2G3TA 5IB9A 4UWJA 1PCAA 5LYLA 4P6YA 4DJLA 4PXEA 1FNOA 2EK8A 2YNEA 4R9MA 3B7IA 3PBEA 4M6IA 2D4OA 2JLMA 1NSLA 4A39A 2Z10A 1CPXA 2X47A 3V2BA 1IIDA 1VHEA 3B35A 3HLPA 4MCRA 5EC4A 3S9LA 5J8CA 2FAVA 1XFOA 4WWVA 2G9DA 2Z11A 3D68A 4ETJA 3RNZA 1M44A 1H8LA 2PJAA 4JGKA 3D8PA 3DR8A 4RS2A 5LRGA 3W6XA 4X2TA 4CGLA 5K8PA 1PYTB 3DSBA 5G21A 4R76A 4JXQA 4B14A 1ELLP 4KLVA 2DXQA 2PJ6A 3GKRA 4UEEA 4GVWA 5IB0A 3N5FA 4X8IA 4II9A 2CNTA 2L8RA 3H8GA 3EO4A 3D7DA 3EWPA 3BLNA 2PJ5A 4XNHB 2PJ3A 4AVAA 2BL1A 4BBHA 1F2PA 2ZW6A 2GU2A 1OBRA 4BD9A 3GUXA 4M6GA 3Q71A 5KTAA 2B4DA 4YFJA 1HJZA 2IL4A 3QAHA 4FAIA 2PVVA 1RXTA 4NGMA 2VEZA 2PJBA 4MHNA 4XNHC 4DNCA 4ABLA 2V8VA 4F0XA 3IFEA 2Z3NA 3V7ZA 2PJ1A 4TNUA 4BMHA 2DX6A 3P2FA 3LWUA 1IYLA 4RI1A 4B5PA 4J5SA 4JJXA 2PIZA 3HUVA 4Q7AA 4F9UA 1KWMA 3PFEA 1IOFA 3WR7A 1XIXA 2REEA 4Z65A 3PP9A 3KHZA 2FG1A 3TX8A 4OADA 2R98A 2RC4A 4KOXA 3EWOA 1NSAA 5AILA 4KSAA 3JRUA 4MCQA 4XPDC 1A2ZA 1DE4C 4H89A 2PDOA 3JVNA 2QYVA 1QSMA 3QAYA 2X7BA 4J5QA 3SHPA 5F49A 5FSYA 2BOAA 1YW4A 2ZEMA 3EJGA 4KUBA 2GE3A 3FB3A 4ZYQA 3R9FA 3GQOA 2B58A 3H4QA 5JPHA 2PJ9A 2J9AA 2BCOA 4F0YA 3IJ3A 3CXQA 4EMEA 4P10A 2NSMA 1ZG8A 3JTKA 4PSXA 4UIAA 3SJEA 2ZEFA 3FMCA 4R3LA 5DWMA 4B6ZA 3NH5A 2JEWA 2PJ4A 4HNWB 4R57A 3FECA 3NE8A 4R3KA 3IEHA 2XEJA 2PRQA 3R1KA 2JZDA 3FBUA 5CBMA 4ZX9A 1YQEA 4P4IA 4A32A 3S6KA 1YD9A 4EVYA 1YX0A 1M4DA 3CPAA 4ABKA 4ZI6A 4ZY0A 4FD4A 1XRYA 4MFJA 4UEFA 2AE6A 4A95A 4EWTA 1Z8TA 4J3GA 1AYEA 4K0CA 4MCPA 3WT4A 1IICA 2C1CA 3D4UA 1TIQA 4CGNA 1IU8A 3KR4A 5AG4A 4IF5A 3E0KA 4K3NA 2PJ2A 5J8FA 4L89A 1X10A 3TC8A 2RB7A 4NGSA 1BPNA 2AFCA 2PJ0A 2Q43A 2ZENA 4KLWA 5LYDA 1VKCA 3G3SA 2HB6A 3SXOA 3D2PA
chains in the Genus database with same CATH topology
3RAMA 4MHYA 1LAMA 3IO1A 4ESSA 1R3NA 3NH4A 2IMOA 4JYWA 3GLJA 2XD7A 4TU0A 2CTCA 2V8DA 3D67A 4R6TA 1TKFA 4GM5A 5F09A 3DGVA 1ZG9A 2JBJA 2DEAA 4KYBA 5D8NA 2Q51A 1ZR3A 2ZEDA 3SJXA 4P4FA 2POKA 1LCPA 2EWBA 5JGFA 2PJ8A 3D66A 1AMPA 2PJ7A 4KSIA 3ETIA 3SIGA 1Z5RA 1ARLA 4G1PA 4NJQA 3GQEA 4DYOA 4P4JA 2XEFA 2RFHA 4OIDA 1ZLIA 3PBBA 4R7MA 3PB9X 4MRIA 5HXDA 1YW6A 4AXVA 1SPVA 1HDUA 5E3BA 3T8WA 4NGTA 4UF4A 5DUSA 2GLFA 3PEIA 4OC4A 3S9MA 1LOKA 4PXBA 3V38A 1RTQA 2FXKA 4OKOA 5LYIA 5FSVA 3CT9A 3EKEA 3KQXA 4ZY1A 1LANA 5HVFA 3FH4A 5THWA 3B3VA 4IK2A 3SI2A 2FVGA 1JQGA 2VL1A 8CPAA 3D7GA 3BI1A 2NYQA 1IGBA 1IY7A 3WC6A 2ZEOA 4OC1A 2CTBA 5J1QA 3K2KA 5HVGA 1XMBA 4H2KA 3RZAA 2OOTA 1EE3P 4P45A 1YLOA 3QNVA 5LRKA 4FWUA 3PRTA 5FSUA 2EK9A 3SI1A 2PVWA 2AFMA 4OMEA 3KZWA 4UMLA 4A37A 2GREA 2I3CA 3IIFA 3ISZA 3MRUA 4JZ0A 3GPOA 3PB6X 3EW5A 1TXZA 1YSJA 3B3SA 1YMEA 2O4HA 4DUKA 5I4MA 4W9YA 1ZR5A 5DS0A 1VHUA 3RBUA 2WZNA 4ZX8A 3GB0A 1HEEA 4WJBA 1BAVA 5K8MA 2Q4ZA 1CP6A 5K8OA 4NGRA 5CPAA 1TKHA 1Y0RA 4UIBA 5HVHA 1Z8LA 3V45A 2IQ6A 2XEIA 3S9NA 3I1UA 4NGPA 1XJOA 1Z2LA 1CX8A 4OP4A 2PIYA 4TWEA 1LAPA 4NJRA 3BXMA 4JCAA 1BLLE 3K9TA 5LRJA 1CG2A 1QQ9A 3PB4X 1ZG7A 4LQGA 5CB5A 2VRIA 5FSXA 2F8HA 1Y0YA 4O23A 2C6PA 2ACFA 2C6GA 3NFZA 4MHZA 4PPZA 1TXRA 4PXCA 3IC1A 3PB7X 4RUHA 2V77A 4F9VA 3ISXA 1R43A 1TF9A 2V8GA 3SJFA 3FJUA 2BO9A 1M4LA 2C6CA 4IAVA 3BI0A 2PCUA 3NH8A 4P4DA 2CIJA 3B3CA 3FX6A 4D86A 1ELMP 1DTDA 3EWQA 2ZELA 3KHXA 4OC5A 4PQAA 3L2NA 4OC2A 4NFRA 4IQYA 3PFOA 1CP7A 