4K3NA

Phosphonic arginine mimetics as inhibitors of the m17 aminopeptidases from plasmodium falciparum
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Synthesis and Structure-Activity Relationships of Phosphonic Arginine Mimetics as Inhibitors of the M1 and M17 Aminopeptidases from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
total genus 179
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4k3nA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4k3nA02
3H8GA 3D7DA 2PJAA 3GUXA 4D86A 2OR4A 4KYBA 4A39A 4Q7AA 3KR5A 3NH5A 4OC3A 4J4ZA 1IGBA 3FECA 2BOAA 4JYWA 1TKHA 3EW5A 3ISXA 2PJ0A 1AMPA 3S9MA 3S9NA 3IC1A 3SIIA 4Z65A 4NGNA 4PPZA 4PXDA 3MRUA 3PFOA 2EEEA 4A37A 4H2KA 2BFRA 2BO9A 4JVVA 4J5SA 2XEJA 1CP7A 4JLLA 3EWPA 4ETJA 1BLLE 4ZY0A 4TNUA 4P45A 2ZOGA 3PB9X 1TXRA 3VARA 2XD7A 2PVVA 4MMOA 3WC6A 1ELLP 2GLFA 2PJ4A 2CTBA 2RFHA 4MRIA 2OOTA 1GYTA 5DS0A 3SJXA 3SIHA 4NFRA 2ZEPA 4PXEA 1XFOA 2ABZA 1QQ9A 2FVGA 1ARMA 3VATA 5ELYA 2G9DA 2EWBA 5D29A 1ZG9A 1YMEA 4IK2A 2F7VA 1PCAA 5LRJA 2L8RA 3IIBA 4TWEA 5HOLA 2JBJA 4BD9A 3WC7A 3MN8A 3IIDA 4JGKA 4P4IA 5LYLA 4R76A 1Y0YA 3IEHA 2ZEHA 1QMUA 3PB6X 2PJ1A 4X3RA 4OC1A 2PJ2A 5CPAA 7CPAA 2ZENA 4NJQA 4MHZA 3D7FA 1SPVA 3D66A 4LQGA 4GVVA 2IQ6A 3FEDA 2GREA 4ZX9A 3B3CA 4ABLA 4MHPA 5HIHA 5FSXA 3KASA 2JBKA 2XEGA 4JZ0A 1XMBA 4PXBA 2AFOA 3WABA 1TY8A 1XJOA 2BCOA 3LMSA 4DYOA 3H8FA 4MHYA 2FXKA 2C1CA 2C6CA 4NJRA 2EK9A 3GPQA 2ZEOA 2QYVA 3EJGA 2XEFA 4GM5A 3JZTA 2VL1A 4RUHA 3LWUA 3QNVA 2XEIA 3GPOA 2FAVA 3B3VA 4P4DA 3GPGA 1HEEA 2AFWA 2PJBA 4UIAA 1Y7EA 3VH9A 3K9TA 2AFZA 5CMSA 4IAVA 1NJRA 2DEAA 4ZYQA 2C6PA 1OBRA 4A38A 3D4UA 3S9LA 4NGSA 1VHEA 4J5QA 5LYFA 2HB6A 5JH9A 4F9UA 4W9YA 1HJZA 4UEEA 1VHUA 4FBEA 2Q4ZA 3B7IA 3KGQA 1Z5RA 3B3SA 4OIDA 1KWMA 3T8WA 5J1QA 1CBXA 4FAIA 1CG2A 3CDXA 1TKJA 3PB8X 3KHZA 3KQXA 3PB7X 4R6TA 2NSMA 1HDUA 3IJ3A 2PJ6A 2VRIA 4B6ZA 2PIYA 4OC4A 5HVFA 1F57A 3FJUA 3IWWA 4IQYA 3V2BA 2ZEMA 3RZAA 4IHMA 1DTDA 5LYDA 3PFEA 1ARLA 4UEZA 3PB4X 3Q71A 3IFEA 4NGQA 3NH4A 4GUAA 3ISZA 4PQAA 2PJ3A 3PBBA 3KQZA 1LFWA 4FUUA 5JGFA 1AYEA 2ACFA 2BFQA 1XBUA 5CB3A 3EJFA 4R8FA 3IIFA 3PBEA 1FT7A 3TX8A 2GU2A 4OP4A 2PE3A 4ZY2A 3FH4A 3D7GA 4FWUA 1VGYA 3IO1A 1F2PA 1VIXA 1Y0RA 2PIZA 3SI0A 4NGTA 1UWYA 2V8DA 4R7MA 4NGRA 3HLPA 3VFQA 1ZG8A 4P4BA 5D8NA 4OKOA 3FX6A 1DE4C 1PYTB 1LOKA 1TF8A 3ETIA 4P44A 2PRQA 4GVWA 4NGPA 4DUKA 3NH8A 3EWQA 2GLJA 4F8ZA 2PJ5A 1CX8A 2PCUA 5LRGA 1CPSA 4F9VA 1ZLIA 3N5FA 3KR4A 1NSAA 3B2YA 4YU9A 2ANPA 3NFZA 3EKEA 1BAVA 3FVLA 3FEEA 1TXZA 2PJ7A 2FG1A 3GB0A 3K2KA 4O23A 2AFMA 2CF4A 2CIJA 3SJEA 5E3BA 3V45A 1JQGA 5DUSA 4WWVA 3KI9A 8CPAA 1XRYA 2LGRA 1ZLHA 1HDQA 4EMEA 5JM6A 1ZG7A 4CPAA 2ZELA 4ZX8A 1Z8LA 2ZEEA 3KL9A 5HXDA 1H8LA 2V77A 3FF3A 5K8MA 2AFUA 4ETKA 3PEIA 2EK8A 1TKFA 2PVWA 5THWA 1YSJA 2HC9A 3GLJA 2WYRA 1LAMA 1CP6A 3SI2A 3GQOA 4P4FA 4UF4A 4OC0A 3SIJA 3BXMA 5K8PA 1Z2LA 2Q43A 2V8VA 3BHXA 3B35A 1CPXA 5F09A 2IMOA 4K3NA 5HVGA 1LCPA 4KSIA 4MCSA 3WC5A 3SIGA 1R3NA 3KZWA 1ELMP 3D7HA 3CPAA 3L2NA 5LYIA 2J9AA 5FSYA 3GQEA 2DX6A 5AILA 4X2TA 3B3TA 4G1PA 4P4JA 4J5RA 4MCQA 4PXCA 2QVPA 4WJBA 1FNOA 3WT4A 2AFXA 4ABKA 4A94A 4OMEA 2V8HA 1VHOA 4P4EA 4OC2A 1LAPA 2RB7A 3EWRA 3B3WA 3CPXA 3H8EA 1Q7LA 4OC5A 5FSUA 3DGVA 4ZI6A 3I1UA 4X8IA 2Q51A 3PRTA 1RTQA 