1LCPA

Bovine lens leucine aminopeptidase complexed with l-leucine phosphonic acid
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
484
structure length
484
Chain Sequence
b'TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE AMINOPEPTIDASE
publication title Transition state analogue L-leucinephosphonic acid bound to bovine lens leucine aminopeptidase: X-ray structure at 1.65 A resolution in a new crystal form.
pubmed doi rcsb
molecule tags Hydrolase (alpha-aminoacylpeptide)
total genus 169
structure length 484
sequence length 484
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lcpA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lcpA02
3FMCA 3B3TA 5K8OA 4AXVA 2CTCA 2EWBA 4PXEA 4A37A 2G9DA 5JM6A 1Z5RA 4H2KA 2WYRA 2X47A 2V8DA 2PJ1A 4NJQA 1ZLHA 3WC5A 3VH9A 5CB5A 4UEEA 4A38A 2XEIA 4JCAA 3D7GA 1ZG9A 5LRGA 2ZOFA 2O53A 2PJBA 5J1QA 2BFRA 4ONWA 4R6TA 3V38A 3MN8A 1AMPA 4Q7AA 5FSYA 5K8NA 3CDXA 3PBBA 1BPNA 1H8LA 1HEEA 4JGKA 1QMUA 1IY7A 4ABLA 1TKHA 4P4IA 4MHYA 5CMSA 4JVVA 4MCPA 4OC1A 1CP6A 5CB3A 3CPAA 1OBRA 2PJCA 4MHZA 4UEFA 3ISZA 5HOLA 2QVPA 1TF8A 2C1CA 1LAPA 3PEIA 8CPAA 2XEGA 3RAMA 3B2YA 2ZOGA 3CT9A 3NH4A 2FAVA 3GQEA 4OIWA 1CPSA 3RZAA 3JRUA 4R76A 5HIHA 4JZ0A 3NH5A 4MCRA 1ZR3A 4MXUA 4NGSA 1FT7A 1BLLE 3B3CA 4MCSA 3T8WA 4OC3A 4ESSA 2PCUA 1FNOA 2PJAA 3PB9X 3B3WA 2PJ4A 1DE4C 3WT4A 2PRQA 4P10A 4W9YA 4UF4A 3D4UA 2XEJA 3PFOA 1Z8LA 4TNUA 2Q43A 4NGMA 3L2NA 3GLJA 4J5RA 1Y7EA 3K2KA 3KASA 4MRIA 2XEFA 3GQOA 1YW4A 2AFOA 4WJBA 3FVLA 1ZG8A 5DUSA 2AFSA 5LYFA 2PJ5A 4ZY0A 2AFWA 4J4ZA 4OC5A 2PVVA 1HJZA 2ZEOA 3B3VA 4OC0A 4P6YA 2V8GA 4P4BA 3IO1A 2AFMA 5HVGA 4O23A 3IC1A 3FF3A 4UMLA 2V8VA 4NGPA 4P4FA 4G1PA 2C6CA 4J5SA 2ZENA 3GPOA 1Y0RA 4RUHA 2F8HA 3IIDA 2O4HA 1ELLP 2FVGA 3D7HA 4P4JA 2VL1A 2IMOA 2Q51A 2HB6A 3EJGA 2JBJA 3NFZA 3I1UA 4X3RA 1F57A 1Y0YA 3IIBA 3V7ZA 3D68A 1CP7A 3WC7A 1XMBA 4KSIA 4K0CA 4GM5A 2IQ6A 4NGQA 4MCQA 1ARLA 2ZEFA 1ARMA 4R8FA 3D7FA 2RFHA 2V8HA 2V77A 3BXMA 1ZR5A 2PJ2A 3D7DA 5JH9A 3KHXA 4K3NA 5LYIA 4EWTA 2AFUA 2AFZA 5HVFA 3K9TA 4FWUA 5AILA 5CPAA 1Q7LA 4OC4A 3SJXA 2FXKA 3CPXA 4UIAA 5ELYA 4A39A 2DX6A 2J9AA 2EK9A 3SJGA 2NYQA 2GREA 2I3CA 5DS0A 3ISXA 2QJ8A 3PRTA 1XRYA 2CTBA 2AFCA 3GPGA 4FAIA 1XBUA 2PJ7A 3BHXA 2XD7A 4OC2A 3B35A 1RTQA 2ZELA 3SI0A 4NGNA 4P4EA 2ZEPA 4ZY1A 5FSXA 3FH4A 3PB6X 4PXBA 3SJEA 4ZX8A 3HLPA 3VARA 1Z2LA 3BI1A 4ZYQA 3KL9A 1LOKA 3S9MA 3JZTA 4EFDA 1YSJA 2PJ6A 4KYBA 3WABA 2VRIA 3B3SA 3FEEA 3EJFA 3EWQA 4FBEA 3TC8A 1GYTA 2EK8A 4EMEA 2L8RA 2BFQA 5FSVA 2BOAA 3IEHA 3D66A 1QQ9A 4JYWA 5CBMA 1CG2A 4X8IA 2FG1A 3EWRA 2OR4A 3IIFA 3KGQA 4X2TA 1CX8A 3EW5A 4IK2A 4YWYA 3SIGA 4ETKA 4FUUA 1SPVA 3KQZA 1TF9A 1YMEA 2ZEGA 3IWWA 3EWPA 1CBXA 3KHZA 4MHPA 2HC9A 4P45A 2OOTA 1HDUA 3FECA 3PB8X 3GPQA 2F7VA 4PXCA 5D8NA 2PIYA 3D67A 1VHUA 4GUAA 4MHNA 4ETJA 3PFEA 2PJ0A 1ELMP 3PB4X 5K8MA 5F09A 4GVWA 3Q71A 1LCPA 1NSAA 2CF4A 4UEZA 6CPAA 3FX6A 4F8ZA 3RBUA 2PIZA 3NH8A 1BPMA 2ACFA 4PPZA 3SIHA 2BCOA 4OP4A 2ZEDA 4F9VA 2PE3A 1VHEA 4GVVA 3SJFA 2ANPA 1YLOA 3B7IA 2BO9A 1VHOA 5HXDA 3BI0A 4Z65A 3H8EA 1TKFA 2PJ3A 5K8PA 2ZEHA 4A94A 3EKEA 4OMEA 3Q6ZA 5LYLA 3N5FA 3GB0A 4IAVA 3FEDA 1XJOA 3DGVA 3HUVA 5LRKA 3PB7X 4P44A 4F9UA 4WWVA 4OIDA 1ZG7A 2GLJA 1UWYA 1YD9A 4P4DA 2Q4ZA 4DUKA 1VGYA 2CIJA 3KR5A 2ZEEA 4PXDA 2PVWA 5THWA 1PYTB 2POKA 4OKOA 4DYOA 4NFRA 1LFWA 4NGTA 3NA6A 1TXRA 5LRJA 1VIXA 4ZY2A 4ZI6A 7CPAA 3QNVA 3GUXA 1HDQA 2C6GA 1LAMA 4R7MA 1AYEA 2JBKA 2PJ9A 3WC6A 4IHMA 4TWEA 3LMSA 2RB7A 4MMOA 2GLFA 3LWUA 1TKJA 4J5QA 3MRUA 3DLJA 1EE3P 5HVHA 1R3NA 5JGFA 4ZX9A 2DEAA 3VATA 4TU0A 4NJRA 4CPAA 1PCAA 2NSMA 5FSZA 3S9LA 3IJ3A 1NJRA 3KI9A 2C6PA 2ZEMA 1R43A 2PJ8A 3SI2A 3SIIA 5E3BA 5D29A 3PBEA 3V2BA 1YW6A 4B6ZA 1F2PA 3V45A 1M4LA 5I4MA 3H8FA 2QYVA 3EWOA 3KR4A 4D86A 4NGRA 1TY8A 5IB9A 4YU9A 2JEWA 4PQAA 4JLLA 3TX8A 4DJLA 2IJZA 2AFXA 3FJUA 2WZNA 3S9NA 5FSUA 1LANA 3SIJA 1JQGA 2EEEA 4IQYA 4BD9A 1KWMA 1TXZA 3IFEA 1CPXA 2ABZA 3KQXA 1DTDA 4UIBA 2GU2A 2LGRA 5LYDA 3H8GA 1BAVA 1F2OA 1XFOA 3VFQA 4LQGA 1ZLIA 4ABKA 3SI1A 1IGBA 3ETIA 3KZWA
chains in the Genus database with same CATH superfamily
