2AFCA

X-ray crystal structure of protein q8a8b0 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr9.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
153
Chain Sequence
EILYIKGDATAPIGSGVKVITHICNDIGGWGKGFVLALSKKWKMPEEAYRQWYKSQEEFTLGAVQFVNVENKLYVANMIGQHGIYKDSKGLPPIRYDAVRQCLKEVALFTIAHKASVHMPRIGCGAGGKWELMEQIIKEELITKEIAVTVYDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title X-ray structure of Q8A8B0 hypothetical protein from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 43
structure length 153
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2afcA00
4ZYQA 4JCAA 4KYBA 5CB5A 2BFQA 3KZWA 1YD9A 1BPNA 3IIFA 3GPGA 2BFRA 1BLLE 1TXZA 4JGKA 2J9AA 3V45A 3EW5A 4R76A 3GPQA 2FXKA 3H8GA 3SIJA 4ZI6A 3GPOA 3SIGA 3KQXA 1LAPA 1LCPA 5CB3A 3VFQA 3KR4A 5CBMA 2EEEA 2FAVA 2VRIA 4KSIA 3IIDA 4D86A 4J5RA 3KQZA 5FSUA 2ACFA 4UMLA 3EJGA 2AFCA 1BPMA 4IQYA 3EWPA 4ZY2A 3JZTA 3ETIA 3EWRA 3EWOA 4J5SA 5E3BA 4ZY1A 3GQOA 3SIIA 1GYTA 4R6TA 4JVVA 4ESSA 4ETJA 1ZR5A 3H8EA 4ETKA 1HJZA 2XD7A 4K0CA 1LAMA 4ZX8A 5AILA 2FG1A 4ZX9A 3EJFA 5CMSA 1SPVA 5FSXA 5FSYA 3JRUA 4JLLA 1LANA 5HIHA 2L8RA 3SIHA 2DX6A 5HOLA 2EWBA 2LGRA 4J4ZA 5FSVA 1VHUA 4ZY0A 3H8FA 3PEIA 4X2TA 4ABKA 3T8WA 5FSZA 3Q71A 4TU0A 3GQEA 4J5QA 4R7MA 3Q6ZA 3V2BA 2X47A 3IJ3A 4GVVA 4K3NA 5DUSA 3EWQA 4ABLA 1NJRA 1ZR3A 1TY8A 5D8NA 4GVWA 4GUAA 3KR5A 3EKEA
chains in the Genus database with same CATH superfamily
4ZYQA 4JCAA 4KYBA 5CB5A 2BFQA 3KZWA 1YD9A 1BPNA 3IIFA 3GPGA 2JZFA 2BFRA 1BLLE 1TXZA 4JGKA 2J9AA 3V45A 3EW5A 4R76A 3GPQA 2FXKA 3H8GA 3SIJA 4ZI6A 3GPOA 3SIGA 3KQXA 1LAPA 1LCPA 5CB3A 3VFQA 3KR4A 5CBMA 2EEEA 2FAVA 2VRIA 4KSIA 3IIDA 4D86A 2KQVA 4J5RA 3KQZA 5FSUA 2WCTA 2ACFA 4UMLA 3EJGA 2AFCA 1BPMA 4IQYA 3EWPA 4ZY2A 3JZTA 3ETIA 3EWRA 3EWOA 4J5SA 5E3BA 4ZY1A 3GQOA 3SIIA 1GYTA 4R6TA 4JVVA 4ESSA 4ETJA 1ZR5A 3H8EA 4ETKA 1HJZA 2XD7A 4K0CA 1LAMA 4ZX8A 5AILA 2FG1A 4ZX9A 3EJFA 5CMSA 1SPVA 5FSXA 5FSYA 3JRUA 4JLLA 1LANA 5HIHA 2L8RA 3SIHA 2DX6A 5HOLA 2EWBA 2LGRA 4J4ZA 5FSVA 1VHUA 4ZY0A 3H8FA 3PEIA 4X2TA 4ABKA 3T8WA 5FSZA 3Q71A 4TU0A 3GQEA 2JZDA 2RNKA 4J5QA 3Q6ZA 4R7MA 3V2BA 2X47A 3IJ3A 4GVVA 4K3NA 5DUSA 3EWQA 4ABLA 2JZEA 2W2GA 1NJRA 1ZR3A 1TY8A 5D8NA 4GVWA 4GUAA 3KR5A 3EKEA