3RBUA 5I4MA 1M4LA 1ZR3A 2POKA 4P6YA 4NGMA 3NA6A 4YWYA 5IB9A 1YLOA 4AXVA 3TC8A 2PJ8A 2ZEDA 5K8NA 4DJLA 2AFCA 4TU0A 3SI1A 3JRUA 1ZR5A 2ZOFA 5CBMA 4EFDA 3D67A 4MCRA 4MHNA 3HUVA 1R43A 2AFSA 2I3CA 5LRKA 2O53A 1TF9A 3EWOA 2ZEGA 4UEFA 5HVHA 1BPNA 6CPAA 1EE3P 5K8OA 1LANA 3FMCA 4UMLA 4OIWA 2V8GA 1YW6A 4ZY1A 3BI1A 1BPMA 2PJ9A 4UIBA 5FSZA 4JCAA 2ZEFA 2QJ8A 2PJCA 4K0CA 4EWTA 5CB5A 3BI0A 1YW4A 3KHXA 4MXUA 3DLJA 1F2OA 4ESSA 1IY7A 3Q6ZA 2O4HA 3CT9A 3V38A 3SJFA 2JEWA 2CTCA 2NYQA 3RAMA 3SJGA 2F8HA 4MCPA 1YD9A 3V7ZA 2X47A 4ONWA 2C6GA 2IJZA 3D68A 2WZNA 5FSVA 4P10A
chains in the Genus database with same CATH superfamily
3H8GA 1B87A 1Z4RA 2JZFA 2W2GA 3D7DA 2PJAA 1IYLA 3GUXA 4D86A 2OR4A 4KLWA 4KYBA 3H4QA 4A39A 4Q7AA 3KR5A 3NH5A 4OC3A 4J4ZA 1IGBA 3FECA 2D4OA 1M4IA 2BOAA 2R8VA 4JYWA 1TKHA 4I49A 3EW5A 3ISXA 2AE6A 2PJ0A 1AMPA 2EBJA 3PZJA 3S9MA 3S9NA 5J8CA 3IC1A 3SIIA 2Q7BA 4Z65A 1M1DA 1S60A 4NGNA 4L89A 4PPZA 4PXDA 3MRUA 1CM0A 3PFOA 4QVTA 2EEEA 3PGPA 5G22A 4H2KA 4A37A 3E0KA 2BFRA 2BO9A 4MJ8A 4JVVA 4J5SA 4RI1A 2XEJA 3ZZIA 1CP7A 3GIUA 5AG5A 4JLLA 5BWAB 1I1DA 3EWPA 4IF5A 4ETJA 2G3AA 1BLLE 4ZY0A 4TNUA 4BMHA 2O28A 3I3GA 1XEBA 4P45A 2JZDA 2ZOGA 1TXRA 3PB9X 1RXTA 2XD7A 1QSOA 2ZW6A 3CZXA 2DPTA 3TO6A 3VARA 2PVVA 4MMOA 3PP9A 2H5MA 3WC6A 3W6SA 1ELLP 2GLFA 2PJ4A 2CTBA 2RFHA 4MRIA 5G1ZA 2OOTA 5G21A 5C88A 1GYTA 2PR8A 5DS0A 3SJXA 3SIHA 2IL4A 2ZEPA 4NFRA 4PXEA 4A2ZA 1XFOA 2ABZA 1QQ9A 2FVGA 1ARMA 5F47A 3VATA 5ELYA 4B10A 2G9DA 2EWBA 2PR1A 5D29A 1ZG9A 4UBRA 1YMEA 2Z3LA 4IK2A 5AG6A 3WR7A 2F7VA 1PCAA 5LRJA 2L8RA 1Y9KA 3IIBA 4TWEA 3B8GA 5HOLA 1XIXA 2JBJA 4BD9A 1L0CA 3TFYA 3WC7A 3MN8A 3IIDA 4JGKA 4P4IA 4B12A 4KOVA 5LYLA 2ARHA 5GCNA 4R76A 1Y0YA 1J4JA 1YREA 2ZEHA 3IEHA 4FD5A 4H6UA 1QMUA 1V0CA 1X12A 1MJAA 3KKWA 1S7NA 1IICA 1P0HA 2VI7A 2OB0A 3PB6X 2PJ1A 1MJ9A 4X3RA 1N71A 3P2FA 3BJ8A 4OC1A 2PJ2A 5CPAA 2YNDA 2Z3MA 5HMNA 7CPAA 3UY5A 1YK3A 4B11A 2ZENA 4NJQA 2BL1A 2Z11A 3D7FA 1SPVA 3D66A 3QB8A 4MHZA 5G20A 4LQGA 4UWIA 4GVVA 2IQ6A 3FEDA 4LQ6A 2GREA 2CY2A 4NXYA 3TCVA 4YFJA 4ZX9A 4QBJA 3B3CA 2R7HA 2B3UA 4ZBGA 4U9ZA 4ABLA 5H84A 4OAEA 3G3SA 3G8WA 4JXRA 4MHPA 5HIHA 4RS2A 5FSXA 3KASA 1Y7RA 2JBKA 2PQ8A 4C7IA 2XEGA 2Z3PA 4JZ0A 4CAEA 1XMBA 2PDOA 2Q7SA 4IUSA 4PXBA 1YVOA 1I21A 2AFOA 3IWGA 3WABA 5DWMA 2Z3KA 4CGNA 2C27A 1TY8A 1XJOA 2BCOA 3LMSA 4DYOA 3H8FA 4MHYA 3DDDA 3EC4A 2YGWA 3S6GA 2FXKA 4B5OA 4LUAA 4ORFA 2C1CA 2C6CA 4NJRA 2EK9A 4AVAA 3GPQA 3DNSA 2ZEOA 4MFLA 4F6AA 2QYVA 2X7BA 4JWPA 3EJGA 4GXHA 2K5TA 2XEFA 3RYOA 4GM5A 5J8FA 4II9A 3JZTA 2VL1A 4MI4A 4KVOE 4RUHA 3LWUA 3QNVA 3VWDA 3GPOA 2OZHA 2FAVA 2XEIA 3RO0A 2GFQA 3B3VA 3IU1A 4PK2A 4P4DA 3SHPA 3IWEA 3GPGA 2J8NA 1HEEA 2AFWA 5EBVA 1YR0A 4A31A 2PJBA 4UIAA 4BBHA 2Q4YA 1Y7EA 3VH9A 3K9TA 2AFZA 5CMSA 4IAVA 1WWZA 4H6ZA 4PK3A 4R3KA 1Z8WA 4KSAA 1NJRA 3EXNA 3S6FA 2DEAA 3MGDA 4ZYQA 2REFA 2C6PA 1OBRA 4A38A 3D4UA 2Z3OA 2P6GA 3FB3A 4HPSA 3A9LA 3GYAA 2BEIA 4NGSA 1VHEA 3S9LA 4J5QA 5LYFA 1A2ZA 2HB6A 5JH9A 2QIRA 4KUBA 4F9UA 1S3ZA 4Q36A 4W9YA 1HJZA 4UEEA 3R9EA 4XPKA 4CS0B 1VHUA 4FBEA 2Q4ZA 3C26A 3BLNA 3NE7A 4AVCA 3T90A 4B14A 5I0CA 3T9YA 3B7IA 3KGQA 1Z5RA 2WSAA 3B3SA 3CXQA 4OIDA 5AG4A 5F46A 1KWMA 4XNHC 3TE4A 1IU8A 2BUEA 3T8WA 5J1QA 1CJWA 1CBXA 4FAIA 1CG2A 4R87A 3RNZA 3CDXA 1TKJA 