3FMCA 5DWMA 3B3TA 5KTAA 4MY0A 4AXVA 5K8OA 2CTCA 1IOIA 2EWBA 2CNTA 5AG6A 2JLMA 4KVME 2WUUA 3GYAA 2ZW6A 4GXHA 4PXEA 4A37A 1N71A 2G9DA 3RYOA 2PR1A 5JM6A 2ZW4A 1Z5RA 3C26A 4H2KA 2WYRA 2X47A 2V8DA 3QB8A 3W91A 4B5PA 2PJ1A 4NJQA 2WSAA 1ZLHA 2AE6A 2H5MA 3WC5A 2PDOA 3VH9A 5CB5A 2BL1A 4UEEA 5EMIA 1Z8XA 4ZBGA 5G1ZA 4A38A 2I00A 2XEIA 4JCAA 3FYNA 1KZFA 1B6BA 1P0HA 3D7GA 2PC1A 1ZG9A 5LRGA 2ZOFA 3F8KA 2B58A 4JXRA 3CXPA 2O53A 2PJBA 4CYOA 5J1QA 2BFRA 2Z0ZA 4ONWA 4R6TA 4JJXA 3MN8A 3NE7A 3V38A 1AMPA 4Q7AA 5FSYA 5K8NA 3CDXA 3PBBA 1BPNA 2CNSA 4M6HA 1H8LA 4YGOA 1HEEA 4JGKA 1MK4A 1QMUA 4A32A 2QMLA 2F5IA 3S6KA 4F6AA 1M4DA 1IY7A 4ABLA 1TKHA 3P2HA 4NCZA 1IIDA 4P4IA 5EBVA 4MHYA 4R3KA 5G20A 5CMSA 4JVVA 4FD7A 2VXKA 5E96A 4MCPA 4OC1A 5IX3A 4NEXA 2FSRA 4AVAA 1U6MA 1CP6A 1IOFA 1YVKA 5CB3A 3CPAA 2NMTA 1OBRA 2B5GB 2PJCA 4MHZA 1Y9KA 1IB1E 4II9A 4OAEA 4XNHC 4UEFA 2P6EA 4AG7A 4A33A 3ISZA 2VEZA 2OU2A 5HOLA 2QVPA 1TF8A 2C1CA 1WK4A 1LAPA 3PEIA 4CAWA 3EXNA 4BBHA 8CPAA 1YR0A 1KUXA 2XEGA 3EY5A 3RAMA 4KOXA 3B2YA 2FL4A 4MI4A 2ZOGA 2GIVA 3CT9A 2VI7A 3NH4A 2YNCC 2FAVA 3JVNA 3GQEA 4OIWA 1CPSA 3TFYA 2OB0A 4F0XA 4PK3A 4B12A 3RZAA 4KOTA 3JRUA 4R76A 5HIHA 4JZ0A 3NH5A 4MCRA 4E0AA 1ZR3A 3CZXA 4KS9A 2EBJA 4MXUA 4NGSA 1FT7A 1BLLE 3B3CA 5KTDA 4B14A 1YQEA 1TIQA 3T8WA 4MCSA 2OZGA 2ZW5A 3PGPA 4KOSA 4OC3A 4ESSA 3R95A 2PCUA 1FNOA 2PJAA 3LACA 3PB9X 2WPWA 3D2MA 4R57A 4UWIA 3B3WA 2PJ4A 3N7ZA 4MFKA 2Z10A 1DE4C 2JZDA 1M4IA 3WT4A 2PRQA 4MFLA 2VQYA 4P10A 4W9YA 4C7HA 4UF4A 3D4UA 1QSTA 4RI1A 2XEJA 3PFOA 1Z8LA 2REEA 2Q43A 4NGMA 4TNUA 3L2NA 3GLJA 1ON0A 1ZO0A 4J5RA 1Y7EA 1XOVA 2B4DA 1P4NA 3K2KA 3KASA 4HNWB 4MRIA 4U5YA 5G22A 2XEFA 3GQOA 1K4JA 2PSWA 2VZYA 4PV6A 2JZFA 3D3SA 1YW4A 2AFOA 4HPSA 4WJBA 3FVLA 1ZG8A 2CXAA 4YRHA 5DUSA 2VBQA 2AFSA 2ODFA 4Q36A 2PJ5A 5LYFA 4NXYA 4KVOE 4PK2A 4ZY0A 3R9FA 5C82A 4KORA 2AFWA 2Q4VA 4A2ZA 4J4ZA 2YNCA 4CGOA 5J8FA 4OC5A 2YNEA 4A30A 4C2ZA 1Y7RA 2PVVA 1I12A 4XPDB 1HJZA 1IICA 2ZEOA 1Z4RA 3B3VA 4OC0A 4ONUA 4P6YA 2P6GA 2V8GA 4P4BA 3IO1A 3S6FA 2AFMA 5F47A 5HVGA 4KZTA 2PRBA 4B5OA 4O23A 3RNZA 3IC1A 3FF3A 4UMLA 2V8VA 4NGPA 4P4FA 3S6HA 4G1PA 2R98A 3T90A 2C6CA 3EFAA 4J3GA 4J5SA 4E2AA 2QIRA 1M44A 2DF5A 4KLWA 3ZJ0A 3DDDA 2Q44A 2ZENA 3GPOA 1Y0RA 4RUHA 1UFHA 2F8HA 3IIDA 4HNYB 4FD5A 2O4HA 1ELLP 2FVGA 3D7HA 5AG7A 5DWNA 2BUEA 4P4JA 2JEVA 2Q0YA 2VL1A 3IWGA 4KOYA 4AG9A 3FB3A 2IMOA 2Q51A 1KUYA 2JDDA 2D4PA 2HB6A 5AG4A 3EJGA 2JBJA 1AUGA 3W6SA 2BSWA 4AB7A 3NFZA 1M4GA 3I1UA 3H5ZA 4X3RA 1F57A 1Y0YA 1Z8WA 3IU2A 4MFPA 3IIBA 3LD2A 3V7ZA 3D68A 1CP7A 3WC7A 1XMBA 3CXSA 4KSIA 4K0CA 4GM5A 2IQ6A 4NGQA 3T9YA 4MCQA 1ARLA 2ZEFA 4BMHA 1ARMA 3DSBA 1RO5A 4M3SA 4R8FA 2PQ8A 2RFHA 3D7FA 3OWCA 2Q4YA 2V8HA 4C2YA 4CAVA 2V77A 4MY3A 3BXMA 4Q38A 1ZR5A 2PJ2A 3D7DA 4KUAA 2FXFA 5JH9A 3KHXA 4K3NA 1GHEA 5LYIA 1BO4A 4EWTA 1J4JA 1IYLA 2AFUA 2AFZA 4KOUA 5HVFA 3K9TA 4FWUA 5AILA 1MJ9A 5CPAA 1Q7LA 3BLNA 2Z3KA 4FD6A 4OC4A 3SJXA 4A31A 2Q7BA 3TOAA 2FXKA 2EUIA 3CPXA 3V8IA 1CM0A 1XIXA 5F48A 2HQYA 4UIAA 5ELYA 3I9SA 4A39A 2DX6A 2J9AA 2EK9A 3GIUA 3SJGA 2NYQA 2GREA 2I3CA 2R8VA 5DS0A 5KTCA 3ISXA 4U9YA 1VHSA 2QJ8A 3PRTA 4UCPA 1XRYA 2CTBA 2AFCA 2DPTA 3GPGA 2FT0A 4CAXA 1XBUA 4FAIA 2PJ7A 3BHXA 1Q2DA 2XD7A 4OC2A 3B35A 4UA3A 4MJ8A 2Z3NA 1RTQA 1Y9WA 2OZUA 2ZELA 4MFZA 1S7KA 2BEIA 4NGNA 3SI0A 2ATRA 4P4EA 4DNCA 2ZEPA 2K5TA 4ZY1A 5FSXA 3FH4A 1S7LA 3PB6X 4PXBA 3SJEA 4ZX8A 3HLPA 3TO6A 1MJAA 1OZPA 3TOBA 1V0CA 1Z8TA 1IYKA 3VARA 1Z2LA 3BI1A 3R9EA 4ZYQA 4KOVA 3KL9A 1MJBA 4PSXA 1LOKA 1IU8A 2YGWA 2Z3LA 3S9MA 4E8OA 3JZTA 4CGNA 1QSNA 4EFDA 1YSJA 2PJ6A 4KYBA 3WABA 2VZZA 2VRIA 3B3SA 3FEEA 4R9MA 3EJFA 3EWQA 2J8NA 3D8PA 4CS0B 4FBEA 2C27A 1CJWA 3TC8A 4EVYA 1YK3A 1GYTA 1X10A 2Z3OA 3VWDA 3GY9A 3SXOA 2EK8A 2X7BA 4EMEA 5HMNA 2L8RA 2BFQA 5FSVA 2BOAA 3IEHA 3D66A 1QQ9A 4JYWA 5CNPA 2WCTA 4M6GA 5ISVA 5CBMA 1CG2A 3QAYA 4X8IA 3P2FA 2FIAA 2FG1A 3EWRA 4L8AA 4QBJA 1XEBA 2B5GA 3IIFA 2OR4A 3KGQA 4X2TA 3LODA 1CX8A 1FY7A 2RNKA 3EW5A 4IK2A 4UWJA 4YWYA 3SIGA 2FS5A 3TO9A 4ETKA 4FUUA 1PUAA 1SPVA 3KQZA 1TF9A 1S7NA 1YMEA 4YFJA 2GANA 4A95A 1A2ZA 4QB9A 2ZEGA 3IWWA 3EWPA 1CBXA 3KHZA 4M85A 4MHPA 2HC9A 4P45A 4RS2A 4XPKA 2OOTA 1HDUA 1YVOA 3FECA 4B5PB 3RO0A 3PB8X 2P0WA 3GPQA 3DR6A 2F7VA 4LX9A 4PXCA 3VWEA 5D8NA 5F49A 2PIYA 3EO4A 3D67A 1VHUA 4GUAA 4R87A 5IB0A 1NSLA 4MHNA 1S60A 3H4QA 3ZZIA 4ETJA 2HUZA 3WR7A 3PFEA 4X5KA 4Y49C 4C2XA 2PJ0A 4CRZB 1ELMP 3G3SA 1WWZA 3PB4X 4LUAA 1Z9UA 4AVBA 5K8MA 2KCWA 5F09A 4GVWA 5I0CA 4CRYB 3TE4A 3Q71A 1LCPA 1NSAA 2CF4A 3FIXA 4UEZA 6CPAA 4GS4A 3FX6A 1YX0A 3TO7A 3TT2A 4H6UA 2Q04A 4JXQA 3FNCA 3F5BA 4F8ZA 5FVJA 3RBUA 2PIZA 2GFQA 3NH8A 1BPMA 4MFJA 5H84A 2EO8A 5IV0A 2ACFA 4BINA 4PPZA 3DNSA 3SIHA 3GKRA 2BCOA 2DXQA 4IUSA 4OP4A 