chains in the Genus database with same CATH topology
4ZYQA 4JCAA 4KYBA 5CB5A 2BFQA 3KZWA 1YD9A 1BPNA 3IIFA 3GPGA 2BFRA 1BLLE 1TXZA 4JGKA 2J9AA 3V45A 3EW5A 4R76A 3GPQA 2FXKA 3H8GA 3SIJA 4ZI6A 3GPOA 3SIGA 3KQXA 1LAPA 1LCPA 5CB3A 3VFQA 3KR4A 5CBMA 2EEEA 2FAVA 2VRIA 4KSIA 3IIDA 4D86A 4J5RA 3KQZA 5FSUA 2ACFA 4UMLA 3EJGA 2AFCA 1BPMA 4IQYA 3EWPA 4ZY2A 3JZTA 3ETIA 3EWRA 3EWOA 4J5SA 5E3BA 4ZY1A 3GQOA 3SIIA 1GYTA 4R6TA 4JVVA 4ESSA 4ETJA 1ZR5A 3H8EA 4ETKA 1HJZA 2XD7A 4K0CA 1LAMA 4ZX8A 5AILA 2FG1A 4ZX9A 3EJFA 5CMSA 1SPVA 5FSXA 5FSYA 3JRUA 4JLLA 1LANA 5HIHA 2L8RA 3SIHA 2DX6A 5HOLA 2EWBA 2LGRA 4J4ZA 5FSVA 1VHUA 4ZY0A 3H8FA 3PEIA 4X2TA 4ABKA 3T8WA 5FSZA 3Q71A 4TU0A 3GQEA 4J5QA 4R7MA 3Q6ZA 3V2BA 2X47A 3IJ3A 4GVVA 4K3NA 5DUSA 3EWQA 4ABLA 1NJRA 1ZR3A 1TY8A 5D8NA 4GVWA 4GUAA 3KR5A 3EKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYQ A;  4JCA A;  4KYB A;  5CB5 A;  2BFQ A;  3KZW A;  1YD9 A;  1BPN A;  3IIF A;  3GPG A;  2BFR A;  1BLL E;  1TXZ A;  4JGK A;  2J9A A;  3V45 A;  3EW5 A;  4R76 A;  3GPQ A;  2FXK A;  3H8G A;  3SIJ A;  4ZI6 A;  3GPO A;  3SIG A;  3KQX A;  1LAP A;  1LCP A;  5CB3 A;  3VFQ A;  3KR4 A;  5CBM A;  2EEE A;  2FAV A;  2VRI A;  4KSI A;  3IID A;  4D86 A;  4J5R A;  3KQZ A;  5FSU A;  2ACF A;  4UML A;  3EJG A;  2AFC A;  1BPM A;  4IQY A;  3EWP A;  4ZY2 A;  3JZT A;  3ETI A;  3EWR A;  3EWO A;  4J5S A;  5E3B A;  4ZY1 A;  3GQO A;  3SII A;  1GYT A;  4R6T A;  4JVV A;  4ESS A;  4ETJ A;  1ZR5 A;  3H8E A;  4ETK A;  1HJZ A;  2XD7 A;  4K0C A;  1LAM A;  4ZX8 A;  5AIL A;  2FG1 A;  4ZX9 A;  3EJF A;  5CMS A;  1SPV A;  5FSX A;  5FSY A;  3JRU A;  4JLL A;  1LAN A;  5HIH A;  2L8R A;  3SIH A;  2DX6 A;  5HOL A;  2EWB A;  2LGR A;  4J4Z A;  5FSV A;  1VHU A;  4ZY0 A;  3H8F A;  3PEI A;  4X2T A;  4ABK A;  3T8W A;  5FSZ A;  3Q71 A;  4TU0 A;  3GQE A;  4J5Q A;  4R7M A;  3Q6Z A;  3V2B A;  2X47 A;  3IJ3 A;  4GVV A;  4K3N A;  5DUS A;  3EWQ A;  4ABL A;  1NJR A;  1ZR3 A;  1TY8 A;  5D8N A;  4GVW A;  4GUA A;  3KR5 A;  3EKE A; 
#chains in the Genus database with same CATH topology