2FS5A 3PB8X 4KVME 2PSWA 4R57A 2DXQA 3KHZA 5HH1A 3KQXA 2KCWA 4NF1A 1QSRA 2R1IA 3PB7X 4MBUA 2OH1A 4R6TA 1XE4A 2NSMA 1HDUA 1I12A 3IJ3A 1R57A 3DR6A 2OZGA 3TOBA 2PJ6A 4A30A 2VRIA 4B6ZA 2PIYA 4F0XA 2QECA 4HKFA 4OC4A 4KOUA 4XPDC 5HVFA 3R9GA 1F57A 2AJ6A 3FJUA 3IWWA 3TOAA 1KUYA 1S7LA 4F0YA 3QAYA 2G0BA 4IQYA 1PUAA 3V2BA 1QSMA 3LODA 2ZEMA 1NMTA 2JDCA 2YNCA 4U5YA 3JTKA 4IHMA 3RZAA 1DTDA 1Z9UA 2YNCC 4C7HA 5LYDA 2JLMA 2Q0YA 5AG7A 5IV0A 5FVJA 3PFEA 1ARLA 3D3SA 4UEZA 3PB4X 1Q2YA 3Q71A 4UWJA 3IFEA 2BSWA 4NGQA 2EVNA 3NH4A 4GUAA 2FT0A 3ISZA 4PQAA 2EO8A 2PJ3A 1FY7A 2ZPAA 4A95A 3PBBA 4FD6A 3KQZA 1LFWA 4FUUA 3TT2A 1AYEA 5JGFA 2ACFA 2Q4VA 4MFPA 2BFQA 1RO5A 5CB3A 1XBUA 3EJFA 4JLYA 4R9MA 5A28A 4KOTA 4R8FA 3IIFA 3PBEA 1FT7A 3TX8A 2GU2A 4OP4A 4AG9A 2PE3A 4X5KA 4ZY2A 3FH4A 3D7GA 1YVKA 1YQEA 4XPLA 3ZJ0A 4FWUA 1VGYA 2VEZA 3IO1A 5C82A 1F2PA 1MJBA 4KSFA 1VIXA 3EFAA 1Y0RA 2J8MA 1VHSA 2PIZA 2QMLA 1IB1E 3SI0A 3W91A 4NGTA 1UWYA 2Z3NA 3GKRA 2V8DA 4R7MA 4MHDA 4C2XA 1P4NA 3F5BA 1BOBA 3TO9A 4NGRA 1KUVA 1S7KA 3JVNA 3R96A 3HLPA 3VFQA 1ZG8A 4CGPA 3CXPA 4P4BA 2VXKA 5D8NA 5A27A 4KORA 3FX6A 1DE4C 4OKOA 2WCTA 1LOKA 1PYTB 1Y9WA 1YLEA 1TF8A 5CNPA 3ETIA 3R1KA 4P44A 2ZW5A 3EY5A 4HNXB 2PRQA 4GVWA 1X10A 4HNYB 1Q2CA 3R95A 4NGPA 4DUKA 1IOFA 3NH8A 2HV2A 3EWQA 2B4BA 2GLJA 2P6EA 2B4DB 4CAWA 4CAVA 4QUSA 1NSLA 2PJ5A 4F8ZA 1CX8A 2ODFA 2PCUA 5LRGA 1CPSA 3FYNA 4NSQA 4F9VA 1ZLIA 2B3VA 2PRBA 3KR4A 1NSAA 3N5FA 4L8AA 3B2YA 4UFWA 4UCPA 2ANPA 2FXFA 3NFZA 3EKEA 1BAVA 4YU9A 3FVLA 3FEEA 1IYKA 1TXZA 4CYOA 2PJ7A 2WPXA 2FG1A 3GB0A 3K2KA 4O23A 2AFMA 2CF4A 2CIJA 2VQYA 4HNWB 3SJEA 1Z4EA 4E0AA 2B4DA 1YX0A 5E3BA 5E96A 3V45A 2RC4A 1JQGA 5DUSA 3D2PA 4M6HA 4H89A 4WWVA 3KI9A 2FCKA 8CPAA 5KTCA 4MFJA 1JWQA 1SQHA 4XNHB 3LACA 1XRYA 2LGRA 4A33A 4KS9A 1ZLHA 1HDQA 1Q2DA 3H5ZA 4Y49B 3VWEA 1ZO0A 4EMEA 5JM6A 1ZG7A 4CPAA 4OADA 4KOXA 4K30A 4OLLA 3FNCA 2ZELA 4ZX8A 1Z8LA 2ZEEA 2VZZA 4MFZA 5EMIA 4C2ZA 1TIQA 4A32A 3FXTA 3KL9A 2B58A 3SXNA 5HXDA 1H8LA 4CYQA 2V77A 4AVBA 4NCZA 3FF3A 2D4PA 2Y0MA 4XPDB 5K8MA 2OU2A 2AFUA 4ETKA 3PEIA 2EK8A 1TKFA 1UFHA 2PVWA 5THWA 1YSJA 2HC9A 2JDDA 3GLJA 2WYRA 5F48A 1LAMA 2HUZA 3N7ZA 1M4DA 2WPWA 4Y49C 1CP6A 4JXQA 3SI2A 3GQOA 4P4FA 4CAFA 4UF4A 2GE3A 1S5KA 1Z8XA 4DNCA 1U6MA 1LRZA 4OC0A 2CNSA 2F5IA 3SIJA 3BXMA 3OWCA 4NEXA 5K8PA 3SXOA 1Z2LA 2Q43A 2V8VA 3BHXA 3K9UA 3B35A 4BINA 1CPXA 2FIWA 5F09A 4B5PB 4J3GA 4CYPA 2IMOA 4K3NA 5HVGA 1LCPA 4KSIA 4MCSA 4CYNA 5KTDA 3GY9A 3WC5A 3SIGA 1R3NA 3NE8A 3F0AA 3P2HA 1QSNA 4B13A 2ZXVA 3KZWA 5ISVA 2NMTA 3S6KA 1ELMP 3DR8A 1NE9A 2EUIA 3D7HA 1OZPA 3CPAA 4C2YA 2GIVA 3L2NA 5LYIA 2J9AA 5FSYA 3GQEA 4B5PA 4M6IA 2B5GB 2DX6A 5AILA 4X2TA 3B3TA 4CGMA 1QSTA 4G1PA 3IU2A 4UCMA 4P4JA 4J5RA 4MCQA 5IB0A 4MFKA 4PXCA 2QVPA 3IGRA 4WJBA 1FNOA 4FD4A 3WT4A 2AFXA 1AUGA 4ABKA 2FSRA 4UFVA 4A94A 2HQYA 4OMEA 1YGHA 1MK4A 3F8KA 2V8HA 4R3LA 1VHOA 4P4EA 2B5GA 2KQVA 4OC2A 1LAPA 4MY0A 4AB7A 2CNMA 4KOWA 1B6BA 2G3TA 3TO7A 2GANA 3EWRA 2RB7A 3B3WA 3H8EA 1Q7LA 3CPXA 5FSUA 4OC5A 3S6HA 1IIDA 2FE7A 3DGVA 4ZI6A 5JQ4A 3I1UA 4KOYA 4UA3A 4PV6A 2Q51A 3FBUA 3PRTA 2ZW4A 4X8IA 1RTQA 3RBUA 5I4MA 1XF8A 3TTHA 4M6GA 1M4LA 2CNTA 1ZR3A 2Z10A 5JPHA 2POKA 4P6YA 4AG7A 4NGMA 4PSXA 4C68A 4ZGYB 4MY3A 1K4JA 1BO4A 3NA6A 2JEVA 4M85A 2PC1A 4UCNA 4YWYA 