2AFCA

X-ray crystal structure of protein q8a8b0 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr9.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
153
Chain Sequence
EILYIKGDATAPIGSGVKVITHICNDIGGWGKGFVLALSKKWKMPEEAYRQWYKSQEEFTLGAVQFVNVENKLYVANMIGQHGIYKDSKGLPPIRYDAVRQCLKEVALFTIAHKASVHMPRIGCGAGGKWELMEQIIKEELITKEIAVTVYDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title X-ray structure of Q8A8B0 hypothetical protein from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 43
structure length 153
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2afcA00
3ETIA 3Q71A 5FSUA 3IIDA 5AILA 4X2TA 4ZY0A 3V2BA 4ZY1A 1NJRA 2J9AA 3H8FA 5DUSA 4J5SA 2L8RA 4TU0A 2LGRA 2FXKA 1LAMA 1BPNA 3JZTA 1HJZA 2XD7A 5E3BA 3EJGA 3EWQA 3KR5A 1TY8A 4ESSA 3GQOA 4R6TA 5FSZA 3IIFA 3VFQA 4JLLA 3H8GA 3GQEA 1ZR3A 2EEEA 4K0CA 5CB3A 4GUAA 4IQYA 3SIJA 1YD9A 4KSIA 3SIHA 4K3NA 3KQZA 3Q6ZA 2FAVA 1LANA 3SIIA 2VRIA 4KYBA 3EWRA 1LAPA 4D86A 3EW5A 2DX6A 2FG1A 5FSXA 1ZR5A 4JVVA 2BFRA 5CBMA 4GVVA 4J5QA 3V45A 5HOLA 1TXZA 4ZY2A 4UMLA 4ZI6A 5FSYA 3EWOA 4R7MA 4JGKA 1VHUA 3SIGA 4ETJA 3T8WA 3EJFA 3KQXA 3GPQA 1GYTA 3KZWA 3GPGA 4ZX8A 4ZX9A 1SPVA 4JCAA 2AFCA 3EWPA 4R76A 4ZYQA 2X47A 3IJ3A 2ACFA 4ETKA 4ABLA 4J5RA 3H8EA 5CB5A 5FSVA 1LCPA 1BLLE 4ABKA 4J4ZA 5CMSA 3EKEA 2EWBA 3KR4A 2BFQA 3GPOA 3PEIA 5HIHA 1BPMA 3JRUA 5D8NA 4GVWA
chains in the Genus database with same CATH superfamily
3ETIA 3Q71A 5FSUA 3IIDA 5AILA 4X2TA 4ZY0A 3V2BA 4ZY1A 1NJRA 2J9AA 3H8FA 5DUSA 4J5SA 2L8RA 4TU0A 2LGRA 2FXKA 1LAMA 1BPNA 3JZTA 1HJZA 2XD7A 5E3BA 3EJGA 3EWQA 3KR5A 1TY8A 4ESSA 3GQOA 4R6TA 2W2GA 5FSZA 3IIFA 3VFQA 2KQVA 4JLLA 3H8GA 3GQEA 1ZR3A 2EEEA 4K0CA 5CB3A 4GUAA 4IQYA 2JZFA 3SIJA 1YD9A 4KSIA 3SIHA 4K3NA 3KQZA 2JZEA 3Q6ZA 2FAVA 1LANA 3SIIA 2VRIA 4KYBA 3EWRA 1LAPA 4D86A 3EW5A 2DX6A 2FG1A 2JZDA 5FSXA 1ZR5A 4JVVA 2BFRA 5CBMA 4GVVA 4J5QA 3V45A 5HOLA 1TXZA 4ZY2A 4UMLA 4ZI6A 5FSYA 3EWOA 4R7MA 4JGKA 1VHUA 3SIGA 4ETJA 3T8WA 3EJFA 3KQXA 3GPQA 1GYTA 3KZWA 3GPGA 4ZX8A 4ZX9A 1SPVA 4JCAA 2AFCA 3EWPA 4R76A 4ZYQA 2X47A 3IJ3A 2ACFA 4ETKA 2RNKA 4ABLA 4J5RA 3H8EA 5CB5A 5FSVA 1LCPA 1BLLE 4ABKA 2WCTA 4J4ZA 5CMSA 3EKEA 2EWBA 3KR4A 2BFQA 3GPOA 3PEIA 5HIHA 1BPMA 3JRUA 5D8NA 4GVWA