 4ZYQ A;  4JCA A;  4KYB A;  5CB5 A;  2BFQ A;  3KZW A;  1YD9 A;  1BPN A;  3IIF A;  3GPG A;  2JZF A;  2BFR A;  1BLL E;  1TXZ A;  4JGK A;  2J9A A;  3V45 A;  3EW5 A;  4R76 A;  3GPQ A;  2FXK A;  3H8G A;  3SIJ A;  4ZI6 A;  3GPO A;  3SIG A;  3KQX A;  1LAP A;  1LCP A;  5CB3 A;  3VFQ A;  3KR4 A;  5CBM A;  2EEE A;  2FAV A;  2VRI A;  4KSI A;  3IID A;  4D86 A;  2KQV A;  4J5R A;  3KQZ A;  5FSU A;  2WCT A;  2ACF A;  4UML A;  3EJG A;  2AFC A;  1BPM A;  4IQY A;  3EWP A;  4ZY2 A;  3JZT A;  3ETI A;  3EWR A;  3EWO A;  4J5S A;  5E3B A;  4ZY1 A;  3GQO A;  3SII A;  1GYT A;  4R6T A;  4JVV A;  4ESS A;  4ETJ A;  1ZR5 A;  3H8E A;  4ETK A;  1HJZ A;  2XD7 A;  4K0C A;  1LAM A;  4ZX8 A;  5AIL A;  2FG1 A;  4ZX9 A;  3EJF A;  5CMS A;  1SPV A;  5FSX A;  5FSY A;  3JRU A;  4JLL A;  1LAN A;  5HIH A;  2L8R A;  3SIH A;  2DX6 A;  5HOL A;  2EWB A;  2LGR A;  4J4Z A;  5FSV A;  1VHU A;  4ZY0 A;  3H8F A;  3PEI A;  4X2T A;  4ABK A;  3T8W A;  5FSZ A;  3Q71 A;  4TU0 A;  3GQE A;  2JZD A;  2RNK A;  4J5Q A;  3Q6Z A;  4R7M A;  3V2B A;  2X47 A;  3IJ3 A;  4GVV A;  4K3N A;  5DUS A;  3EWQ A;  4ABL A;  2JZE A;  2W2G A;  1NJR A;  1ZR3 A;  1TY8 A;  5D8N A;  4GVW A;  4GUA A;  3KR5 A;  3EKE A; 
#chains in the Genus database with same CATH homology
 4ZYQ A;  4JCA A;  4KYB A;  5CB5 A;  2BFQ A;  3KZW A;  1YD9 A;  1BPN A;  3IIF A;  3GPG A;  2BFR A;  1BLL E;  1TXZ A;  4JGK A;  2J9A A;  3V45 A;  3EW5 A;  4R76 A;  3GPQ A;  2FXK A;  3H8G A;  3SIJ A;  4ZI6 A;  3GPO A;  3SIG A;  3KQX A;  1LAP A;  1LCP A;  5CB3 A;  3VFQ A;  3KR4 A;  5CBM A;  2EEE A;  2FAV A;  2VRI A;  4KSI A;  3IID A;  4D86 A;  4J5R A;  3KQZ A;  5FSU A;  2ACF A;  4UML A;  3EJG A;  2AFC A;  1BPM A;  4IQY A;  3EWP A;  4ZY2 A;  3JZT A;  3ETI A;  3EWR A;  3EWO A;  4J5S A;  5E3B A;  4ZY1 A;  3GQO A;  3SII A;  1GYT A;  4R6T A;  4JVV A;  4ESS A;  4ETJ A;  1ZR5 A;  3H8E A;  4ETK A;  1HJZ A;  2XD7 A;  4K0C A;  1LAM A;  4ZX8 A;  5AIL A;  2FG1 A;  4ZX9 A;  3EJF A;  5CMS A;  1SPV A;  5FSX A;  5FSY A;  3JRU A;  4JLL A;  1LAN A;  5HIH A;  2L8R A;  3SIH A;  2DX6 A;  5HOL A;  2EWB A;  2LGR A;  4J4Z A;  5FSV A;  1VHU A;  4ZY0 A;  3H8F A;  3PEI A;  4X2T A;  4ABK A;  3T8W A;  5FSZ A;  3Q71 A;  4TU0 A;  3GQE A;  4J5Q A;  4R7M A;  3Q6Z A;  3V2B A;  2X47 A;  3IJ3 A;  4GVV A;  4K3N A;  5DUS A;  3EWQ A;  4ABL A;  1NJR A;  1ZR3 A;  1TY8 A;  5D8N A;  4GVW A;  4GUA A;  3KR5 A;  3EKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...