5IB9A 4E2AA 3D8PA 3LD2A 1YLOA 2P0WA 4KZTA 4AXVA 4YRHA 2PJ8A 3CXSA 3TC8A 2ZEDA 3QAHA 5K8NA 4DJLA 2AFCA 2ATRA 5DWNA 4TU0A 3SI1A 5AGEA 4EVYA 2YNEA 4CRYB 4JD6A 3JRUA 2I00A 1ZR5A 3I9SA 2RNKA 2ZOFA 5CBMA 4CGLA 4EFDA 3D67A 4MCRA 4MHNA 1ON0A 1GHEA 3HUVA 1R43A 3JUWA 4JJXA 2AFSA 3V8IA 2FL4A 2I3CA 5LRKA 2O53A 4E8OA 4KOSA 1TF9A 1XOVA 2P6FA 3EWOA 3FRMA 2ZEGA 1Z8TA 5EC4A 4UEFA 1VKCA 5HVHA 2A4NA 1BPNA 2DF5A 1KZFA 6CPAA 1EE3P 2VZYA 1LANA 3FMCA 4UMLA 2R98A 2VBQA 2V8GA 4OIWA 5K8OA 2FIAA 2I79A 4P10A 1YW6A 4ZY1A 1M44A 2OZUA 3BI1A 1BPMA 4MFQA 1IOIA 2PJ9A 4UIBA 1PU9A 4RN7A 5FSZA 4JCAA 2ZEFA 2QJ8A 2PJCA 3W6XA 4K0CA 4KLVA 4EWTA 5CB5A 3BI0A 1YW4A 4LX9A 4CGOA 4CRZB 1WK4A 3KHXA 4GS4A 4MXUA 4QB9A 3DLJA 4PSWA 1S7FA 2ZW7A 1F2OA 1XMTA 4ESSA 4M3SA 4Q38A 2DPSA 1IY7A 5H86A 3R9FA 3Q6ZA 5F49A 2REEA 2JZEA 2O4HA 4FD7A 4CAXA 3BJ7A 4U9YA 3CT9A 3D2MA 4ONUA 2J8RA 3SJFA 2CXAA 3V38A 2JEWA 2CTCA 2NYQA 3FIXA 2Z0ZA 3DSBA 1M4GA 3RAMA 5KTAA 3SJGA 2F8HA 4MCPA 1YD9A 3V7ZA 2X47A 4UFXA 4ONWA 4KVXA 4YGOA 2C6GA 2IJZA 2Q44A 4QC6A 1KUXA 4KUAA 2Q04A 3D68A 2WUUA 2WZNA 5IX3A 5FSVA 3EO4A
chains in the Genus database with same CATH topology
3H8GA 3D7DA 2PJAA 3GUXA 4D86A 2OR4A 4KYBA 4A39A 4Q7AA 3KR5A 3NH5A 4OC3A 4J4ZA 1IGBA 3FECA 2BOAA 4JYWA 1TKHA 3EW5A 3ISXA 2PJ0A 1AMPA 3S9MA 3S9NA 3IC1A 3SIIA 4Z65A 4NGNA 4PPZA 4PXDA 3MRUA 3PFOA 2EEEA 4A37A 4H2KA 2BFRA 2BO9A 4JVVA 4J5SA 2XEJA 1CP7A 4JLLA 3EWPA 4ETJA 1BLLE 4ZY0A 4TNUA 4P45A 2ZOGA 3PB9X 1TXRA 3VARA 2XD7A 2PVVA 4MMOA 3WC6A 1ELLP 2GLFA 2PJ4A 2CTBA 2RFHA 4MRIA 2OOTA 1GYTA 5DS0A 3SJXA 3SIHA 4NFRA 2ZEPA 4PXEA 1XFOA 2ABZA 1QQ9A 2FVGA 1ARMA 3VATA 5ELYA 2G9DA 2EWBA 5D29A 1ZG9A 1YMEA 4IK2A 2F7VA 1PCAA 5LRJA 2L8RA 3IIBA 4TWEA 5HOLA 2JBJA 4BD9A 3WC7A 3MN8A 3IIDA 4JGKA 4P4IA 5LYLA 4R76A 1Y0YA 3IEHA 2ZEHA 1QMUA 3PB6X 2PJ1A 4X3RA 4OC1A 2PJ2A 5CPAA 7CPAA 2ZENA 4NJQA 4MHZA 3D7FA 1SPVA 3D66A 4LQGA 4GVVA 2IQ6A 3FEDA 2GREA 4ZX9A 3B3CA 4ABLA 4MHPA 5HIHA 5FSXA 3KASA 2JBKA 2XEGA 4JZ0A 1XMBA 4PXBA 2AFOA 3WABA 1TY8A 1XJOA 2BCOA 3LMSA 4DYOA 3H8FA 4MHYA 2FXKA 2C1CA 2C6CA 4NJRA 2EK9A 3GPQA 2ZEOA 2QYVA 3EJGA 2XEFA 4GM5A 3JZTA 2VL1A 4RUHA 3LWUA 3QNVA 2XEIA 3GPOA 2FAVA 3B3VA 4P4DA 3GPGA 1HEEA 2AFWA 2PJBA 4UIAA 1Y7EA 3VH9A 3K9TA 2AFZA 5CMSA 4IAVA 1NJRA 2DEAA 4ZYQA 2C6PA 1OBRA 4A38A 3D4UA 3S9LA 4NGSA 1VHEA 4J5QA 5LYFA 2HB6A 5JH9A 4F9UA 4W9YA 1HJZA 4UEEA 1VHUA 4FBEA 2Q4ZA 3B7IA 3KGQA 1Z5RA 3B3SA 4OIDA 1KWMA 3T8WA 5J1QA 1CBXA 4FAIA 1CG2A 3CDXA 1TKJA 3PB8X 3KHZA 3KQXA 3PB7X 4R6TA 2NSMA 1HDUA 3IJ3A 2PJ6A 2VRIA 4B6ZA 2PIYA 4OC4A 5HVFA 1F57A 3FJUA 3IWWA 4IQYA 3V2BA 2ZEMA 3RZAA 4IHMA 1DTDA 5LYDA 3PFEA 1ARLA 4UEZA 3PB4X 3Q71A 3IFEA 4NGQA 3NH4A 4GUAA 3ISZA 4PQAA 2PJ3A 3PBBA 3KQZA 1LFWA 4FUUA 5JGFA 1AYEA 2ACFA 2BFQA 1XBUA 5CB3A 3EJFA 4R8FA 3IIFA 3PBEA 1FT7A 3TX8A 2GU2A 4OP4A 2PE3A 4ZY2A 3FH4A 3D7GA 4FWUA 1VGYA 3IO1A 1F2PA 1VIXA 1Y0RA 2PIZA 3SI0A 4NGTA 1UWYA 2V8DA 4R7MA 4NGRA 3HLPA 3VFQA 1ZG8A 4P4BA 5D8NA 4OKOA 3FX6A 1DE4C 1PYTB 1LOKA 1TF8A 3ETIA 4P44A 2PRQA 4GVWA 4NGPA 4DUKA 3NH8A 3EWQA 2GLJA 4F8ZA 2PJ5A 1CX8A 2PCUA 5LRGA 1CPSA 4F9VA 1ZLIA 3N5FA 3KR4A 1NSAA 3B2YA 4YU9A 2ANPA 3NFZA 3EKEA 1BAVA 3FVLA 3FEEA 1TXZA 2PJ7A 2FG1A 3GB0A 3K2KA 4O23A 2AFMA 2CF4A 2CIJA 3SJEA 5E3BA 3V45A 1JQGA 5DUSA 4WWVA 