chains in the Genus database with same CATH topology
3ETIA 3Q71A 5FSUA 3IIDA 5AILA 4X2TA 4ZY0A 3V2BA 4ZY1A 1NJRA 2J9AA 3H8FA 5DUSA 4J5SA 2L8RA 4TU0A 2LGRA 2FXKA 1LAMA 1BPNA 3JZTA 1HJZA 2XD7A 5E3BA 3EJGA 3EWQA 3KR5A 1TY8A 4ESSA 3GQOA 4R6TA 5FSZA 3IIFA 3VFQA 4JLLA 3H8GA 3GQEA 1ZR3A 2EEEA 4K0CA 5CB3A 4GUAA 4IQYA 3SIJA 1YD9A 4KSIA 3SIHA 4K3NA 3KQZA 3Q6ZA 2FAVA 1LANA 3SIIA 2VRIA 4KYBA 3EWRA 1LAPA 4D86A 3EW5A 2DX6A 2FG1A 5FSXA 1ZR5A 4JVVA 2BFRA 5CBMA 4GVVA 4J5QA 3V45A 5HOLA 1TXZA 4ZY2A 4UMLA 4ZI6A 5FSYA 3EWOA 4R7MA 4JGKA 1VHUA 3SIGA 4ETJA 3T8WA 3EJFA 3KQXA 3GPQA 1GYTA 3KZWA 3GPGA 4ZX8A 4ZX9A 1SPVA 4JCAA 2AFCA 3EWPA 4R76A 4ZYQA 2X47A 3IJ3A 2ACFA 4ETKA 4ABLA 4J5RA 3H8EA 5CB5A 5FSVA 1LCPA 1BLLE 4ABKA 4J4ZA 5CMSA 3EKEA 2EWBA 3KR4A 2BFQA 3GPOA 3PEIA 5HIHA 1BPMA 3JRUA 5D8NA 4GVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETI A;  3Q71 A;  5FSU A;  3IID A;  5AIL A;  4X2T A;  4ZY0 A;  3V2B A;  4ZY1 A;  1NJR A;  2J9A A;  3H8F A;  5DUS A;  4J5S A;  2L8R A;  4TU0 A;  2LGR A;  2FXK A;  1LAM A;  1BPN A;  3JZT A;  1HJZ A;  2XD7 A;  5E3B A;  3EJG A;  3EWQ A;  3KR5 A;  1TY8 A;  4ESS A;  3GQO A;  4R6T A;  5FSZ A;  3IIF A;  3VFQ A;  4JLL A;  3H8G A;  3GQE A;  1ZR3 A;  2EEE A;  4K0C A;  5CB3 A;  4GUA A;  4IQY A;  3SIJ A;  1YD9 A;  4KSI A;  3SIH A;  4K3N A;  3KQZ A;  3Q6Z A;  2FAV A;  1LAN A;  3SII A;  2VRI A;  4KYB A;  3EWR A;  1LAP A;  4D86 A;  3EW5 A;  2DX6 A;  2FG1 A;  5FSX A;  1ZR5 A;  4JVV A;  2BFR A;  5CBM A;  4GVV A;  4J5Q A;  3V45 A;  5HOL A;  1TXZ A;  4ZY2 A;  4UML A;  4ZI6 A;  5FSY A;  3EWO A;  4R7M A;  4JGK A;  1VHU A;  3SIG A;  4ETJ A;  3T8W A;  3EJF A;  3KQX A;  3GPQ A;  1GYT A;  3KZW A;  3GPG A;  4ZX8 A;  4ZX9 A;  1SPV A;  4JCA A;  2AFC A;  3EWP A;  4R76 A;  4ZYQ A;  2X47 A;  3IJ3 A;  2ACF A;  4ETK A;  4ABL A;  4J5R A;  3H8E A;  5CB5 A;  5FSV A;  1LCP A;  1BLL E;  4ABK A;  4J4Z A;  5CMS A;  3EKE A;  2EWB A;  3KR4 A;  2BFQ A;  3GPO A;  3PEI A;  5HIH A;  1BPM A;  3JRU A;  5D8N A;  4GVW A; 
#chains in the Genus database with same CATH topology