5A27A 2J8MA 2EVNA 4FD4A 3SXNA 2P6FA 2ZEDA 4F9VA 2PE3A 3DR8A 1VHEA 4HKFA 2J8RA 4GVVA 2OZHA 3SJFA 2ANPA 5BWAB 1YLOA 2WPXA 2Z3PA 3B7IA 2BO9A 3MGDA 4KSFA 3B8GA 3G8WA 5AGEA 1I21A 1VHOA 3SHPA 5HXDA 3BI0A 4QUSA 3EC4A 3W6XA 4K30A 4Z65A 3H8EA 1TKFA 2PJ3A 4B13A 1Z4EA 5K8PA 2ZEHA 1QSRA 2G3AA 2CY2A 2RC4A 2Y0MA 2R7HA 4IF5A 4A94A 1B87A 3JTKA 3EKEA 4OMEA 3Q6ZA 5LYLA 3IWEA 3N5FA 3GB0A 3IU1A 1NE9A 1XJOA 1L0CA 3DGVA 3FEDA 3HUVA 4IAVA 1QSMA 5LRKA 4KOWA 3PB7X 4P44A 4F9UA 4WWVA 4OIDA 5JPHA 1ZG7A 2CNMA 4UFVA 2GLJA 1UWYA 5AG5A 1YD9A 3FXTA 2W2GA 2B3UA 4P4DA 2Q4ZA 4C7IA 3K9UA 4DUKA 1VGYA 2CIJA 5HH1A 1Q2YA 2B3VA 3TTHA 3KR5A 3PP9A 4B10A 1M1DA 2ZEEA 4PXDA 2PVWA 2AJ6A 4UFXA 4RN7A 4QC6A 1PYTB 5THWA 2YNDA 5F46A 2POKA 4OKOA 2A4NA 4NFRA 4DYOA 1LFWA 1S5KA 4NGTA 3NA6A 3E0KA 1TXRA 5LRJA 1VIXA 4ZY2A 4ZI6A 7CPAA 3QNVA 5J8CA 3GUXA 1HDQA 2C6GA 1LAMA 4R7MA 3BJ7A 3CXQA 3FBUA 1AYEA 2ZXVA 2R1IA 2FE7A 4B11A 3R96A 4MBUA 4CYQA 2JBKA 4XNHB 4L89A 4NF1A 2B4DB 2PJ9A 3WC6A 4IHMA 1XF8A 4TWEA 2JDCA 3F0AA 4LQ6A 4KUBA 3LMSA 2RB7A 3TCVA 5C88A 1VKCA 4MMOA 1I1DA 2GLFA 3LWUA 1SQHA 1TKJA 4JLYA 4KSAA 4OLLA 2O28A 3R9GA 4J5QA 3MRUA 1QSOA 1EE3P 2QECA 3DLJA 2GE3A 4UCNA 1S3ZA 2I79A 5HVHA 1R3NA 5JGFA 2FCKA 4MHDA 4OADA 4ZX9A 4CAFA 4HNXB 4CGMA 2D4OA 2DEAA 1JWQA 3VATA 1R57A 4TU0A 4PSWA 4U9ZA 4NJRA 4UFWA 1PCAA 4CPAA 5A28A 4CGPA 4AVCA 2NSMA 5FSZA 3S9LA 1S7FA 3IJ3A 3KKWA 1NJRA 1NMTA 1LRZA 2C6PA 3KI9A 4ORFA 2JZEA 1RXTA 4CYNA 3A9LA 2ZEMA 1R43A 4CAEA 4UCMA 2ARHA 2B4BA 2PJ8A 3FRMA 3SI2A 3SIIA 2ZPAA 2G0BA 5E3BA 4XPLA 4NSQA 4R3LA 5GCNA 5D29A 5EC4A 3PBEA 3V2BA 1YW6A 3D2PA 3R1KA 2DPSA 3I3GA 3NE8A 1YGHA 1XE4A 4B6ZA 1YLEA 1F2PA 2REFA 4JD6A 3QAHA 3V45A 4QVTA 1M4LA 5I4MA 1PU9A 3H8FA 2G3TA 5JQ4A 2FIWA 3UY5A 4JWPA 2QYVA 4I49A 2HV2A 1XMTA 2IL4A 3EWOA 3KR4A 4D86A 2Z11A 3BJ8A 4NGRA 1TY8A 4CGLA 5IB9A 4YU9A 2JEWA 4H89A 4PQAA 4JLLA 4KVXA 1BOBA 4XPDC 5H86A 2PR8A 1X12A 3TX8A 4DJLA 4F0YA 2IJZA 2AFXA 3FJUA 1Q2CA 3IGRA 2WZNA 2Z3MA 3S9NA 4C68A 5FSUA 1LANA 3SIJA 1JQGA 2ZW7A 2OH1A 2EEEA 4IQYA 4M6IA 1YREA 4BD9A 1KWMA 2Q7SA 3PZJA 1TXZA 4UBRA 4KLVA 3IFEA 1CPXA 3S6GA 2ABZA 3KQXA 4MFQA 1DTDA 4UIBA 2GU2A 4Y49B 2LGRA 4H6ZA 5LYDA 3H8GA 1KUVA 4CYPA 4ZGYB 1BAVA 1F2OA 1XFOA 3VFQA 4LQGA 1ZLIA 3JUWA 4ABKA 3SI1A 2KQVA 1IGBA 3ETIA 5G21A 3KZWA
chains in the Genus database with same CATH topology
3FMCA 3B3TA 5K8OA 4AXVA 2CTCA 2EWBA 4PXEA 4A37A 2G9DA 5JM6A 1Z5RA 4H2KA 2WYRA 2X47A 2V8DA 2PJ1A 4NJQA 1ZLHA 3WC5A 3VH9A 5CB5A 4UEEA 4A38A 2XEIA 4JCAA 3D7GA 1ZG9A 5LRGA 2ZOFA 2O53A 2PJBA 5J1QA 2BFRA 4ONWA 4R6TA 3V38A 3MN8A 1AMPA 4Q7AA 5FSYA 5K8NA 3CDXA 3PBBA 1BPNA 1H8LA 1HEEA 4JGKA 1QMUA 1IY7A 4ABLA 1TKHA 4P4IA 4MHYA 5CMSA 4JVVA 4MCPA 4OC1A 1CP6A 5CB3A 3CPAA 1OBRA 2PJCA 4MHZA 4UEFA 3ISZA 5HOLA 2QVPA 1TF8A 2C1CA 1LAPA 3PEIA 8CPAA 2XEGA 3RAMA 3B2YA 2ZOGA 3CT9A 3NH4A 2FAVA 3GQEA 4OIWA 1CPSA 3RZAA 3JRUA 4R76A 5HIHA 4JZ0A 3NH5A 4MCRA 1ZR3A 4MXUA 4NGSA 1FT7A 1BLLE 3B3CA 4MCSA 3T8WA 4OC3A 4ESSA 2PCUA 1FNOA 2PJAA 3PB9X 3B3WA 2PJ4A 1DE4C 3WT4A 2PRQA 4P10A 4W9YA 4UF4A 3D4UA 2XEJA 3PFOA 1Z8LA 4TNUA 2Q43A 4NGMA 3L2NA 3GLJA 4J5RA 1Y7EA 3K2KA 3KASA 4MRIA 2XEFA 3GQOA 1YW4A 2AFOA 4WJBA 3FVLA 1ZG8A 5DUSA 2AFSA 5LYFA 2PJ5A 4ZY0A 2AFWA 4J4ZA 4OC5A 2PVVA 1HJZA 2ZEOA 3B3VA 4OC0A 4P6YA 2V8GA 4P4BA 3IO1A 2AFMA 5HVGA 4O23A 3IC1A 3FF3A 4UMLA 2V8VA 4NGPA 4P4FA 4G1PA 2C6CA 4J5SA 2ZENA 3GPOA 1Y0RA 4RUHA 2F8HA 3IIDA 2O4HA 1ELLP 2FVGA 3D7HA 4P4JA 2VL1A 2IMOA 2Q51A 2HB6A 3EJGA 2JBJA 3NFZA 3I1UA 4X3RA 1F57A 1Y0YA 3IIBA 3V7ZA 3D68A 1CP7A 3WC7A 1XMBA 4KSIA 4K0CA 4GM5A 2IQ6A 4NGQA 4MCQA 1ARLA 2ZEFA 1ARMA 4R8FA 3D7FA 2RFHA 2V8HA 2V77A 3BXMA 1ZR5A 2PJ2A 3D7DA 5JH9A 3KHXA 4K3NA 5LYIA 4EWTA 2AFUA 2AFZA 5HVFA 3K9TA 4FWUA 5AILA 5CPAA 1Q7LA 4OC4A 3SJXA 2FXKA 3CPXA 4UIAA 5ELYA 4A39A 2DX6A 2J9AA 2EK9A 3SJGA 2NYQA 2GREA 2I3CA 5DS0A 3ISXA 2QJ8A 3PRTA 1XRYA 2CTBA 2AFCA 3GPGA 4FAIA 1XBUA 2PJ7A 3BHXA 2XD7A 4OC2A 3B35A 1RTQA 2ZELA 3SI0A 4NGNA 4P4EA 2ZEPA 4ZY1A 5FSXA 3FH4A 3PB6X 4PXBA 3SJEA 4ZX8A 3HLPA 3VARA 1Z2LA 3BI1A 4ZYQA 3KL9A 1LOKA 3S9MA 3JZTA 4EFDA 1YSJA 2PJ6A 4KYBA 3WABA 2VRIA 3B3SA 3FEEA 3EJFA 3EWQA 4FBEA 3TC8A 1GYTA 2EK8A 4EMEA 2L8RA 2BFQA 5FSVA 2BOAA 3IEHA 3D66A 1QQ9A 4JYWA 5CBMA 1CG2A 4X8IA 2FG1A 3EWRA 2OR4A 3IIFA 3KGQA 4X2TA 1CX8A 3EW5A 4IK2A 4YWYA 3SIGA 4ETKA 4FUUA 1SPVA 3KQZA 1TF9A 1YMEA 2ZEGA 3IWWA 3EWPA 1CBXA 3KHZA 4MHPA 2HC9A 4P45A 2OOTA 1HDUA 3FECA 3PB8X 