4P4BA 4UEZA 5JH9A 1CPSA 4MXUA 1HDQA 1UWYA 5CB3A 4PXDA 3SI0A 3FEEA 4X3RA 3EWRA 3IIDA 2PE3A 4MHPA 3BHXA 4P44A 1LFWA 3KR5A 4GUAA 2ZOGA 4EFDA 3EJFA 1F57A 3H8EA 1ZLHA 2O53A 2AFUA 2AFXA 3WC7A 3D7FA 3KASA 1F2OA 1BPMA 2AFOA 4NGQA 2ZEGA 3JZTA 1NJRA 2CF4A 2AFSA 3SIJA 2ZEPA 4R8FA 2QVPA 3B2YA 3IWWA 4CPAA 2OR4A 5FSZA 1QMUA 1TKJA 3FEDA 1GYTA 4ONWA 3VARA 3KGQA 2GLJA 4FUUA 4ZY2A 3KL9A 2LGRA 3D7HA 3VFQA 1VIXA 3NA6A 4FBEA 3H8FA 4YWYA 3SJGA 2JBKA 5CMSA 3CDXA 3KI9A 4OIWA 5K8NA 2IJZA 4IHMA 4MMOA 3FVLA 2ZEHA 3WC5A 3PB8X 2HC9A 3FF3A 3MN8A 3SIHA 2AFZA 3B3WA 1TF8A 3VH9A 5LYFA 4A94A 4OC0A 1Y7EA 5D29A 3GPQA 1CBXA 3B3TA 4YU9A 4JLLA 5HIHA 3WABA 4MCSA 4GVVA 4J4ZA 3KQZA 2PJCA 2ABZA 4P4EA 7CPAA 1VHOA 2QJ8A 4OC3A 4ETKA 3CPXA 4J5RA 4JVVA 2ZEEA 4NGNA 3SIIA 3GPGA 2EEEA 2AFWA 1VGYA 2V8HA 3DLJA 2WYRA 4A38A 3IIBA 2BFRA 1XBUA 3LMSA 6CPAA 4F8ZA 5ELYA 2ZOFA 5HOLA 1ARMA 5JM6A 2BFQA 3VATA 1FT7A 2ANPA 2F7VA 1TY8A 3Q6ZA 2XEGA 1Q7LA 5LYLA 5IB9A 1PCAA 4P6YA 4DJLA 4PXEA 1FNOA 2EK8A 3B7IA 3PBEA 4A39A 1CPXA 2X47A 3V2BA 1VHEA 3HLPA 3B35A 4MCRA 3S9LA 2FAVA 1XFOA 4WWVA 2G9DA 3D68A 4ETJA 1H8LA 2PJAA 4JGKA 5LRGA 4X2TA 5K8PA 1PYTB 4R76A 1ELLP 2PJ6A 4UEEA 4GVWA 3N5FA 4X8IA 2L8RA 3H8GA 3D7DA 3EWPA 2PJ5A 2PJ3A 1F2PA 2GU2A 1OBRA 4BD9A 3GUXA 3Q71A 1HJZA 4FAIA 2PVVA 4NGMA 2PJBA 4MHNA 4ABLA 2V8VA 3IFEA 3V7ZA 2PJ1A 4TNUA 2DX6A 3LWUA 4J5SA 2PIZA 3HUVA 4Q7AA 4F9UA 1KWMA 3PFEA 4Z65A 3KHZA 2FG1A 3TX8A 3EWOA 1NSAA 5AILA 4MCQA 3JRUA 1DE4C 2QYVA 4J5QA 5FSYA 2BOAA 1YW4A 2ZEMA 3EJGA 4ZYQA 3GQOA 2PJ9A 2J9AA 2BCOA 3IJ3A 4EMEA 4P10A 2NSMA 1ZG8A 4UIAA 3SJEA 2ZEFA 3FMCA 4B6ZA 3NH5A 2JEWA 2PJ4A 3FECA 3IEHA 2XEJA 2PRQA 5CBMA 4ZX9A 4P4IA 1YD9A 3CPAA 4ABKA 4ZI6A 4ZY0A 4UEFA 1XRYA 4EWTA 4MCPA 1AYEA 4K0CA 3WT4A 2C1CA 3D4UA 3KR4A 4K3NA 2PJ2A 3TC8A 2RB7A 4NGSA 1BPNA 2AFCA 2PJ0A 2Q43A 2ZENA 5LYDA 2HB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAM A;  4MHY A;  1LAM A;  3IO1 A;  4ESS A;  1R3N A;  3NH4 A;  2IMO A;  4JYW A;  3GLJ A;  2XD7 A;  4TU0 A;  2CTC A;  2V8D A;  3D67 A;  4R6T A;  1TKF A;  4GM5 A;  5F09 A;  3DGV A;  1ZG9 A;  2JBJ A;  2DEA A;  4KYB A;  5D8N A;  2Q51 A;  1ZR3 A;  2ZED A;  3SJX A;  4P4F A;  2POK A;  1LCP A;  2EWB A;  5JGF A;  2PJ8 A;  3D66 A;  1AMP A;  2PJ7 A;  4KSI A;  3ETI A;  3SIG A;  1Z5R A;  1ARL A;  4G1P A;  4NJQ A;  3GQE A;  4DYO A;  4P4J A;  2XEF A;  2RFH A;  4OID A;  1ZLI A;  3PBB A;  4R7M A;  3PB9 X;  4MRI A;  5HXD A;  1YW6 A;  4AXV A;  1SPV A;  1HDU A;  5E3B A;  3T8W A;  4NGT A;  4UF4 A;  5DUS A;  2GLF A;  3PEI A;  4OC4 A;  3S9M A;  1LOK A;  4PXB A;  3V38 A;  1RTQ A;  2FXK A;  4OKO A;  5LYI A;  5FSV A;  3CT9 A;  3EKE A;  3KQX A;  4ZY1 A;  1LAN A;  5HVF A;  3FH4 A;  5THW A;  3B3V A;  4IK2 A;  3SI2 A;  2FVG A;  1JQG A;  2VL1 A;  8CPA A;  3D7G A;  3BI1 A;  2NYQ A;  1IGB A;  1IY7 A;  3WC6 A;  2ZEO A;  4OC1 A;  2CTB A;  5J1Q A;  3K2K A;  5HVG A;  1XMB A;  4H2K A;  3RZA A;  2OOT A;  1EE3 P;  4P45 A;  1YLO A;  3QNV A;  5LRK A;  4FWU A;  3PRT A;  5FSU A;  2EK9 A;  3SI1 A;  2PVW A;  2AFM A;  4OME A;  3KZW A;  4UML A;  4A37 A;  2GRE A;  2I3C A;  3IIF A;  3ISZ A;  3MRU A;  4JZ0 A;  3GPO A;  3PB6 X;  3EW5 A;  1TXZ A;  1YSJ A;  3B3S A;  1YME A;  2O4H A;  4DUK A;  5I4M