 3ETI A;  3Q71 A;  5FSU A;  3IID A;  5AIL A;  4X2T A;  4ZY0 A;  3V2B A;  4ZY1 A;  1NJR A;  2J9A A;  3H8F A;  5DUS A;  4J5S A;  2L8R A;  4TU0 A;  2LGR A;  2FXK A;  1LAM A;  1BPN A;  3JZT A;  1HJZ A;  2XD7 A;  5E3B A;  3EJG A;  3EWQ A;  3KR5 A;  1TY8 A;  4ESS A;  3GQO A;  4R6T A;  2W2G A;  5FSZ A;  3IIF A;  3VFQ A;  2KQV A;  4JLL A;  3H8G A;  3GQE A;  1ZR3 A;  2EEE A;  4K0C A;  5CB3 A;  4GUA A;  4IQY A;  2JZF A;  3SIJ A;  1YD9 A;  4KSI A;  3SIH A;  4K3N A;  3KQZ A;  2JZE A;  3Q6Z A;  2FAV A;  1LAN A;  3SII A;  2VRI A;  4KYB A;  3EWR A;  1LAP A;  4D86 A;  3EW5 A;  2DX6 A;  2FG1 A;  2JZD A;  5FSX A;  1ZR5 A;  4JVV A;  2BFR A;  5CBM A;  4GVV A;  4J5Q A;  3V45 A;  5HOL A;  1TXZ A;  4ZY2 A;  4UML A;  4ZI6 A;  5FSY A;  3EWO A;  4R7M A;  4JGK A;  1VHU A;  3SIG A;  4ETJ A;  3T8W A;  3EJF A;  3KQX A;  3GPQ A;  1GYT A;  3KZW A;  3GPG A;  4ZX8 A;  4ZX9 A;  1SPV A;  4JCA A;  2AFC A;  3EWP A;  4R76 A;  4ZYQ A;  2X47 A;  3IJ3 A;  2ACF A;  4ETK A;  2RNK A;  4ABL A;  4J5R A;  3H8E A;  5CB5 A;  5FSV A;  1LCP A;  1BLL E;  4ABK A;  2WCT A;  4J4Z A;  5CMS A;  3EKE A;  2EWB A;  3KR4 A;  2BFQ A;  3GPO A;  3PEI A;  5HIH A;  1BPM A;  3JRU A;  5D8N A;  4GVW A; 
#chains in the Genus database with same CATH homology
 3ETI A;  3Q71 A;  5FSU A;  3IID A;  5AIL A;  4X2T A;  4ZY0 A;  3V2B A;  4ZY1 A;  1NJR A;  2J9A A;  3H8F A;  5DUS A;  4J5S A;  2L8R A;  4TU0 A;  2LGR A;  2FXK A;  1LAM A;  1BPN A;  3JZT A;  1HJZ A;  2XD7 A;  5E3B A;  3EJG A;  3EWQ A;  3KR5 A;  1TY8 A;  4ESS A;  3GQO A;  4R6T A;  5FSZ A;  3IIF A;  3VFQ A;  4JLL A;  3H8G A;  3GQE A;  1ZR3 A;  2EEE A;  4K0C A;  5CB3 A;  4GUA A;  4IQY A;  3SIJ A;  1YD9 A;  4KSI A;  3SIH A;  4K3N A;  3KQZ A;  3Q6Z A;  2FAV A;  1LAN A;  3SII A;  2VRI A;  4KYB A;  3EWR A;  1LAP A;  4D86 A;  3EW5 A;  2DX6 A;  2FG1 A;  5FSX A;  1ZR5 A;  4JVV A;  2BFR A;  5CBM A;  4GVV A;  4J5Q A;  3V45 A;  5HOL A;  1TXZ A;  4ZY2 A;  4UML A;  4ZI6 A;  5FSY A;  3EWO A;  4R7M A;  4JGK A;  1VHU A;  3SIG A;  4ETJ A;  3T8W A;  3EJF A;  3KQX A;  3GPQ A;  1GYT A;  3KZW A;  3GPG A;  4ZX8 A;  4ZX9 A;  1SPV A;  4JCA A;  2AFC A;  3EWP A;  4R76 A;  4ZYQ A;  2X47 A;  3IJ3 A;  2ACF A;  4ETK A;  4ABL A;  4J5R A;  3H8E A;  5CB5 A;  5FSV A;  1LCP A;  1BLL E;  4ABK A;  4J4Z A;  5CMS A;  3EKE A;  2EWB A;  3KR4 A;  2BFQ A;  3GPO A;  3PEI A;  5HIH A;  1BPM A;  3JRU A;  5D8N A;  4GVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...