3GPQA 2F7VA 4PXCA 5D8NA 2PIYA 3D67A 1VHUA 4GUAA 4MHNA 4ETJA 3PFEA 2PJ0A 1ELMP 3PB4X 5K8MA 5F09A 4GVWA 3Q71A 1LCPA 1NSAA 2CF4A 4UEZA 6CPAA 3FX6A 4F8ZA 3RBUA 2PIZA 3NH8A 1BPMA 2ACFA 4PPZA 3SIHA 2BCOA 4OP4A 2ZEDA 4F9VA 2PE3A 1VHEA 4GVVA 3SJFA 2ANPA 1YLOA 3B7IA 2BO9A 1VHOA 5HXDA 3BI0A 4Z65A 3H8EA 1TKFA 2PJ3A 5K8PA 2ZEHA 4A94A 3EKEA 4OMEA 3Q6ZA 5LYLA 3N5FA 3GB0A 4IAVA 3FEDA 1XJOA 3DGVA 3HUVA 5LRKA 3PB7X 4P44A 4F9UA 4WWVA 4OIDA 1ZG7A 2GLJA 1UWYA 1YD9A 4P4DA 2Q4ZA 4DUKA 1VGYA 2CIJA 3KR5A 2ZEEA 4PXDA 2PVWA 5THWA 1PYTB 2POKA 4OKOA 4DYOA 4NFRA 1LFWA 4NGTA 3NA6A 1TXRA 5LRJA 1VIXA 4ZY2A 4ZI6A 7CPAA 3QNVA 3GUXA 1HDQA 2C6GA 1LAMA 4R7MA 1AYEA 2JBKA 2PJ9A 3WC6A 4IHMA 4TWEA 3LMSA 2RB7A 4MMOA 2GLFA 3LWUA 1TKJA 4J5QA 3MRUA 3DLJA 1EE3P 5HVHA 1R3NA 5JGFA 4ZX9A 2DEAA 3VATA 4TU0A 4NJRA 4CPAA 1PCAA 2NSMA 5FSZA 3S9LA 3IJ3A 1NJRA 3KI9A 2C6PA 2ZEMA 1R43A 2PJ8A 3SI2A 3SIIA 5E3BA 5D29A 3PBEA 3V2BA 1YW6A 4B6ZA 1F2PA 3V45A 1M4LA 5I4MA 3H8FA 2QYVA 3EWOA 3KR4A 4D86A 4NGRA 1TY8A 5IB9A 4YU9A 2JEWA 4PQAA 4JLLA 3TX8A 4DJLA 2IJZA 2AFXA 3FJUA 2WZNA 3S9NA 5FSUA 1LANA 3SIJA 1JQGA 2EEEA 4IQYA 4BD9A 1KWMA 1TXZA 3IFEA 1CPXA 2ABZA 3KQXA 1DTDA 4UIBA 2GU2A 2LGRA 5LYDA 3H8GA 1BAVA 1F2OA 1XFOA 3VFQA 4LQGA 1ZLIA 4ABKA 3SI1A 1IGBA 3ETIA 3KZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMC A;  3B3T A;  5K8O A;  4AXV A;  2CTC A;  2EWB A;  4PXE A;  4A37 A;  2G9D A;  5JM6 A;  1Z5R A;  4H2K A;  2WYR A;  2X47 A;  2V8D A;  2PJ1 A;  4NJQ A;  1ZLH A;  3WC5 A;  3VH9 A;  5CB5 A;  4UEE A;  4A38 A;  2XEI A;  4JCA A;  3D7G A;  1ZG9 A;  5LRG A;  2ZOF A;  2O53 A;  2PJB A;  5J1Q A;  2BFR A;  4ONW A;  4R6T A;  3V38 A;  3MN8 A;  1AMP A;  4Q7A A;  5FSY A;  5K8N A;  3CDX A;  3PBB A;  1BPN A;  1H8L A;  1HEE A;  4JGK A;  1QMU A;  1IY7 A;  4ABL A;  1TKH A;  4P4I A;  4MHY A;  5CMS A;  4JVV A;  4MCP A;  4OC1 A;  1CP6 A;  5CB3 A;  3CPA A;  1OBR A;  2PJC A;  4MHZ A;  4UEF A;  3ISZ A;  5HOL A;  2QVP A;  1TF8 A;  2C1C A;  1LAP A;  3PEI A;  8CPA A;  2XEG A;  3RAM A;  3B2Y A;  2ZOG A;  3CT9 A;  3NH4 A;  2FAV A;  3GQE A;  4OIW A;  1CPS A;  3RZA A;  3JRU A;  4R76 A;  5HIH A;  4JZ0 A;  3NH5 A;  4MCR A;  1ZR3 A;  4MXU A;  4NGS A;  1FT7 A;  1BLL E;  3B3C A;  4MCS A;  3T8W A;  4OC3 A;  4ESS A;  2PCU A;  1FNO A;  2PJA A;  3PB9 X;  3B3W A;  2PJ4 A;  1DE4 C;  3WT4 A;  2PRQ A;  4P10 A;  4W9Y A;  4UF4 A;  3D4U A;  2XEJ A;  3PFO A;  1Z8L A;  4TNU A;  2Q43 A;  4NGM A;  3L2N A;  3GLJ A;  4J5R A;  1Y7E A;  3K2K A;  3KAS A;  4MRI A;  2XEF A;  3GQO A;  1YW4 A;  2AFO A;  4WJB A;  3FVL A;  1ZG8 A;  5DUS A;  2AFS A;  5LYF A;  2PJ5 A;  4ZY0 A;  2AFW A;  4J4Z A;  4OC5 A;  2PVV A;  1HJZ A;  2ZEO A;  3B3V A;  4OC0 A;  4P6Y A;  2V8G A;  4P4B A;  3IO1 A;  2AFM A;  5HVG A;  4O23 A;  3IC1 A;  3FF3 A;  4UML A;  2V8V A;  4NGP A;  4P4F A;  4G1P A;  2C6C A;  4J5S A;  2ZEN A;  3GPO A;  1Y0R A;  4RUH A;  2F8H A;  3IID A;  2O4H A;  1ELL P;  2FVG A;  3D7H A;  4P4J A;  2VL1 A;  2IMO A;  2Q51 A;  2HB6 A;  3EJG A;  2JBJ A;  3NFZ A;  3I1U A;  4X3R A;  1F57 A;  1Y0Y A;  3IIB A;  3V7Z A;  3D68 A;  1CP7 A;  3WC7 A;  1XMB A;  4KSI A;  4K0C A;  4GM5 A;  2IQ6 A;  4NGQ A;  4MCQ A;  1ARL A;  2ZEF A;  1ARM A;  4R8F A;  3D7F A;  2RFH A;  2V8H A;  2V77 A;  3BXM A;  1ZR5 A;  2PJ2 A;  3D7D A;  5JH9 A;  3KHX A;  4K3N A;  5LYI A;  4EWT A;  2AFU A;  2AFZ A;  5HVF A;  3K9T A;  4FWU A;  5AIL A;  5CPA A;  1Q7L A;  4OC4 A;  3SJX A;  2FXK A;  3CPX A;  4UIA A;  5ELY A;  4A39 A;  2DX6 A;  2J9A A;  2EK9 A;  3SJG A;  2NYQ A;  2GRE A;  2I3C A;  5DS0 A;  3ISX A;  2QJ8 A;  3PRT A;  1XRY A;  2CTB A;  2AFC A;  3GPG A;  4FAI A;  1XBU A;  2PJ7 A;  3BHX A;  2XD7 A;  4OC2 A;  3B35 A;  1RTQ A;  2ZEL A;  3SI0 A;  4NGN A;  4P4E A;  2ZEP A;  4ZY1 A;  5FSX A;  3FH4 A;  3PB6 X;  4PXB A;  3SJE A;  4ZX8 A;  3HLP A;  3VAR A;  1Z2L A;  3BI1 A;  4ZYQ A;  3KL9 A;  1LOK A;  3S9M A;  3JZT A;  4EFD A;  1YSJ A;  2PJ6 A;  4KYB A;  3WAB A;  2VRI A;  3B3S A;  3FEE A;  3EJF A;  3EWQ A;  4FBE A;  3TC8 A;  1GYT A;  2EK8 A;  4EME A;  2L8R A;  2BFQ A;  5FSV A;  2BOA A;  3IEH A;  3D66 A;  1QQ9 A;  4JYW A;  5CBM A;  1CG2 A;  4X8I A;  2FG1 A;  3EWR A;  2OR4 A;  3IIF A;  3KGQ A;  4X2T A;  1CX8 A;  3EW5 A;  4IK2 A;  4YWY A;  3SIG A;  4ETK A;  4FUU A;  1SPV A;  3KQZ A;  1TF9 A;  1YME A;  2ZEG A;  3IWW A;  3EWP A;  1CBX A;  3KHZ A;  4MHP A;  2HC9 A;  4P45 A;  2OOT A;  1HDU