A;  4W9Y A;  1ZR5 A;  5DS0 A;  1VHU A;  3RBU A;  2WZN A;  4ZX8 A;  3GB0 A;  1HEE A;  4WJB A;  1BAV A;  5K8M A;  2Q4Z A;  1CP6 A;  5K8O A;  4NGR A;  5CPA A;  1TKH A;  1Y0R A;  4UIB A;  5HVH A;  1Z8L A;  3V45 A;  2IQ6 A;  2XEI A;  3S9N A;  3I1U A;  4NGP A;  1XJO A;  1Z2L A;  1CX8 A;  4OP4 A;  2PIY A;  4TWE A;  1LAP A;  4NJR A;  3BXM A;  4JCA A;  1BLL E;  3K9T A;  5LRJ A;  1CG2 A;  1QQ9 A;  3PB4 X;  1ZG7 A;  4LQG A;  5CB5 A;  2VRI A;  5FSX A;  2F8H A;  1Y0Y A;  4O23 A;  2C6P A;  2ACF A;  2C6G A;  3NFZ A;  4MHZ A;  4PPZ A;  1TXR A;  4PXC A;  3IC1 A;  3PB7 X;  4RUH A;  2V77 A;  4F9V A;  3ISX A;  1R43 A;  1TF9 A;  2V8G A;  3SJF A;  3FJU A;  2BO9 A;  1M4L A;  2C6C A;  4IAV A;  3BI0 A;  2PCU A;  3NH8 A;  4P4D A;  2CIJ A;  3B3C A;  3FX6 A;  4D86 A;  1ELM P;  1DTD A;  3EWQ A;  2ZEL A;  3KHX A;  4OC5 A;  4PQA A;  3L2N A;  4OC2 A;  4NFR A;  4IQY A;  3PFO A;  1CP7 A;  4P4B A;  4UEZ A;  5JH9 A;  1CPS A;  4MXU A;  1HDQ A;  1UWY A;  5CB3 A;  4PXD A;  3SI0 A;  3FEE A;  4X3R A;  3EWR A;  3IID A;  2PE3 A;  4MHP A;  3BHX A;  4P44 A;  1LFW A;  3KR5 A;  4GUA A;  2ZOG A;  4EFD A;  3EJF A;  1F57 A;  3H8E A;  1ZLH A;  2O53 A;  2AFU A;  2AFX A;  3WC7 A;  3D7F A;  3KAS A;  1F2O A;  1BPM A;  2AFO A;  4NGQ A;  2ZEG A;  3JZT A;  1NJR A;  2CF4 A;  2AFS A;  3SIJ A;  2ZEP A;  4R8F A;  2QVP A;  3B2Y A;  3IWW A;  4CPA A;  2OR4 A;  5FSZ A;  1QMU A;  1TKJ A;  3FED A;  1GYT A;  4ONW A;  3VAR A;  3KGQ A;  2GLJ A;  4FUU A;  4ZY2 A;  3KL9 A;  2LGR A;  3D7H A;  3VFQ A;  1VIX A;  3NA6 A;  4FBE A;  3H8F A;  4YWY A;  3SJG A;  2JBK A;  5CMS A;  3CDX A;  3KI9 A;  4OIW A;  5K8N A;  2IJZ A;  4IHM A;  4MMO A;  3FVL A;  2ZEH A;  3WC5 A;  3PB8 X;  2HC9 A;  3FF3 A;  3MN8 A;  3SIH A;  2AFZ A;  3B3W A;  1TF8 A;  3VH9 A;  5LYF A;  4A94 A;  4OC0 A;  1Y7E A;  5D29 A;  3GPQ A;  1CBX A;  3B3T A;  4YU9 A;  4JLL A;  5HIH A;  3WAB A;  4MCS A;  4GVV A;  4J4Z A;  3KQZ A;  2PJC A;  2ABZ A;  4P4E A;  7CPA A;  1VHO A;  2QJ8 A;  4OC3 A;  4ETK A;  3CPX A;  4J5R A;  4JVV A;  2ZEE A;  4NGN A;  3SII A;  3GPG A;  2EEE A;  2AFW A;  1VGY A;  2V8H A;  3DLJ A;  2WYR A;  4A38 A;  3IIB A;  2BFR A;  1XBU A;  3LMS A;  6CPA A;  4F8Z A;  5ELY A;  2ZOF A;  5HOL A;  1ARM A;  5JM6 A;  2BFQ A;  3VAT A;  1FT7 A;  2ANP A;  2F7V A;  1TY8 A;  3Q6Z A;  2XEG A;  1Q7L A;  5LYL A;  5IB9 A;  1PCA A;  4P6Y A;  4DJL A;  4PXE A;  1FNO A;  2EK8 A;  3B7I A;  3PBE A;  4A39 A;  1CPX A;  2X47 A;  3V2B A;  1VHE A;  3HLP A;  3B35 A;  4MCR A;  3S9L A;  2FAV A;  1XFO A;  4WWV A;  2G9D A;  3D68 A;  4ETJ A;  1H8L A;  2PJA A;  4JGK A;  5LRG A;  4X2T A;  5K8P A;  1PYT B;  4R76 A;  1ELL P;  2PJ6 A;  4UEE A;  4GVW A;  3N5F A;  4X8I A;  2L8R A;  3H8G A;  3D7D A;  3EWP A;  2PJ5 A;  2PJ3 A;  1F2P A;  2GU2 A;  1OBR A;  4BD9 A;  3GUX A;  3Q71 A;  1HJZ A;  4FAI A;  2PVV A;  4NGM A;  2PJB A;  4MHN A;  4ABL A;  2V8V A;  3IFE A;  3V7Z A;  2PJ1 A;  4TNU A;  2DX6 A;  3LWU A;  4J5S A;  2PIZ A;  3HUV A;  4Q7A A;  4F9U A;  1KWM A;  3PFE A;  4Z65 A;  3KHZ A;  2FG1 A;  3TX8 A;  3EWO A;  1NSA A;  5AIL A;  4MCQ A;  3JRU A;  1DE4 C;  2QYV A;  4J5Q A;  5FSY A;  2BOA A;  1YW4 A;  2ZEM A;  3EJG A;  4ZYQ A;  3GQO A;  2PJ9 A;  2J9A A;  2BCO A;  3IJ3 A;  4EME A;  4P10 A;  2NSM A;  1ZG8 A;  4UIA A;  3SJE A;  2ZEF A;  3FMC A;  4B6Z A;  3NH5 A;  2JEW A;  2PJ4 A;  3FEC A;  3IEH A;  2XEJ A;  2PRQ A;  5CBM A;  4ZX9 A;  4P4I A;  1YD9 A;  3CPA A;  4ABK A;  4ZI6 A;  4ZY0 A;  4UEF A;  1XRY A;  4EWT A;  4MCP A;  1AYE A;  4K0C A;  3WT4 A;  2C1C A;  3D4U A;  3KR4 A;  4K3N A;  2PJ2 A;  3TC8 A;  2RB7 A;  4NGS A;  1BPN A;  2AFC A;  2PJ0 A;  2Q43 A;  2ZEN A;  5LYD A;  2HB6 A; 