3KI9A 8CPAA 1XRYA 2LGRA 1ZLHA 1HDQA 4EMEA 5JM6A 1ZG7A 4CPAA 2ZELA 4ZX8A 1Z8LA 2ZEEA 3KL9A 5HXDA 1H8LA 2V77A 3FF3A 5K8MA 2AFUA 4ETKA 3PEIA 2EK8A 1TKFA 2PVWA 5THWA 1YSJA 2HC9A 3GLJA 2WYRA 1LAMA 1CP6A 3SI2A 3GQOA 4P4FA 4UF4A 4OC0A 3SIJA 3BXMA 5K8PA 1Z2LA 2Q43A 2V8VA 3BHXA 3B35A 1CPXA 5F09A 2IMOA 4K3NA 5HVGA 1LCPA 4KSIA 4MCSA 3WC5A 3SIGA 1R3NA 3KZWA 1ELMP 3D7HA 3CPAA 3L2NA 5LYIA 2J9AA 5FSYA 3GQEA 2DX6A 5AILA 4X2TA 3B3TA 4G1PA 4P4JA 4J5RA 4MCQA 4PXCA 2QVPA 4WJBA 1FNOA 3WT4A 2AFXA 4ABKA 4A94A 4OMEA 2V8HA 1VHOA 4P4EA 4OC2A 1LAPA 2RB7A 3EWRA 3B3WA 3CPXA 3H8EA 1Q7LA 4OC5A 5FSUA 3DGVA 4ZI6A 3I1UA 4X8IA 2Q51A 3PRTA 1RTQA 3RBUA 5I4MA 1M4LA 1ZR3A 2POKA 4P6YA 4NGMA 3NA6A 4YWYA 5IB9A 1YLOA 4AXVA 3TC8A 2PJ8A 2ZEDA 5K8NA 4DJLA 2AFCA 4TU0A 3SI1A 3JRUA 1ZR5A 2ZOFA 5CBMA 4EFDA 3D67A 4MCRA 4MHNA 3HUVA 1R43A 2AFSA 2I3CA 5LRKA 2O53A 1TF9A 3EWOA 2ZEGA 4UEFA 5HVHA 1BPNA 6CPAA 1EE3P 5K8OA 1LANA 3FMCA 4UMLA 4OIWA 2V8GA 1YW6A 4ZY1A 3BI1A 1BPMA 2PJ9A 4UIBA 5FSZA 4JCAA 2ZEFA 2QJ8A 2PJCA 4K0CA 4EWTA 5CB5A 3BI0A 1YW4A 3KHXA 4MXUA 3DLJA 1F2OA 4ESSA 1IY7A 3Q6ZA 2O4HA 3CT9A 3V38A 3SJFA 2JEWA 2CTCA 2NYQA 3RAMA 3SJGA 2F8HA 4MCPA 1YD9A 3V7ZA 2X47A 4ONWA 2C6GA 2IJZA 3D68A 2WZNA 5FSVA 4P10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8G A;  3D7D A;  2PJA A;  3GUX A;  4D86 A;  2OR4 A;  4KYB A;  4A39 A;  4Q7A A;  3KR5 A;  3NH5 A;  4OC3 A;  4J4Z A;  1IGB A;  3FEC A;  2BOA A;  4JYW A;  1TKH A;  3EW5 A;  3ISX A;  2PJ0 A;  1AMP A;  3S9M A;  3S9N A;  3IC1 A;  3SII A;  4Z65 A;  4NGN A;  4PPZ A;  4PXD A;  3MRU A;  3PFO A;  2EEE A;  4A37 A;  4H2K A;  2BFR A;  2BO9 A;  4JVV A;  4J5S A;  2XEJ A;  1CP7 A;  4JLL A;  3EWP A;  4ETJ A;  1BLL E;  4ZY0 A;  4TNU A;  4P45 A;  2ZOG A;  3PB9 X;  1TXR A;  3VAR A;  2XD7 A;  2PVV A;  4MMO A;  3WC6 A;  1ELL P;  2GLF A;  2PJ4 A;  2CTB A;  2RFH A;  4MRI A;  2OOT A;  1GYT A;  5DS0 A;  3SJX A;  3SIH A;  4NFR A;  2ZEP A;  4PXE A;  1XFO A;  2ABZ A;  1QQ9 A;  2FVG A;  1ARM A;  3VAT A;  5ELY A;  2G9D A;  2EWB A;  5D29 A;  1ZG9 A;  1YME A;  4IK2 A;  2F7V A;  1PCA A;  5LRJ A;  2L8R A;  3IIB A;  4TWE A;  5HOL A;  2JBJ A;  4BD9 A;  3WC7 A;  3MN8 A;  3IID A;  4JGK A;  4P4I A;  5LYL A;  4R76 A;  1Y0Y A;  3IEH A;  2ZEH A;  1QMU A;  3PB6 X;  2PJ1 A;  4X3R A;  4OC1 A;  2PJ2 A;  5CPA A;  7CPA A;  2ZEN A;  4NJQ A;  4MHZ A;  3D7F A;  1SPV A;  3D66 A;  4LQG A;  4GVV A;  2IQ6 A;  3FED A;  2GRE A;  4ZX9 A;  3B3C A;  4ABL A;  4MHP A;  5HIH A;  5FSX A;  3KAS A;  2JBK A;  2XEG A;  4JZ0 A;  1XMB A;  4PXB A;  2AFO A;  3WAB A;  1TY8 A;  1XJO A;  2BCO A;  3LMS A;  4DYO A;  3H8F A;  4MHY A;  2FXK A;  2C1C A;  2C6C A;  4NJR A;  2EK9 A;  3GPQ A;  2ZEO A;  2QYV A;  3EJG A;  2XEF A;  4GM5 A;  3JZT A;  2VL1 A;  4RUH A;  3LWU A;  3QNV A;  2XEI A;  3GPO A;  2FAV A;  3B3V A;  4P4D A;  3GPG A;  1HEE A;  2AFW A;  2PJB A;  4UIA A;  1Y7E A;  3VH9 A;  3K9T A;  2AFZ A;  5CMS A;  4IAV A;  1NJR A;  2DEA A;  4ZYQ A;  2C6P A;  1OBR A;  4A38 A;  3D4U A;  3S9L A;  4NGS A;  1VHE A;  4J5Q A;  5LYF A;  2HB6 A;  5JH9 A;  4F9U A;  4W9Y A;  1HJZ A;  4UEE A;  1VHU A;  4FBE A;  2Q4Z A;  3B7I A;  3KGQ A;  1Z5R A;  3B3S A;  4OID A;  1KWM A;  3T8W A;  5J1Q A;  1CBX A;  4FAI A;  1CG2 A;  3CDX A;  1TKJ A;  