A;  3FEC A;  3PB8 X;  3GPQ A;  2F7V A;  4PXC A;  5D8N A;  2PIY A;  3D67 A;  1VHU A;  4GUA A;  4MHN A;  4ETJ A;  3PFE A;  2PJ0 A;  1ELM P;  3PB4 X;  5K8M A;  5F09 A;  4GVW A;  3Q71 A;  1LCP A;  1NSA A;  2CF4 A;  4UEZ A;  6CPA A;  3FX6 A;  4F8Z A;  3RBU A;  2PIZ A;  3NH8 A;  1BPM A;  2ACF A;  4PPZ A;  3SIH A;  2BCO A;  4OP4 A;  2ZED A;  4F9V A;  2PE3 A;  1VHE A;  4GVV A;  3SJF A;  2ANP A;  1YLO A;  3B7I A;  2BO9 A;  1VHO A;  5HXD A;  3BI0 A;  4Z65 A;  3H8E A;  1TKF A;  2PJ3 A;  5K8P A;  2ZEH A;  4A94 A;  3EKE A;  4OME A;  3Q6Z A;  5LYL A;  3N5F A;  3GB0 A;  4IAV A;  3FED A;  1XJO A;  3DGV A;  3HUV A;  5LRK A;  3PB7 X;  4P44 A;  4F9U A;  4WWV A;  4OID A;  1ZG7 A;  2GLJ A;  1UWY A;  1YD9 A;  4P4D A;  2Q4Z A;  4DUK A;  1VGY A;  2CIJ A;  3KR5 A;  2ZEE A;  4PXD A;  2PVW A;  5THW A;  1PYT B;  2POK A;  4OKO A;  4DYO A;  4NFR A;  1LFW A;  4NGT A;  3NA6 A;  1TXR A;  5LRJ A;  1VIX A;  4ZY2 A;  4ZI6 A;  7CPA A;  3QNV A;  3GUX A;  1HDQ A;  2C6G A;  1LAM A;  4R7M A;  1AYE A;  2JBK A;  2PJ9 A;  3WC6 A;  4IHM A;  4TWE A;  3LMS A;  2RB7 A;  4MMO A;  2GLF A;  3LWU A;  1TKJ A;  4J5Q A;  3MRU A;  3DLJ A;  1EE3 P;  5HVH A;  1R3N A;  5JGF A;  4ZX9 A;  2DEA A;  3VAT A;  4TU0 A;  4NJR A;  4CPA A;  1PCA A;  2NSM A;  5FSZ A;  3S9L A;  3IJ3 A;  1NJR A;  3KI9 A;  2C6P A;  2ZEM A;  1R43 A;  2PJ8 A;  3SI2 A;  3SII A;  5E3B A;  5D29 A;  3PBE A;  3V2B A;  1YW6 A;  4B6Z A;  1F2P A;  3V45 A;  1M4L A;  5I4M A;  3H8F A;  2QYV A;  3EWO A;  3KR4 A;  4D86 A;  4NGR A;  1TY8 A;  5IB9 A;  4YU9 A;  2JEW A;  4PQA A;  4JLL A;  3TX8 A;  4DJL A;  2IJZ A;  2AFX A;  3FJU A;  2WZN A;  3S9N A;  5FSU A;  1LAN A;  3SIJ A;  1JQG A;  2EEE A;  4IQY A;  4BD9 A;  1KWM A;  1TXZ A;  3IFE A;  1CPX A;  2ABZ A;  3KQX A;  1DTD A;  4UIB A;  2GU2 A;  2LGR A;  5LYD A;  3H8G A;  1BAV A;  1F2O A;  1XFO A;  3VFQ A;  4LQG A;  1ZLI A;  4ABK A;  3SI1 A;  1IGB A;  3ETI A;  3KZW A; 
#chains in the Genus database with same CATH topology
 3FMC A;  5DWM A;  3B3T A;  5KTA A;  4MY0 A;  4AXV A;  5K8O A;  2CTC A;  1IOI A;  2EWB A;  2CNT A;  5AG6 A;  2JLM A;  4KVM E;  2WUU A;  3GYA A;  2ZW6 A;  4GXH A;  4PXE A;  4A37 A;  1N71 A;  2G9D A;  3RYO A;  2PR1 A;  5JM6 A;  2ZW4 A;  1Z5R A;  3C26 A;  4H2K A;  2WYR A;  2X47 A;  2V8D A;  3QB8 A;  3W91 A;  4B5P A;  2PJ1 A;  4NJQ A;  2WSA A;  1ZLH A;  2AE6 A;  2H5M A;  3WC5 A;  2PDO A;  3VH9 A;  5CB5 A;  2BL1 A;  4UEE A;  5EMI A;  1Z8X A;  4ZBG A;  5G1Z A;  4A38 A;  2I00 A;  2XEI A;  4JCA A;  3FYN A;  1KZF A;  1B6B A;  1P0H A;  3D7G A;  2PC1 A;  1ZG9 A;  5LRG A;  2ZOF A;  3F8K A;  2B58 A;  4JXR A;  3CXP A;  2O53 A;  2PJB A;  4CYO A;  5J1Q A;  2BFR A;  2Z0Z A;  4ONW A;  4R6T A;  4JJX A;  3MN8 A;  3NE7 A;  3V38 A;  1AMP A;  4Q7A A;  5FSY A;  5K8N A;  3CDX A;  3PBB A;  1BPN A;  2CNS A;  4M6H A;  1H8L A;  4YGO A;  1HEE A;  4JGK A;  1MK4 A;  1QMU A;  4A32 A;  2QML A;  2F5I A;  3S6K A;  4F6A A;  1M4D A;  1IY7 A;  4ABL A;  1TKH A;  3P2H A;  4NCZ A;  1IID A;  4P4I A;  5EBV A;  4MHY A;  4R3K A;  5G20 A;  5CMS A;  4JVV A;  4FD7 A;  2VXK A;  5E96 A;  4MCP A;  4OC1 A;  5IX3 A;  4NEX A;  2FSR A;  4AVA A;  1U6M A;  1CP6 A;  1IOF A;  1YVK A;  5CB3 A;  3CPA A;  2NMT A;  1OBR A;  2B5G B;  2PJC A;  4MHZ A;  1Y9K A;  1IB1 E;  4II9 A;  4OAE A;  4XNH C;  4UEF A;  2P6E A;  4AG7 A;  4A33 A;  3ISZ A;  2VEZ A;  2OU2 A;  5HOL A;  2QVP A;  1TF8 A;  2C1C A;  1WK4 A;  1LAP A;  3PEI A;  4CAW A;  3EXN A;  4BBH A;  8CPA A;  1YR0 A;  1KUX A;  2XEG A;  3EY5 A;  3RAM A;  4KOX A;  3B2Y A;  2FL4 A;  4MI4 A;  2ZOG A;  2GIV A;  3CT9 A;  2VI7 A;  3NH4 A;  2YNC C;  2FAV A;  3JVN A;  3GQE A;  4OIW A;  1CPS A;  3TFY A;  2OB0 A;  4F0X A;  4PK3 A;  4B12 A;  3RZA A;  4KOT A;  3JRU A;  4R76 A;  5HIH A;  4JZ0 A;  3NH5 A;  4MCR A;  4E0A A;  1ZR3 A;  3CZX A;  4KS9 A;  2EBJ A;  4MXU A;  4NGS A;  1FT7 A;  1BLL E;  3B3C A;  5KTD A;  4B14 A;  1YQE A;  1TIQ A;  3T8W A;  4MCS A;  2OZG A;  2ZW5 A;  3PGP A;  4KOS A;  4OC3 A;  4ESS A;  3R95 A;  2PCU A;  1FNO A;  2PJA A;  3LAC A;  3PB9 X;  2WPW A;  3D2M A;  4R57 A;  4UWI A;  3B3W A;  2PJ4 A;  3N7Z A;  4MFK A;  2Z10 A;  1DE4 C;  2JZD A;  1M4I A;  3WT4 A;  2PRQ A;  4MFL A;  2VQY A;  4P10 A;  4W9Y A;  4C7H A;  4UF4 A;  3D4U A;  1QST A;  4RI1 A;  2XEJ A;  3PFO A;  1Z8L A;  2REE A;  2Q43 A;  4NGM A;  4TNU A;  3L2N A;  3GLJ A;  1ON0 A;  1ZO0 A;  4J5R A;  