#chains in the Genus database with same CATH topology
 3FNC A;  3RAM A;  4KVM E;  4MHY A;  1I12 A;  4HNX B;  1LAM A;  3IO1 A;  4CGM A;  2CY2 A;  4ESS A;  1R3N A;  1XMT A;  1YK3 A;  2IMO A;  2F5I A;  3GLJ A;  3NH4 A;  2XD7 A;  4TU0 A;  3QB8 A;  2CTC A;  2V8D A;  3D67 A;  4R6T A;  2Q4V A;  1TKF A;  4GM5 A;  5F09 A;  3DGV A;  1ZG9 A;  1S3Z A;  1QSN A;  1MJ9 A;  2J8N A;  2JBJ A;  3P2H A;  4C7I A;  2EVN A;  2DEA A;  4KYB A;  4JWP A;  5D8N A;  2Q51 A;  3IWE A;  2ODF A;  2ZW5 A;  4CAW A;  2C27 A;  4HNY B;  1ZR3 A;  2RNK A;  4JLY A;  1PU9 A;  1L0C A;  2ZED A;  2FIW A;  3S6F A;  3SJX A;  5KTD A;  2JDD A;  2VQY A;  4P4F A;  2POK A;  1S7L A;  1LCP A;  2WPW A;  2Z3K A;  4A2Z A;  2EWB A;  2VZY A;  2O28 A;  3A9L A;  3D3S A;  3TO9 A;  2WUU A;  5DWN A;  2PJ8 A;  3D66 A;  4CYO A;  5JGF A;  1AMP A;  2PJ7 A;  3GYA A;  4FD6 A;  4KSI A;  2D4P A;  4UCP A;  4PV6 A;  1IOI A;  1ZO0 A;  2ZPA A;  3ETI A;  3SIG A;  2REF A;  1Z5R A;  4MBU A;  1ARL A;  2PSW A;  4G1P A;  4PK3 A;  4NJQ A;  4QUS A;  3UY5 A;  4K30 A;  3GQE A;  1Y9K A;  1YVO A;  4DYO A;  1QSR A;  4P4J A;  1ON0 A;  2XEF A;  2RFH A;  3BJ7 A;  3W6S A;  5I0C A;  3S6H A;  4B13 A;  4OID A;  1ZLI A;  3PBB A;  4U9Z A;  2HQY A;  5EBV A;  5ISV A;  4R7M A;  1CJW A;  1KUX A;  3PB9 X;  4MRI A;  4A30 A;  5HXD A;  1YW6 A;  4AXV A;  1SPV A;  1HDU A;  4CRZ B;  5E3B A;  3T8W A;  4NGT A;  4QBJ A;  2YGW A;  2R1I A;  1YGH A;  2ZXV A;  2OZU A;  2W2G A;  5DUS A;  4H6Z A;  4UF4 A;  4AVB A;  4E0A A;  2GLF A;  3FIX A;  3PEI A;  4QC6 A;  4QB9 A;  4Y49 B;  4ZGY B;  2B4B A;  4OC4 A;  3S9M A;  1LOK A;  2B5G A;  2K5T A;  4PXB A;  3V38 A;  1RTQ A;  2FXK A;  4OKO A;  3R9G A;  2QIR A;  5LYI A;  5FSV A;  3CT9 A;  3EKE A;  3KQX A;  1P4N A;  4ZY1 A;  2B5G B;  4KOU A;  2Q7B A;  1LAN A;  2KQV A;  3PGP A;  3FH4 A;  4Y49 C;  2FS5 A;  5HVF A;  5THW A;  3B3V A;  3LAC A;  4IK2 A;  3SI2 A;  2DPT A;  4KOR A;  4AG7 A;  5HH1 A;  2FVG A;  1JQG A;  1NE9 A;  2VL1 A;  4MFL A;  8CPA A;  3NE7 A;  4MJ8 A;  3IU1 A;  3D7G A;  3PZJ A;  3BI1 A;  2NYQ A;  3JUW A;  1IGB A;  2P6G A;  2PR8 A;  4ONU A;  4XPD B;  3FYN A;  1IY7 A;  3EC4 A;  5G20 A;  3WC6 A;  2ZEO A;  4OC1 A;  5GCN A;  4KSF A;  2CTB A;  4C2Z A;  5J1Q A;  1UFH A;  3K2K A;  4KS9 A;  4KOS A;  5HVG A;  4MFP A;  4B5O A;  2GIV A;  1XMB A;  4H2K A;  3RZA A;  3B8G A;  1V0C A;  2OOT A;  1EE3 P;  1IB1 E;  4CYN A;  4M85 A;  4P45 A;  2FSR A;  1YLO A;  1KZF A;  3D2M A;  3QNV A;  4OLL A;  5LRK A;  4FWU A;  3PRT A;  4KOT A;  5FSU A;  2EK9 A;  1S7F A;  1BO4 A;  3BJ8 A;  3SI1 A;  2PVW A;  2AFM A;  4OME A;  4AB7 A;  4XPL A;  3KZW A;  4UML A;  1IYK A;  4A37 A;  2GRE A;  2Q4Y A;  1LRZ A;  3H5Z A;  4BIN A;  4MFK A;  2WCT A;  3IIF A;  2I3C A;  1MJB A;  5EMI A;  4B10 