3PB8 X;  3KHZ A;  3KQX A;  3PB7 X;  4R6T A;  2NSM A;  1HDU A;  3IJ3 A;  2PJ6 A;  2VRI A;  4B6Z A;  2PIY A;  4OC4 A;  5HVF A;  1F57 A;  3FJU A;  3IWW A;  4IQY A;  3V2B A;  2ZEM A;  3RZA A;  4IHM A;  1DTD A;  5LYD A;  3PFE A;  1ARL A;  4UEZ A;  3PB4 X;  3Q71 A;  3IFE A;  4NGQ A;  3NH4 A;  4GUA A;  3ISZ A;  4PQA A;  2PJ3 A;  3PBB A;  3KQZ A;  1LFW A;  4FUU A;  5JGF A;  1AYE A;  2ACF A;  2BFQ A;  1XBU A;  5CB3 A;  3EJF A;  4R8F A;  3IIF A;  3PBE A;  1FT7 A;  3TX8 A;  2GU2 A;  4OP4 A;  2PE3 A;  4ZY2 A;  3FH4 A;  3D7G A;  4FWU A;  1VGY A;  3IO1 A;  1F2P A;  1VIX A;  1Y0R A;  2PIZ A;  3SI0 A;  4NGT A;  1UWY A;  2V8D A;  4R7M A;  4NGR A;  3HLP A;  3VFQ A;  1ZG8 A;  4P4B A;  5D8N A;  4OKO A;  3FX6 A;  1DE4 C;  1PYT B;  1LOK A;  1TF8 A;  3ETI A;  4P44 A;  2PRQ A;  4GVW A;  4NGP A;  4DUK A;  3NH8 A;  3EWQ A;  2GLJ A;  4F8Z A;  2PJ5 A;  1CX8 A;  2PCU A;  5LRG A;  1CPS A;  4F9V A;  1ZLI A;  3N5F A;  3KR4 A;  1NSA A;  3B2Y A;  4YU9 A;  2ANP A;  3NFZ A;  3EKE A;  1BAV A;  3FVL A;  3FEE A;  1TXZ A;  2PJ7 A;  2FG1 A;  3GB0 A;  3K2K A;  4O23 A;  2AFM A;  2CF4 A;  2CIJ A;  3SJE A;  5E3B A;  3V45 A;  1JQG A;  5DUS A;  4WWV A;  3KI9 A;  8CPA A;  1XRY A;  2LGR A;  1ZLH A;  1HDQ A;  4EME A;  5JM6 A;  1ZG7 A;  4CPA A;  2ZEL A;  4ZX8 A;  1Z8L A;  2ZEE A;  3KL9 A;  5HXD A;  1H8L A;  2V77 A;  3FF3 A;  5K8M A;  2AFU A;  4ETK A;  3PEI A;  2EK8 A;  1TKF A;  2PVW A;  5THW A;  1YSJ A;  2HC9 A;  3GLJ A;  2WYR A;  1LAM A;  1CP6 A;  3SI2 A;  3GQO A;  4P4F A;  4UF4 A;  4OC0 A;  3SIJ A;  3BXM A;  5K8P A;  1Z2L A;  2Q43 A;  2V8V A;  3BHX A;  3B35 A;  1CPX A;  5F09 A;  2IMO A;  4K3N A;  5HVG A;  1LCP A;  4KSI A;  4MCS A;  3WC5 A;  3SIG A;  1R3N A;  3KZW A;  1ELM P;  3D7H A;  3CPA A;  3L2N A;  5LYI A;  2J9A A;  5FSY A;  3GQE A;  2DX6 A;  5AIL A;  4X2T A;  3B3T A;  4G1P A;  4P4J A;  4J5R A;  4MCQ A;  4PXC A;  2QVP A;  4WJB A;  1FNO A;  3WT4 A;  2AFX A;  4ABK A;  4A94 A;  4OME A;  2V8H A;  1VHO A;  4P4E A;  4OC2 A;  1LAP A;  2RB7 A;  3EWR A;  3B3W A;  3CPX A;  3H8E A;  1Q7L A;  4OC5 A;  5FSU A;  3DGV A;  4ZI6 A;  3I1U A;  4X8I A;  2Q51 A;  3PRT A;  1RTQ A;  3RBU A;  5I4M A;  1M4L A;  1ZR3 A;  2POK A;  4P6Y A;  4NGM A;  3NA6 A;  4YWY A;  5IB9 A;  1YLO A;  4AXV A;  3TC8 A;  2PJ8 A;  2ZED A;  5K8N A;  4DJL A;  2AFC A;  4TU0 A;  3SI1 A;  3JRU A;  1ZR5 A;  2ZOF A;  5CBM A;  4EFD A;  3D67 A;  4MCR A;  4MHN A;  3HUV A;  1R43 A;  2AFS A;  2I3C A;  5LRK A;  2O53 A;  1TF9 A;  3EWO A;  2ZEG A;  4UEF A;  5HVH A;  1BPN A;  6CPA A;  1EE3 P;  5K8O A;  1LAN A;  3FMC A;  4UML A;  4OIW A;  2V8G A;  1YW6 A;  4ZY1 A;  3BI1 A;  1BPM A;  2PJ9 A;  4UIB A;  5FSZ A;  4JCA A;  2ZEF A;  2QJ8 A;  2PJC A;  4K0C A;  4EWT A;  5CB5 A;  3BI0 A;  1YW4 A;  3KHX A;  4MXU A;  3DLJ A;  1F2O A;  4ESS A;  1IY7 A;  3Q6Z A;  2O4H A;  3CT9 A;  3V38 A;  3SJF A;  2JEW A;  2CTC A;  2NYQ A;  3RAM A;  3SJG A;  2F8H A;  4MCP A;  1YD9 A;  3V7Z A;  2X47 A;  4ONW A;  2C6G A;  2IJZ A;  3D68 A;  2WZN A;  5FSV A;  4P10 A; 
#chains in the Genus database with same CATH topology