1Y7E A;  1XOV A;  2B4D A;  1P4N A;  3K2K A;  3KAS A;  4HNW B;  4MRI A;  4U5Y A;  5G22 A;  2XEF A;  3GQO A;  1K4J A;  2PSW A;  2VZY A;  4PV6 A;  2JZF A;  3D3S A;  1YW4 A;  2AFO A;  4HPS A;  4WJB A;  3FVL A;  1ZG8 A;  2CXA A;  4YRH A;  5DUS A;  2VBQ A;  2AFS A;  2ODF A;  4Q36 A;  2PJ5 A;  5LYF A;  4NXY A;  4KVO E;  4PK2 A;  4ZY0 A;  3R9F A;  5C82 A;  4KOR A;  2AFW A;  2Q4V A;  4A2Z A;  4J4Z A;  2YNC A;  4CGO A;  5J8F A;  4OC5 A;  2YNE A;  4A30 A;  4C2Z A;  1Y7R A;  2PVV A;  1I12 A;  4XPD B;  1HJZ A;  1IIC A;  2ZEO A;  1Z4R A;  3B3V A;  4OC0 A;  4ONU A;  4P6Y A;  2P6G A;  2V8G A;  4P4B A;  3IO1 A;  3S6F A;  2AFM A;  5F47 A;  5HVG A;  4KZT A;  2PRB A;  4B5O A;  4O23 A;  3RNZ A;  3IC1 A;  3FF3 A;  4UML A;  2V8V A;  4NGP A;  4P4F A;  3S6H A;  4G1P A;  2R98 A;  3T90 A;  2C6C A;  3EFA A;  4J3G A;  4J5S A;  4E2A A;  2QIR A;  1M44 A;  2DF5 A;  4KLW A;  3ZJ0 A;  3DDD A;  2Q44 A;  2ZEN A;  3GPO A;  1Y0R A;  4RUH A;  1UFH A;  2F8H A;  3IID A;  4HNY B;  4FD5 A;  2O4H A;  1ELL P;  2FVG A;  3D7H A;  5AG7 A;  5DWN A;  2BUE A;  4P4J A;  2JEV A;  2Q0Y A;  2VL1 A;  3IWG A;  4KOY A;  4AG9 A;  3FB3 A;  2IMO A;  2Q51 A;  1KUY A;  2JDD A;  2D4P A;  2HB6 A;  5AG4 A;  3EJG A;  2JBJ A;  1AUG A;  3W6S A;  2BSW A;  4AB7 A;  3NFZ A;  1M4G A;  3I1U A;  3H5Z A;  4X3R A;  1F57 A;  1Y0Y A;  1Z8W A;  3IU2 A;  4MFP A;  3IIB A;  3LD2 A;  3V7Z A;  3D68 A;  1CP7 A;  3WC7 A;  1XMB A;  3CXS A;  4KSI A;  4K0C A;  4GM5 A;  2IQ6 A;  4NGQ A;  3T9Y A;  4MCQ A;  1ARL A;  2ZEF A;  4BMH A;  1ARM A;  3DSB A;  1RO5 A;  4M3S A;  4R8F A;  2PQ8 A;  2RFH A;  3D7F A;  3OWC A;  2Q4Y A;  2V8H A;  4C2Y A;  4CAV A;  2V77 A;  4MY3 A;  3BXM A;  4Q38 A;  1ZR5 A;  2PJ2 A;  3D7D A;  4KUA A;  2FXF A;  5JH9 A;  3KHX A;  4K3N A;  1GHE A;  5LYI A;  1BO4 A;  4EWT A;  1J4J A;  1IYL A;  2AFU A;  2AFZ A;  4KOU A;  5HVF A;  3K9T A;  4FWU A;  5AIL A;  1MJ9 A;  5CPA A;  1Q7L A;  3BLN A;  2Z3K A;  4FD6 A;  4OC4 A;  3SJX A;  4A31 A;  2Q7B A;  3TOA A;  2FXK A;  2EUI A;  3CPX A;  3V8I A;  1CM0 A;  1XIX A;  5F48 A;  2HQY A;  4UIA A;  5ELY A;  3I9S A;  4A39 A;  2DX6 A;  2J9A A;  2EK9 A;  3GIU A;  3SJG A;  2NYQ A;  2GRE A;  2I3C A;  2R8V A;  5DS0 A;  5KTC A;  3ISX A;  4U9Y A;  1VHS A;  2QJ8 A;  3PRT A;  4UCP A;  1XRY A;  2CTB A;  2AFC A;  2DPT A;  3GPG A;  2FT0 A;  4CAX A;  1XBU A;  4FAI A;  2PJ7 A;  3BHX A;  1Q2D A;  2XD7 A;  4OC2 A;  3B35 A;  4UA3 A;  4MJ8 A;  2Z3N A;  1RTQ A;  1Y9W A;  2OZU A;  2ZEL A;  4MFZ A;  1S7K A;  2BEI A;  4NGN A;  3SI0 A;  2ATR A;  4P4E A;  4DNC A;  2ZEP A;  2K5T A;  4ZY1 A;  5FSX A;  3FH4 A;  1S7L A;  3PB6 X;  4PXB A;  3SJE A;  4ZX8 A;  3HLP A;  3TO6 A;  1MJA A;  1OZP A;  3TOB A;  1V0C A;  1Z8T A;  1IYK A;  3VAR A;  1Z2L A;  3BI1 A;  3R9E A;  4ZYQ A;  4KOV A;  3KL9 A;  1MJB A;  4PSX A;  1LOK A;  1IU8 A;  2YGW A;  2Z3L A;  3S9M A;  4E8O A;  3JZT A;  4CGN A;  1QSN A;  4EFD A;  1YSJ A;  2PJ6 A;  4KYB A;  3WAB A;  2VZZ A;  2VRI A;  3B3S A;  3FEE A;  4R9M A;  3EJF A;  3EWQ A;  2J8N A;  3D8P A;  4CS0 B;  4FBE A;  2C27 A;  1CJW A;  3TC8 A;  4EVY A;  1YK3 A;  1GYT A;  1X10 A;  2Z3O A;  3VWD A;  3GY9 A;  3SXO A;  2EK8 A;  2X7B A;  4EME A;  5HMN A;  2L8R A;  2BFQ A;  5FSV A;  2BOA A;  3IEH A;  3D66 A;  1QQ9 A;  4JYW A;  5CNP A;  2WCT A;  4M6G A;  5ISV A;  5CBM A;  1CG2 A;  3QAY A;  4X8I A;  3P2F A;  2FIA A;  2FG1 A;  3EWR A;  4L8A A;  4QBJ A;  1XEB A;  2B5G A;  3IIF A;  2OR4 A;  3KGQ A;  4X2T A;  3LOD A;  1CX8 A;  1FY7 A;  2RNK A;  3EW5 A;  4IK2 A;  4UWJ A;  4YWY A;  3SIG A;  2FS5 A;  3TO9 A;  4ETK A;  4FUU A;  1PUA A;  1SPV A;  3KQZ A;  1TF9 A;  1S7N A;  1YME A;  4YFJ A;  2GAN A;  4A95 A;  1A2Z A;  4QB9 A;  2ZEG A;  3IWW A;  3EWP A;  1CBX A;  3KHZ A;  4M85 A;  4MHP A;  2HC9 A;  4P45 A;  4RS2 A;  4XPK A;  2OOT A;  1HDU A;  1YVO A;  3FEC A;  4B5P B;  3RO0 A;  3PB8 X;  2P0W A;  3GPQ A;  3DR6 A;  2F7V A;  4LX9 A;  4PXC A;  3VWE A;  5D8N A;  5F49 A;  2PIY A;  3EO4 A;  3D67 A;  1VHU A;  4GUA A;  4R87 A;  5IB0 A;  1NSL A;  4MHN A;  1S60 A;  3H4Q A;  3ZZI A;  4ETJ A;  2HUZ A;  3WR7 A;  3PFE A;  4X5K A;  4Y49 C;  4C2X A;  2PJ0 A;  4CRZ B;  1ELM P;  3G3S A;  1WWZ A;  3PB4 X;  4LUA A;  1Z9U A;  4AVB A;  5K8M A;  2KCW A;  5F09 A;  4GVW A;  5I0C A;  4CRY B;  3TE4 A;  3Q71 A;  1LCP A;  1NSA A;  2CF4 A;  3FIX A;  4UEZ A;  6CPA A;  4GS4 A;  3FX6 A;  1YX0 A;  3TO7 A;  3TT2 