A;  3ISZ A;  2BEI A;  3MRU A;  4JZ0 A;  3GPO A;  3PB6 X;  3IGR A;  4CYQ A;  5CNP A;  4E8O A;  2CNM A;  1YLE A;  3KKW A;  4CAF A;  2NMT A;  4MHD A;  3EW5 A;  1B6B A;  1TXZ A;  2I79 A;  1YSJ A;  2FL4 A;  3LOD A;  1MJA A;  3IWG A;  3B3S A;  2B3U A;  5E96 A;  1YME A;  2O4H A;  4DUK A;  1Z4R A;  4W9Y A;  5I4M A;  4HKF A;  5C88 A;  1ZR5 A;  5DS0 A;  1VHU A;  2Z3O A;  3VWE A;  3RBU A;  2WZN A;  4ZX8 A;  2G0B A;  4ZBG A;  3GB0 A;  1HEE A;  5IV0 A;  1QST A;  4WJB A;  1BAV A;  5K8M A;  3DDD A;  2R7H A;  2Q4Z A;  4H6U A;  1CP6 A;  1I21 A;  5K8O A;  4A33 A;  2Z3M A;  4NGR A;  2Q7S A;  4NXY A;  1TKH A;  2JZE A;  5CPA A;  1Y0R A;  3R96 A;  4JD6 A;  1YRE A;  3CXS A;  4UIB A;  4F6A A;  5A28 A;  5HVH A;  2YND A;  1Z8L A;  3V45 A;  2IQ6 A;  2XEI A;  2PR1 A;  2H5M A;  3S9N A;  3I1U A;  4NGP A;  1XJO A;  5JQ4 A;  4NEX A;  1Z2L A;  1CX8 A;  3VWD A;  4OP4 A;  3R9E A;  1K4J A;  1B87 A;  2WPX A;  1S60 A;  2VXK A;  2PIY A;  4KZT A;  4TWE A;  2FIA A;  1LAP A;  4NJR A;  3BXM A;  3LD2 A;  4JCA A;  3FXT A;  1BLL E;  2YNC C;  2KCW A;  3FRM A;  1RO5 A;  2QEC A;  3K9T A;  1CG2 A;  2HV2 A;  1QQ9 A;  2VBQ A;  3PB4 X;  5LRJ A;  4AG9 A;  2OZG A;  3EY5 A;  4Q36 A;  1ZG7 A;  5G1Z A;  4MI4 A;  2Z3P A;  4LQG A;  5CB5 A;  2VRI A;  2JDC A;  5FSX A;  2GFQ A;  2F8H A;  1Y0Y A;  4O23 A;  2C6P A;  2ACF A;  1WK4 A;  2C6G A;  3NFZ A;  5F47 A;  4MHZ A;  4PPZ A;  1TXR A;  4PXC A;  3IC1 A;  3PB7 X;  4CYP A;  1XEB A;  2V77 A;  1YVK A;  2AJ6 A;  3C26 A;  4UWI A;  4F9V A;  4RUH A;  3TE4 A;  2P6E A;  3T9Y A;  1XOV A;  1S7K A;  4MY3 A;  4IUS A;  5AG6 A;  3F8K A;  1SQH A;  1Z4E A;  3ISX A;  1R43 A;  1TF9 A;  2B3V A;  2V8G A;  2ZW4 A;  2J8M A;  4UCN A;  1U6M A;  3SJF A;  4I49 A;  3FJU A;  2BO9 A;  4KOY A;  1M4L A;  2C6C A;  4IAV A;  1S7N A;  2QML A;  3BI0 A;  4C2X A;  3TCV A;  2PCU A;  2A4N A;  2DF5 A;  4U5Y A;  4YGO A;  3NH8 A;  4P4D A;  2CIJ A;  3B3C A;  3FX6 A;  3IU2 A;  4FD5 A;  5BWA B;  3TOA A;  3RYO A;  3MGD A;  4D86 A;  5H86 A;  1ELM P;  1I1D A;  5AGE A;  2PRB A;  1DTD A;  1OZP A;  4CAE A;  4UFW A;  3EWQ A;  2ZEL A;  3KHX A;  4X5K A;  4OC5 A;  4PQA A;  2FXF A;  3L2N A;  5F46 A;  4OC2 A;  2ZW7 A;  4NFR A;  3R95 A;  3T90 A;  4IQY A;  3N7Z A;  3PFO A;  4C68 A;  1CP7 A;  4P4B A;  4UEZ A;  4L8A A;  1CPS A;  2GAN A;  4NSQ A;  5JH9 A;  5AG7 A;  4MXU A;  3S6G A;  1HDQ A;  1UWY A;  5CB3 A;  4PXD A;  3SI0 A;  3V8I A;  1BOB A;  1N71 A;  4RN7 A;  3FEE A;  4A31 A;  4YRH A;  4LQ6 A;  4X3R A;  4JYW A;  1GHE A;  3EWR A;  3IID A;  1Z8W A;  4KUA A;  4AVC A;  2Z0Z A;  2PE3 A;  2Y0M A;  4NF1 A;  4MHP A;  3TOB A;  3BHX A;  4P44 A;  1LFW A;  2EBJ A;  3KR5 A;  4GUA A;  2ZOG A;  4EFD A;  1FY7 A;  3EJF A;  1F57 A;  3H8E A;  1ZLH A;  2R8V A;  2O53 A;  2AFU A;  2AFX A;  3WC7 A;  1Y9W A;  2Q44 A;  1F2O A;  3D7F A;  1BPM A;  3KAS A;  2AFO A;  4KOW A;  4UA3 A;  4NGQ A;  4B11 A;  2CXA A;  1AUG A;  3EFA A;  2ZEG A;  4KOV A;  3JZT A;  4U9Y A;  1NJR A;  1Z8X A;  2CF4 A;  1WWZ A;  2AFS A;  2G3A A;  2HUZ A;  3SIJ A;  3I9S A;  2ZEP A;  4UFX A;  2B4D B;  3TT2 A;  3W91 A;  5F48 A;  4R8F A;  2QVP A;  3B2Y A;  3IWW A;  5FVJ A;  1S5K A;  4UCM A;  1YR0 A;  4CPA A;  2OR4 A;  5FSZ A;  2EUI A;  