 3H8G A;  1B87 A;  1Z4R A;  2JZF A;  2W2G A;  3D7D A;  2PJA A;  1IYL A;  3GUX A;  4D86 A;  2OR4 A;  4KLW A;  4KYB A;  3H4Q A;  4A39 A;  4Q7A A;  3KR5 A;  3NH5 A;  4OC3 A;  4J4Z A;  1IGB A;  3FEC A;  2D4O A;  1M4I A;  2BOA A;  2R8V A;  4JYW A;  1TKH A;  4I49 A;  3EW5 A;  3ISX A;  2AE6 A;  2PJ0 A;  1AMP A;  2EBJ A;  3PZJ A;  3S9M A;  3S9N A;  5J8C A;  3IC1 A;  3SII A;  2Q7B A;  4Z65 A;  1M1D A;  1S60 A;  4NGN A;  4L89 A;  4PPZ A;  4PXD A;  3MRU A;  1CM0 A;  3PFO A;  4QVT A;  2EEE A;  3PGP A;  5G22 A;  4H2K A;  4A37 A;  3E0K A;  2BFR A;  2BO9 A;  4MJ8 A;  4JVV A;  4J5S A;  4RI1 A;  2XEJ A;  3ZZI A;  1CP7 A;  3GIU A;  5AG5 A;  4JLL A;  5BWA B;  1I1D A;  3EWP A;  4IF5 A;  4ETJ A;  2G3A A;  1BLL E;  4ZY0 A;  4TNU A;  4BMH A;  2O28 A;  3I3G A;  1XEB A;  4P45 A;  2JZD A;  2ZOG A;  1TXR A;  3PB9 X;  1RXT A;  2XD7 A;  1QSO A;  2ZW6 A;  3CZX A;  2DPT A;  3TO6 A;  3VAR A;  2PVV A;  4MMO A;  3PP9 A;  2H5M A;  3WC6 A;  3W6S A;  1ELL P;  2GLF A;  2PJ4 A;  2CTB A;  2RFH A;  4MRI A;  5G1Z A;  2OOT A;  5G21 A;  5C88 A;  1GYT A;  2PR8 A;  5DS0 A;  3SJX A;  3SIH A;  2IL4 A;  2ZEP A;  4NFR A;  4PXE A;  4A2Z A;  1XFO A;  2ABZ A;  1QQ9 A;  2FVG A;  1ARM A;  5F47 A;  3VAT A;  5ELY A;  4B10 A;  2G9D A;  2EWB A;  2PR1 A;  5D29 A;  1ZG9 A;  4UBR A;  1YME A;  2Z3L A;  4IK2 A;  5AG6 A;  3WR7 A;  2F7V A;  1PCA A;  5LRJ A;  2L8R A;  1Y9K A;  3IIB A;  4TWE A;  3B8G A;  5HOL A;  1XIX A;  2JBJ A;  4BD9 A;  1L0C A;  3TFY A;  3WC7 A;  3MN8 A;  3IID A;  4JGK A;  4P4I A;  4B12 A;  4KOV A;  5LYL A;  2ARH A;  5GCN A;  4R76 A;  1Y0Y A;  1J4J A;  1YRE A;  2ZEH A;  3IEH A;  4FD5 A;  4H6U A;  1QMU A;  1V0C A;  1X12 A;  1MJA A;  3KKW A;  1S7N A;  1IIC A;  1P0H A;  2VI7 A;  2OB0 A;  3PB6 X;  2PJ1 A;  1MJ9 A;  4X3R A;  1N71 A;  3P2F A;  3BJ8 A;  4OC1 A;  2PJ2 A;  5CPA A;  2YND A;  2Z3M A;  5HMN A;  7CPA A;  3UY5 A;  1YK3 A;  4B11 A;  2ZEN A;  4NJQ A;  2BL1 A;  2Z11 A;  3D7F A;  1SPV A;  3D66 A;  3QB8 A;  4MHZ A;  5G20 A;  4LQG A;  4UWI A;  4GVV A;  2IQ6 A;  3FED A;  4LQ6 A;  2GRE A;  2CY2 A;  4NXY A;  3TCV A;  4YFJ A;  4ZX9 A;  4QBJ A;  3B3C A;  2R7H A;  2B3U A;  4ZBG A;  4U9Z A;  4ABL A;  5H84 A;  4OAE A;  3G3S A;  3G8W A;  4JXR A;  4MHP A;  5HIH A;  4RS2 A;  5FSX A;  3KAS A;  1Y7R A;  2JBK A;  2PQ8 A;  4C7I A;  2XEG A;  2Z3P A;  4JZ0 A;  4CAE A;  1XMB A;  2PDO A;  2Q7S A;  4IUS A;  4PXB A;  1YVO A;  1I21 A;  2AFO A;  3IWG A;  3WAB A;  5DWM A;  2Z3K A;  4CGN A;  2C27 A;  1TY8 A;  1XJO A;  2BCO A;  3LMS A;  4DYO A;  3H8F A;  4MHY A;  3DDD A;  3EC4 A;  2YGW A;  3S6G A;  2FXK A;  4B5O A;  4LUA A;  4ORF A;  2C1C A;  2C6C A;  4NJR A;  2EK9 A;  4AVA A;  3GPQ A;  3DNS A;  2ZEO A;  4MFL A;  4F6A A;  2QYV A;  2X7B A;  4JWP A;  3EJG A;  4GXH A;  2K5T A;  2XEF A;  3RYO A;  4GM5 A;  5J8F A;  4II9 A;  3JZT A;  2VL1 A;  4MI4 A;  4KVO E;  4RUH A;  3LWU A;  3QNV A;  3VWD A;  3GPO A;  2OZH A;  2FAV A;  2XEI A;  3RO0 A;  2GFQ A;  3B3V A;  3IU1 A;  4PK2 A;  4P4D A;  3SHP A;  3IWE A;  3GPG A;  2J8N A;  1HEE A;  2AFW A;  5EBV A;  1YR0 A;  4A31 A;  2PJB A;  4UIA A;  4BBH A;  2Q4Y A;  1Y7E A;  3VH9 A;  3K9T A;  2AFZ A;  5CMS A;  4IAV A;  1WWZ A;  4H6Z A;  4PK3 A;  4R3K A;  1Z8W A;  4KSA A;  1NJR A;  3EXN A;  3S6F A;  2DEA A;  3MGD A;  4ZYQ A;  2REF A;  2C6P A;  1OBR A;  4A38 A;  3D4U A;  2Z3O A;  2P6G A;  3FB3 A;  4HPS A;  3A9L A;  3GYA A;  2BEI A;  4NGS A;  1VHE