A;  4H6U A;  2Q04 A;  4JXQ A;  3FNC A;  3F5B A;  4F8Z A;  5FVJ A;  3RBU A;  2PIZ A;  2GFQ A;  3NH8 A;  1BPM A;  4MFJ A;  5H84 A;  2EO8 A;  5IV0 A;  2ACF A;  4BIN A;  4PPZ A;  3DNS A;  3SIH A;  3GKR A;  2BCO A;  2DXQ A;  4IUS A;  4OP4 A;  5A27 A;  2J8M A;  2EVN A;  4FD4 A;  3SXN A;  2P6F A;  2ZED A;  4F9V A;  2PE3 A;  3DR8 A;  1VHE A;  4HKF A;  2J8R A;  4GVV A;  2OZH A;  3SJF A;  2ANP A;  5BWA B;  1YLO A;  2WPX A;  2Z3P A;  3B7I A;  2BO9 A;  3MGD A;  4KSF A;  3B8G A;  3G8W A;  5AGE A;  1I21 A;  1VHO A;  3SHP A;  5HXD A;  3BI0 A;  4QUS A;  3EC4 A;  3W6X A;  4K30 A;  4Z65 A;  3H8E A;  1TKF A;  2PJ3 A;  4B13 A;  1Z4E A;  5K8P A;  2ZEH A;  1QSR A;  2G3A A;  2CY2 A;  2RC4 A;  2Y0M A;  2R7H A;  4IF5 A;  4A94 A;  1B87 A;  3JTK A;  3EKE A;  4OME A;  3Q6Z A;  5LYL A;  3IWE A;  3N5F A;  3GB0 A;  3IU1 A;  1NE9 A;  1XJO A;  1L0C A;  3DGV A;  3FED A;  3HUV A;  4IAV A;  1QSM A;  5LRK A;  4KOW A;  3PB7 X;  4P44 A;  4F9U A;  4WWV A;  4OID A;  5JPH A;  1ZG7 A;  2CNM A;  4UFV A;  2GLJ A;  1UWY A;  5AG5 A;  1YD9 A;  3FXT A;  2W2G A;  2B3U A;  4P4D A;  2Q4Z A;  4C7I A;  3K9U A;  4DUK A;  1VGY A;  2CIJ A;  5HH1 A;  1Q2Y A;  2B3V A;  3TTH A;  3KR5 A;  3PP9 A;  4B10 A;  1M1D A;  2ZEE A;  4PXD A;  2PVW A;  2AJ6 A;  4UFX A;  4RN7 A;  4QC6 A;  1PYT B;  5THW A;  2YND A;  5F46 A;  2POK A;  4OKO A;  2A4N A;  4NFR A;  4DYO A;  1LFW A;  1S5K A;  4NGT A;  3NA6 A;  3E0K A;  1TXR A;  5LRJ A;  1VIX A;  4ZY2 A;  4ZI6 A;  7CPA A;  3QNV A;  5J8C A;  3GUX A;  1HDQ A;  2C6G A;  1LAM A;  4R7M A;  3BJ7 A;  3CXQ A;  3FBU A;  1AYE A;  2ZXV A;  2R1I A;  2FE7 A;  4B11 A;  3R96 A;  4MBU A;  4CYQ A;  2JBK A;  4XNH B;  4L89 A;  4NF1 A;  2B4D B;  2PJ9 A;  3WC6 A;  4IHM A;  1XF8 A;  4TWE A;  2JDC A;  3F0A A;  4LQ6 A;  4KUB A;  3LMS A;  2RB7 A;  3TCV A;  5C88 A;  1VKC A;  4MMO A;  1I1D A;  2GLF A;  3LWU A;  1SQH A;  1TKJ A;  4JLY A;  4KSA A;  4OLL A;  2O28 A;  3R9G A;  4J5Q A;  3MRU A;  1QSO A;  1EE3 P;  2QEC A;  3DLJ A;  2GE3 A;  4UCN A;  1S3Z A;  2I79 A;  5HVH A;  1R3N A;  5JGF A;  2FCK A;  4MHD A;  4OAD A;  4ZX9 A;  4CAF A;  4HNX B;  4CGM A;  2D4O A;  2DEA A;  1JWQ A;  3VAT A;  1R57 A;  4TU0 A;  4PSW A;  4U9Z A;  4NJR A;  4UFW A;  1PCA A;  4CPA A;  5A28 A;  4CGP A;  4AVC A;  2NSM A;  5FSZ A;  3S9L A;  1S7F A;  3IJ3 A;  3KKW A;  1NJR A;  1NMT A;  1LRZ A;  2C6P A;  3KI9 A;  4ORF A;  2JZE A;  1RXT A;  4CYN A;  3A9L A;  2ZEM A;  1R43 A;  4CAE A;  4UCM A;  2ARH A;  2B4B A;  2PJ8 A;  3FRM A;  3SI2 A;  3SII A;  2ZPA A;  2G0B A;  5E3B A;  4XPL A;  4NSQ A;  4R3L A;  5GCN A;  5D29 A;  5EC4 A;  3PBE A;  3V2B A;  1YW6 A;  3D2P A;  3R1K A;  2DPS A;  3I3G A;  3NE8 A;  1YGH A;  1XE4 A;  4B6Z A;  1YLE A;  1F2P A;  2REF A;  4JD6 A;  3QAH A;  3V45 A;  4QVT A;  1M4L A;  5I4M A;  1PU9 A;  3H8F A;  2G3T A;  5JQ4 A;  2FIW A;  3UY5 A;  4JWP A;  2QYV A;  4I49 A;  2HV2 A;  1XMT A;  2IL4 A;  3EWO A;  3KR4 A;  4D86 A;  2Z11 A;  3BJ8 A;  4NGR A;  1TY8 A;  4CGL A;  5IB9 A;  4YU9 A;  2JEW A;  4H89 A;  4PQA A;  4JLL A;  4KVX A;  1BOB A;  4XPD C;  5H86 A;  2PR8 A;  1X12 A;  3TX8 A;  4DJL A;  4F0Y A;  2IJZ A;  2AFX A;  3FJU A;  1Q2C A;  3IGR A;  2WZN A;  2Z3M A;  3S9N A;  4C68 A;  5FSU A;  1LAN A;  3SIJ A;  1JQG A;  2ZW7 A;  2OH1 A;  2EEE A;  4IQY A;  4M6I A;  1YRE A;  4BD9 A;  1KWM A;  2Q7S A;  3PZJ A;  1TXZ A;  4UBR A;  4KLV A;  3IFE A;  1CPX A;  3S6G A;  2ABZ A;  3KQX A;  4MFQ A;  1DTD A;  4UIB A;  2GU2 A;  4Y49 B;  2LGR A;  4H6Z A;  5LYD A;  3H8G A;  1KUV A;  4CYP A;  4ZGY B;  1BAV A;  1F2O A;  1XFO A;  3VFQ A;  4LQG A;  1ZLI A;  3JUW A;  4ABK A;  3SI1 A;  2KQV A;  1IGB A;  3ETI A;  5G21 A;  3KZW A; 
#chains in the Genus database with same CATH homology
 3FMC A;  3B3T A;  5K8O A;  4AXV A;  2CTC A;  2EWB A;  4PXE A;  4A37 A;  2G9D A;  5JM6 A;  1Z5R A;  4H2K A;  2WYR A;  2X47 A;  2V8D A;  2PJ1 A;  4NJQ A;  1ZLH A;  3WC5 A;  3VH9 A;  5CB5 A;  4UEE A;  4A38 A;  2XEI A;  4JCA A;  3D7G A;  1ZG9 A;  5LRG A;  2ZOF A;  2O53 A;  2PJB A;  5J1Q A;  2BFR A;  4ONW A;  4R6T A;  3V38 A;  3MN8 A;  1AMP A;  4Q7A A;  5FSY A;  5K8N A;  3CDX A;  3PBB A;  1BPN A;  1H8L A;  1HEE A;  4JGK A;  1QMU A;  1IY7 A;  4ABL A;  1TKH A;  4P4I A;  4MHY A;  5CMS A;  4JVV A;  4MCP A;  4OC1 A;  1CP6 A;  5CB3 A;  3CPA A;  1OBR A;  2PJC A;  4MHZ A;  4UEF A;  3ISZ A;  5HOL A;  2QVP A;  1TF8 A;  2C1C A;  1LAP A;  