1QMU A;  1TKJ A;  2ATR A;  1GYT A;  3FED A;  2EO8 A;  2Z3L A;  4ONW A;  4KVO E;  3VAR A;  2OH1 A;  3GY9 A;  3KGQ A;  4LX9 A;  2GLJ A;  4FUU A;  2JZF A;  4E2A A;  1VHS A;  4HPS A;  4MFQ A;  4ZY2 A;  1NMT A;  3KL9 A;  2LGR A;  3CZX A;  3D7H A;  3VFQ A;  3TO6 A;  1VIX A;  3SXN A;  2FE7 A;  3NA6 A;  4C7H A;  4FBE A;  1Q2D A;  4NCZ A;  4JXR A;  5C82 A;  3H8F A;  1R57 A;  2PC1 A;  4YWY A;  4QVT A;  3SJG A;  2JBK A;  5CMS A;  2FT0 A;  3TTH A;  3CDX A;  4UBR A;  1J4J A;  4CS0 B;  4CAV A;  3KI9 A;  1CM0 A;  4OIW A;  5K8N A;  2IJZ A;  4OAE A;  3CXP A;  4CGO A;  4IHM A;  4MMO A;  3FVL A;  2ZEH A;  3WC5 A;  3PB8 X;  4GXH A;  4PSW A;  2I00 A;  2HC9 A;  4FD7 A;  5KTC A;  4C2Y A;  1Q2Y A;  3OWC A;  3FF3 A;  2YNC A;  3MN8 A;  4GS4 A;  5G22 A;  3SIH A;  2AFZ A;  3B3W A;  1TF8 A;  2P0W A;  3F0A A;  3VH9 A;  5LYF A;  4M6H A;  4OC0 A;  2PQ8 A;  1Y7E A;  5D29 A;  3GPQ A;  1CBX A;  4A94 A;  4B5P B;  3B3T A;  4YU9 A;  4JLL A;  5HIH A;  1Z9U A;  3WAB A;  5A27 A;  1M4G A;  4B12 A;  5IX3 A;  3K9U A;  4MCS A;  4CGP A;  4M3S A;  2OB0 A;  2JEV A;  4GVV A;  3TFY A;  1QSO A;  4J4Z A;  3TO7 A;  1XF8 A;  3ZZI A;  4CAX A;  2ARH A;  5HMN A;  1X12 A;  3KQZ A;  1PUA A;  2PJC A;  1M4I A;  2DPS A;  2ABZ A;  2J8R A;  3I3G A;  3DNS A;  4P4E A;  7CPA A;  1VHO A;  2QJ8 A;  4OC3 A;  4ETK A;  3EXN A;  3CPX A;  1KUV A;  2P6F A;  3DR6 A;  4MFZ A;  1KUY A;  4J5R A;  2Q0Y A;  2VI7 A;  4JVV A;  2CNS A;  2ZEE A;  4NGN A;  3ZJ0 A;  4R87 A;  3G8W A;  4UFV A;  1Y7R A;  1JWQ A;  2FCK A;  4Q38 A;  2Q04 A;  3SII A;  3GPG A;  2EEE A;  2AFW A;  4KVX A;  1VGY A;  4LUA A;  3F5B A;  1P0H A;  1Q2C A;  2BUE A;  2V8H A;  2WYR A;  3DLJ A;  4A38 A;  3IIB A;  2BFR A;  1XBU A;  3LMS A;  2OZH A;  6CPA A;  4PK2 A;  3GIU A;  4F8Z A;  5H84 A;  1XE4 A;  2VZZ A;  2OU2 A;  5ELY A;  2ZOF A;  5HOL A;  1ARM A;  5AG5 A;  5JM6 A;  1M1D A;  4ORF A;  2BFQ A;  2BSW A;  3VAT A;  2WSA A;  1FT7 A;  2ANP A;  2F7V A;  4XPK A;  3RO0 A;  1TY8 A;  3Q6Z A;  2XEG A;  4MY0 A;  1MK4 A;  1Q7L A;  4CRY B;  2G3T A;  5IB9 A;  4UWJ A;  1PCA A;  5LYL A;  4P6Y A;  4DJL A;  4PXE A;  1FNO A;  2EK8 A;  2YNE A;  4R9M A;  3B7I A;  3PBE A;  4M6I A;  2D4O A;  2JLM A;  1NSL A;  4A39 A;  2Z10 A;  1CPX A;  2X47 A;  3V2B A;  1IID A;  1VHE A;  3B35 A;  3HLP A;  4MCR A;  5EC4 A;  3S9L A;  5J8C A;  2FAV A;  1XFO A;  4WWV A;  2G9D A;  2Z11 A;  3D68 A;  4ETJ A;  3RNZ A;  1M44 A;  1H8L A;  2PJA A;  4JGK A;  3D8P A;  3DR8 A;  4RS2 A;  5LRG A;  3W6X A;  4X2T A;  4CGL A;  5K8P A;  1PYT B;  3DSB A;  5G21 A;  4R76 A;  4JXQ A;  4B14 A;  1ELL P;  4KLV A;  2DXQ A;  2PJ6 A;  3GKR A;  4UEE A;  4GVW A;  5IB0 A;  3N5F A;  4X8I A;  4II9 A;  2CNT A;  2L8R A;  3H8G A;  3EO4 A;  3D7D A;  3EWP A;  3BLN A;  2PJ5 A;  4XNH B;  2PJ3 A;  4AVA A;  2BL1 A;  4BBH A;  1F2P A;  2ZW6 A;  2GU2 A;  1OBR A;  4BD9 A;  3GUX A;  4M6G A;  3Q71 A;  5KTA A;  2B4D A;  4YFJ A;  1HJZ A;  2IL4 A;  3QAH A;  4FAI A;  2PVV A;  1RXT A;  4NGM A;  2VEZ A;  2PJB A;  4MHN A;  4XNH C;  4DNC A;  4ABL A;  2V8V A;  4F0X A;  3IFE A;  2Z3N A;  3V7Z A;  2PJ1 A;  4TNU A;  4BMH A;  2DX6 A;  3P2F A;  3LWU A;  1IYL A;  4RI1 A;  4B5P A;  4J5S A;  4JJX A;  2PIZ A;  3HUV A;  4Q7A