3PEI A;  8CPA A;  2XEG A;  3RAM A;  3B2Y A;  2ZOG A;  3CT9 A;  3NH4 A;  2FAV A;  3GQE A;  4OIW A;  1CPS A;  3RZA A;  3JRU A;  4R76 A;  5HIH A;  4JZ0 A;  3NH5 A;  4MCR A;  1ZR3 A;  4MXU A;  4NGS A;  1FT7 A;  1BLL E;  3B3C A;  4MCS A;  3T8W A;  4OC3 A;  4ESS A;  2PCU A;  1FNO A;  2PJA A;  3PB9 X;  3B3W A;  2PJ4 A;  1DE4 C;  3WT4 A;  2PRQ A;  4P10 A;  4W9Y A;  4UF4 A;  3D4U A;  2XEJ A;  3PFO A;  1Z8L A;  4TNU A;  2Q43 A;  4NGM A;  3L2N A;  3GLJ A;  4J5R A;  1Y7E A;  3K2K A;  3KAS A;  4MRI A;  2XEF A;  3GQO A;  1YW4 A;  2AFO A;  4WJB A;  3FVL A;  1ZG8 A;  5DUS A;  2AFS A;  5LYF A;  2PJ5 A;  4ZY0 A;  2AFW A;  4J4Z A;  4OC5 A;  2PVV A;  1HJZ A;  2ZEO A;  3B3V A;  4OC0 A;  4P6Y A;  2V8G A;  4P4B A;  3IO1 A;  2AFM A;  5HVG A;  4O23 A;  3IC1 A;  3FF3 A;  4UML A;  2V8V A;  4NGP A;  4P4F A;  4G1P A;  2C6C A;  4J5S A;  2ZEN A;  3GPO A;  1Y0R A;  4RUH A;  2F8H A;  3IID A;  2O4H A;  1ELL P;  2FVG A;  3D7H A;  4P4J A;  2VL1 A;  2IMO A;  2Q51 A;  2HB6 A;  3EJG A;  2JBJ A;  3NFZ A;  3I1U A;  4X3R A;  1F57 A;  1Y0Y A;  3IIB A;  3V7Z A;  3D68 A;  1CP7 A;  3WC7 A;  1XMB A;  4KSI A;  4K0C A;  4GM5 A;  2IQ6 A;  4NGQ A;  4MCQ A;  1ARL A;  2ZEF A;  1ARM A;  4R8F A;  3D7F A;  2RFH A;  2V8H A;  2V77 A;  3BXM A;  1ZR5 A;  2PJ2 A;  3D7D A;  5JH9 A;  3KHX A;  4K3N A;  5LYI A;  4EWT A;  2AFU A;  2AFZ A;  5HVF A;  3K9T A;  4FWU A;  5AIL A;  5CPA A;  1Q7L A;  4OC4 A;  3SJX A;  2FXK A;  3CPX A;  4UIA A;  5ELY A;  4A39 A;  2DX6 A;  2J9A A;  2EK9 A;  3SJG A;  2NYQ A;  2GRE A;  2I3C A;  5DS0 A;  3ISX A;  2QJ8 A;  3PRT A;  1XRY A;  2CTB A;  2AFC A;  3GPG A;  4FAI A;  1XBU A;  2PJ7 A;  3BHX A;  2XD7 A;  4OC2 A;  3B35 A;  1RTQ A;  2ZEL A;  3SI0 A;  4NGN A;  4P4E A;  2ZEP A;  4ZY1 A;  5FSX A;  3FH4 A;  3PB6 X;  4PXB A;  3SJE A;  4ZX8 A;  3HLP A;  3VAR A;  1Z2L A;  3BI1 A;  4ZYQ A;  3KL9 A;  1LOK A;  3S9M A;  3JZT A;  4EFD A;  1YSJ A;  2PJ6 A;  4KYB A;  3WAB A;  2VRI A;  3B3S A;  3FEE A;  3EJF A;  3EWQ A;  4FBE A;  3TC8 A;  1GYT A;  2EK8 A;  4EME A;  2L8R A;  2BFQ A;  5FSV A;  2BOA A;  3IEH A;  3D66 A;  1QQ9 A;  4JYW A;  5CBM A;  1CG2 A;  4X8I A;  2FG1 A;  3EWR A;  2OR4 A;  3IIF A;  3KGQ A;  4X2T A;  1CX8 A;  3EW5 A;  4IK2 A;  4YWY A;  3SIG A;  4ETK A;  4FUU A;  1SPV A;  3KQZ A;  1TF9 A;  1YME A;  2ZEG A;  3IWW A;  3EWP A;  1CBX A;  3KHZ A;  4MHP A;  2HC9 A;  4P45 A;  2OOT A;  1HDU A;  3FEC A;  3PB8 X;  3GPQ A;  2F7V A;  4PXC A;  5D8N A;  2PIY A;  3D67 A;  1VHU A;  4GUA A;  4MHN A;  4ETJ A;  3PFE A;  2PJ0 A;  1ELM P;  3PB4 X;  5K8M A;  5F09 A;  4GVW A;  3Q71 A;  1LCP A;  1NSA A;  2CF4 A;  4UEZ A;  6CPA A;  3FX6 A;  4F8Z A;  3RBU A;  2PIZ A;  3NH8 A;  1BPM A;  2ACF A;  4PPZ A;  3SIH A;  2BCO A;  4OP4 A;  2ZED A;  4F9V A;  2PE3 A;  1VHE A;  4GVV A;  3SJF A;  2ANP A;  1YLO A;  3B7I A;  2BO9 A;  1VHO A;  5HXD A;  3BI0 A;  4Z65 A;  3H8E A;  1TKF A;  2PJ3 A;  5K8P A;  2ZEH A;  4A94 A;  3EKE A;  4OME A;  3Q6Z A;  5LYL A;  3N5F A;  3GB0 A;  4IAV A;  3FED A;  1XJO A;  3DGV A;  3HUV A;  5LRK A;  3PB7 X;  4P44 A;  4F9U A;  4WWV A;  4OID A;  1ZG7 A;  2GLJ A;  1UWY A;  1YD9 A;  4P4D A;  2Q4Z A;  4DUK A;  1VGY A;  2CIJ A;  3KR5 A;  2ZEE A;  4PXD A;  2PVW A;  5THW A;  1PYT B;  2POK A;  4OKO A;  4DYO A;  4NFR A;  1LFW A;  4NGT A;  3NA6 A;  1TXR A;  5LRJ A;  1VIX A;  4ZY2 A;  4ZI6 A;  7CPA A;  3QNV A;  3GUX A;  1HDQ A;  2C6G A;  1LAM A;  4R7M A;  1AYE A;  2JBK A;  2PJ9 A;  3WC6 A;  4IHM A;  4TWE A;  3LMS A;  2RB7 A;  4MMO A;  2GLF A;  3LWU A;  1TKJ A;  4J5Q A;  3MRU A;  3DLJ A;  1EE3 P;  5HVH A;  1R3N A;  5JGF A;  4ZX9 A;  2DEA A;  3VAT A;  4TU0 A;  4NJR A;  4CPA A;  1PCA A;  2NSM A;  5FSZ A;  3S9L A;  3IJ3 A;  1NJR A;  3KI9 A;  2C6P A;  2ZEM A;  1R43 A;  2PJ8 A;  3SI2 A;  3SII A;  5E3B A;  5D29 A;  3PBE A;  3V2B A;  1YW6 A;  4B6Z A;  1F2P A;  3V45 A;  1M4L A;  5I4M A;  3H8F A;  2QYV A;  3EWO A;  3KR4 A;  4D86 A;  4NGR A;  1TY8 A;  5IB9 A;  4YU9 A;  2JEW A;  4PQA A;  4JLL A;  3TX8 A;  4DJL A;  2IJZ A;  2AFX A;  3FJU A;  2WZN A;  3S9N A;  5FSU A;  1LAN A;  3SIJ A;  1JQG A;  2EEE A;  4IQY A;  4BD9 A;  1KWM A;  1TXZ A;  3IFE A;  1CPX A;  2ABZ A;  3KQX A;  1DTD A;  4UIB A;  2GU2 A;  2LGR A;  5LYD A;  3H8G A;  1BAV A;  1F2O A;  1XFO A;  3VFQ A;  4LQG A;  1ZLI A;  4ABK A;  3SI1 A;  1IGB A;  3ETI A;  3KZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...