A;  4F9U A;  1KWM A;  3PFE A;  1IOF A;  3WR7 A;  1XIX A;  2REE A;  4Z65 A;  3PP9 A;  3KHZ A;  2FG1 A;  3TX8 A;  4OAD A;  2R98 A;  2RC4 A;  4KOX A;  3EWO A;  1NSA A;  5AIL A;  4KSA A;  3JRU A;  4MCQ A;  4XPD C;  1A2Z A;  1DE4 C;  4H89 A;  2PDO A;  3JVN A;  2QYV A;  1QSM A;  3QAY A;  2X7B A;  4J5Q A;  3SHP A;  5F49 A;  5FSY A;  2BOA A;  1YW4 A;  2ZEM A;  3EJG A;  4KUB A;  2GE3 A;  3FB3 A;  4ZYQ A;  3R9F A;  3GQO A;  2B58 A;  3H4Q A;  5JPH A;  2PJ9 A;  2J9A A;  2BCO A;  4F0Y A;  3IJ3 A;  3CXQ A;  4EME A;  4P10 A;  2NSM A;  1ZG8 A;  3JTK A;  4PSX A;  4UIA A;  3SJE A;  2ZEF A;  3FMC A;  4R3L A;  5DWM A;  4B6Z A;  3NH5 A;  2JEW A;  2PJ4 A;  4HNW B;  4R57 A;  3FEC A;  3NE8 A;  4R3K A;  3IEH A;  2XEJ A;  2PRQ A;  3R1K A;  2JZD A;  3FBU A;  5CBM A;  4ZX9 A;  1YQE A;  4P4I A;  4A32 A;  3S6K A;  1YD9 A;  4EVY A;  1YX0 A;  1M4D A;  3CPA A;  4ABK A;  4ZI6 A;  4ZY0 A;  4FD4 A;  1XRY A;  4MFJ A;  4UEF A;  2AE6 A;  4A95 A;  4EWT A;  1Z8T A;  4J3G A;  1AYE A;  4K0C A;  4MCP A;  3WT4 A;  1IIC A;  2C1C A;  3D4U A;  1TIQ A;  4CGN A;  1IU8 A;  3KR4 A;  5AG4 A;  4IF5 A;  3E0K A;  4K3N A;  2PJ2 A;  5J8F A;  4L89 A;  1X10 A;  3TC8 A;  2RB7 A;  4NGS A;  1BPN A;  2AFC A;  2PJ0 A;  2Q43 A;  2ZEN A;  4KLW A;  5LYD A;  1VKC A;  3G3S A;  2HB6 A;  3SXO A;  3D2P A; 
#chains in the Genus database with same CATH homology
 3RAM A;  4MHY A;  1LAM A;  3IO1 A;  4ESS A;  1R3N A;  3NH4 A;  2IMO A;  4JYW A;  3GLJ A;  2XD7 A;  4TU0 A;  2CTC A;  2V8D A;  3D67 A;  4R6T A;  1TKF A;  4GM5 A;  5F09 A;  3DGV A;  1ZG9 A;  2JBJ A;  2DEA A;  4KYB A;  5D8N A;  2Q51 A;  1ZR3 A;  2ZED A;  3SJX A;  4P4F A;  2POK A;  1LCP A;  2EWB A;  5JGF A;  2PJ8 A;  3D66 A;  1AMP A;  2PJ7 A;  4KSI A;  3ETI A;  3SIG A;  1Z5R A;  1ARL A;  4G1P A;  4NJQ A;  3GQE A;  4DYO A;  4P4J A;  2XEF A;  2RFH A;  4OID A;  1ZLI A;  3PBB A;  4R7M A;  3PB9 X;  4MRI A;  5HXD A;  1YW6 A;  4AXV A;  1SPV A;  1HDU A;  5E3B A;  3T8W A;  4NGT A;  4UF4 A;  5DUS A;  2GLF A;  3PEI A;  4OC4 A;  3S9M A;  1LOK A;  4PXB A;  3V38 A;  1RTQ A;  2FXK A;  4OKO A;  5LYI A;  5FSV A;  3CT9 A;  3EKE A;  3KQX A;  4ZY1 A;  1LAN A;  5HVF A;  3FH4 A;  5THW A;  3B3V A;  4IK2 A;  3SI2 A;  2FVG A;  1JQG A;  2VL1 A;  8CPA A;  3D7G A;  3BI1 A;  2NYQ A;  1IGB A;  1IY7 A;  3WC6 A;  2ZEO A;  4OC1 A;  2CTB A;  5J1Q A;  3K2K A;  5HVG A;  1XMB A;  4H2K A;  3RZA A;  2OOT A;  1EE3 P;  4P45 A;  1YLO A;  3QNV A;  5LRK A;  4FWU A;  3PRT A;  5FSU A;  2EK9 A;  3SI1 A;  2PVW A;  2AFM A;  4OME A;  3KZW A;  4UML A;  4A37 A;  2GRE A;  2I3C A;  3IIF A;  3ISZ A;  3MRU A;  4JZ0 A;  3GPO A;  3PB6 X;  3EW5 A;  1TXZ A;  1YSJ A;  3B3S A;  1YME A;  2O4H A;  4DUK A;  5I4M A;  4W9Y A;  1ZR5 A;  5DS0 A;  1VHU A;  3RBU A;  2WZN A;  4ZX8 A;  3GB0 A;  1HEE A;  4WJB A;  1BAV A;  5K8M A;  2Q4Z A;  1CP6 A;  5K8O A;  4NGR A;  5CPA A;  1TKH A;  1Y0R A;  4UIB A;  5HVH A;  1Z8L A;  3V45 A;  2IQ6 A;  2XEI A;  3S9N A;  3I1U A;  4NGP A;  1XJO A;  1Z2L A;  1CX8 A;  4OP4 A;  2PIY A;  4TWE A;  1LAP A;  4NJR A;  3BXM A;  4JCA A;  1BLL E;  3K9T A;  5LRJ A;  1CG2 A;  1QQ9 A;  3PB4 X;  1ZG7 A;  4LQG A;  5CB5 A;  2VRI A;  5FSX A;  2F8H A;  1Y0Y A;  4O23 A;  2C6P A;  2ACF A;  2C6G A;  3NFZ A;  4MHZ A;  4PPZ A;  1TXR A;  4PXC A;  3IC1 A;  3PB7 X;  4RUH A;  2V77 A;  4F9V A;  3ISX A;  1R43 A;  1TF9 A;  2V8G A;  3SJF A;  3FJU A;  2BO9 A;  1M4L A;  2C6C A;  4IAV A;  3BI0 A;  2PCU A;  3NH8 A;  4P4D A;  2CIJ A;  3B3C A;  3FX6 A;  4D86 A;  1ELM P;  1DTD A;  3EWQ A;  2ZEL A;  3KHX A;  4OC5 A;  4PQA A;  3L2N A;  4OC2 A;  4NFR A;  4IQY A;  3PFO A;  1CP7 A;  4P4B A;  4UEZ A;  5JH9 A;  1CPS A;  4MXU A;  1HDQ A;  1UWY A;  5CB3 A;  4PXD A;  3SI0 A;  3FEE A;  4X3R A;  3EWR A;  3IID A;  2PE3 A;  4MHP A;  3BHX A;  4P44 A;  1LFW A;  3KR5 A;  4GUA A;  2ZOG A;  4EFD A;  3EJF A;  1F57 A;  3H8E A;  1ZLH A;  2O53 A;  2AFU A;  2AFX A;  3WC7 A;  3D7F A;  3KAS A;  1F2O A;  1BPM A;  2AFO A;  4NGQ A;  2ZEG A;  3JZT A;  1NJR A;  2CF4 A;  2AFS A;  3SIJ A;  2ZEP A;  4R8F A;  2QVP A;  3B2Y A;  3IWW A;  4CPA A;  2OR4 A;  5FSZ A;  1QMU A;  1TKJ A;  3FED A;  1GYT A;  4ONW A;  3VAR A;  3KGQ A;  2GLJ A;  4FUU A;  4ZY2 A;  3KL9 A;  2LGR A;  3D7H A;  3VFQ A;  1VIX A;  3NA6 A;  4FBE A;  3H8F A;  4YWY A;  3SJG A;  2JBK A;  5CMS A;  3CDX A;  3KI9 A;  4OIW A;  5K8N A;  2IJZ A;  4IHM A;  4MMO A;  3FVL A;  2ZEH A;  3WC5 A;  3PB8 X;  2HC9 A;  3FF3 A;  3MN8 A;  3SIH A;  2AFZ A;  3B3W A;  1TF8 A;  3VH9 A;  5LYF A;  4A94 A;  4OC0 A;  1Y7E A;  5D29 A;  3GPQ A;  1CBX A;  3B3T A;  4YU9 A;  4JLL A;  5HIH A;  3WAB A;  4MCS A;  4GVV A;  4J4Z A;  3KQZ A;  2PJC A;  2ABZ A;  4P4E A;  7CPA A;  1VHO A;  2QJ8 A;  4OC3 A;  4ETK A;  3CPX A;  4J5R A;  4JVV A;  2ZEE A;  4NGN A;  3SII A;  3GPG A;  2EEE A;  2AFW A;  1VGY A;  2V8H A;  3DLJ A;  2WYR A;  4A38 A;  3IIB A;  2BFR A;  1XBU A;  3LMS A;  6CPA A;  4F8Z A;  5ELY A;  2ZOF A;  5HOL A;  1ARM A;  5JM6 A;  2BFQ A;  3VAT A;  1FT7 A;  2ANP A;  2F7V A;  1TY8 A;  3Q6Z A;  2XEG A;  1Q7L A;  5LYL A;  5IB9 A;  1PCA A;  4P6Y A;  4DJL A;  4PXE A;  1FNO A;  2EK8 A;  3B7I A;  3PBE A;  4A39 A;  1CPX A;  2X47 A;  3V2B A;  1VHE A;  3HLP A;  3B35 A;  4MCR A;  3S9L A;  2FAV A;  1XFO A;  4WWV A;  2G9D A;  3D68 A;  4ETJ A;  1H8L A;  2PJA A;  4JGK A;  5LRG A;  4X2T A;  5K8P A;  1PYT B;  4R76 A;  1ELL P;  2PJ6 A;  4UEE A;  4GVW A;  3N5F A;  4X8I A;  2L8R A;  3H8G A;  3D7D A;  3EWP A;  2PJ5 A;  2PJ3 A;  1F2P A;  2GU2 A;  1OBR A;  4BD9 A;  3GUX A;  3Q71 A;  1HJZ A;  4FAI A;  2PVV A;  4NGM A;  2PJB A;  4MHN A;  4ABL A;  2V8V A;  3IFE A;  3V7Z A;  2PJ1 A;  4TNU A;  2DX6 A;  3LWU A;  4J5S A;  2PIZ A;  3HUV A;  4Q7A A;  4F9U A;  1KWM A;  3PFE A;  4Z65 A;  3KHZ A;  2FG1 A;  3TX8 A;  3EWO A;  1NSA A;  5AIL A;  4MCQ A;  3JRU A;  1DE4 C;  2QYV A;  4J5Q A;  5FSY A;  2BOA A;  1YW4 A;  2ZEM A;  3EJG A;  4ZYQ A;  3GQO A;  2PJ9 A;  2J9A A;  2BCO A;  3IJ3 A;  4EME A;  4P10 A;  2NSM A;  1ZG8 A;  4UIA A;  3SJE A;  2ZEF A;  3FMC A;  4B6Z A;  3NH5 A;  2JEW A;  2PJ4 A;  3FEC A;  3IEH A;  2XEJ A;  2PRQ A;  5CBM A;  4ZX9 A;  4P4I A;  1YD9 A;  3CPA A;  4ABK A;  4ZI6 A;  4ZY0 A;  4UEF A;  1XRY A;  4EWT A;  4MCP A;  1AYE A;  4K0C A;  3WT4 A;  2C1C A;  3D4U A;  3KR4 A;  4K3N A;  2PJ2 A;  3TC8 A;  2RB7 A;  4NGS A;  1BPN A;  2AFC A;  2PJ0 A;  2Q43 A;  2ZEN A;  5LYD A;  2HB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...