A;  3S9L A;  4J5Q A;  5LYF A;  1A2Z A;  2HB6 A;  5JH9 A;  2QIR A;  4KUB A;  4F9U A;  1S3Z A;  4Q36 A;  4W9Y A;  1HJZ A;  4UEE A;  3R9E A;  4XPK A;  4CS0 B;  1VHU A;  4FBE A;  2Q4Z A;  3C26 A;  3BLN A;  3NE7 A;  4AVC A;  3T90 A;  4B14 A;  5I0C A;  3T9Y A;  3B7I A;  3KGQ A;  1Z5R A;  2WSA A;  3B3S A;  3CXQ A;  4OID A;  5AG4 A;  5F46 A;  1KWM A;  4XNH C;  3TE4 A;  1IU8 A;  2BUE A;  3T8W A;  5J1Q A;  1CJW A;  1CBX A;  4FAI A;  1CG2 A;  4R87 A;  3RNZ A;  3CDX A;  1TKJ A;  2FS5 A;  3PB8 X;  4KVM E;  2PSW A;  4R57 A;  2DXQ A;  3KHZ A;  5HH1 A;  3KQX A;  2KCW A;  4NF1 A;  1QSR A;  2R1I A;  3PB7 X;  4MBU A;  2OH1 A;  4R6T A;  1XE4 A;  2NSM A;  1HDU A;  1I12 A;  3IJ3 A;  1R57 A;  3DR6 A;  2OZG A;  3TOB A;  2PJ6 A;  4A30 A;  2VRI A;  4B6Z A;  2PIY A;  4F0X A;  2QEC A;  4HKF A;  4OC4 A;  4KOU A;  4XPD C;  5HVF A;  3R9G A;  1F57 A;  2AJ6 A;  3FJU A;  3IWW A;  3TOA A;  1KUY A;  1S7L A;  4F0Y A;  3QAY A;  2G0B A;  4IQY A;  1PUA A;  3V2B A;  1QSM A;  3LOD A;  2ZEM A;  1NMT A;  2JDC A;  2YNC A;  4U5Y A;  3JTK A;  4IHM A;  3RZA A;  1DTD A;  1Z9U A;  2YNC C;  4C7H A;  5LYD A;  2JLM A;  2Q0Y A;  5AG7 A;  5IV0 A;  5FVJ A;  3PFE A;  1ARL A;  3D3S A;  4UEZ A;  3PB4 X;  1Q2Y A;  3Q71 A;  4UWJ A;  3IFE A;  2BSW A;  4NGQ A;  2EVN A;  3NH4 A;  4GUA A;  2FT0 A;  3ISZ A;  4PQA A;  2EO8 A;  2PJ3 A;  1FY7 A;  2ZPA A;  4A95 A;  3PBB A;  4FD6 A;  3KQZ A;  1LFW A;  4FUU A;  3TT2 A;  1AYE A;  5JGF A;  2ACF A;  2Q4V A;  4MFP A;  2BFQ A;  1RO5 A;  5CB3 A;  1XBU A;  3EJF A;  4JLY A;  4R9M A;  5A28 A;  4KOT A;  4R8F A;  3IIF A;  3PBE A;  1FT7 A;  3TX8 A;  2GU2 A;  4OP4 A;  4AG9 A;  2PE3 A;  4X5K A;  4ZY2 A;  3FH4 A;  3D7G A;  1YVK A;  1YQE A;  4XPL A;  3ZJ0 A;  4FWU A;  1VGY A;  2VEZ A;  3IO1 A;  5C82 A;  1F2P A;  1MJB A;  4KSF A;  1VIX A;  3EFA A;  1Y0R A;  2J8M A;  1VHS A;  2PIZ A;  2QML A;  1IB1 E;  3SI0 A;  3W91 A;  4NGT A;  1UWY A;  2Z3N A;  3GKR A;  2V8D A;  4R7M A;  4MHD A;  4C2X A;  1P4N A;  3F5B A;  1BOB A;  3TO9 A;  4NGR A;  1KUV A;  1S7K A;  3JVN A;  3R96 A;  3HLP A;  3VFQ A;  1ZG8 A;  4CGP A;  3CXP A;  4P4B A;  2VXK A;  5D8N A;  5A27 A;  4KOR A;  3FX6 A;  1DE4 C;  4OKO A;  2WCT A;  1LOK A;  1PYT B;  1Y9W A;  1YLE A;  1TF8 A;  5CNP A;  3ETI A;  3R1K A;  4P44 A;  2ZW5 A;  3EY5 A;  4HNX B;  2PRQ A;  4GVW A;  1X10 A;  4HNY B;  1Q2C A;  3R95 A;  4NGP A;  4DUK A;  1IOF A;  3NH8 A;  2HV2 A;  3EWQ A;  2B4B A;  2GLJ A;  2P6E A;  2B4D B;  4CAW A;  4CAV A;  4QUS A;  1NSL A;  2PJ5 A;  4F8Z A;  1CX8 A;  2ODF A;  2PCU A;  5LRG A;  1CPS A;  3FYN A;  4NSQ A;  4F9V A;  1ZLI A;  2B3V A;  2PRB A;  3KR4 A;  1NSA A;  3N5F A;  4L8A A;  3B2Y A;  4UFW A;  4UCP A;  2ANP A;  2FXF A;  3NFZ A;  3EKE A;  1BAV A;  4YU9 A;  3FVL A;  3FEE A;  1IYK A;  1TXZ A;  4CYO A;  2PJ7 A;  2WPX A;  2FG1 A;  3GB0 A;  3K2K A;  4O23 A;  2AFM A;  2CF4 A;  2CIJ A;  2VQY A;  4HNW B;  3SJE A;  1Z4E A;  4E0A A;  2B4D A;  1YX0 A;  5E3B A;  5E96 A;  3V45 A;  2RC4 A;  1JQG A;  5DUS A;  3D2P A;  4M6H A;  4H89 A;  4WWV A;  3KI9 A;  2FCK A;  8CPA A;  5KTC A;  4MFJ A;  1JWQ A;  1SQH A;  4XNH B;  3LAC A;  1XRY A;  2LGR A;  4A33 A;  4KS9 A;  1ZLH A;  1HDQ A;  1Q2D A;  3H5Z A;  4Y49 B;  3VWE A;  1ZO0 A;  4EME A;  5JM6 A;  1ZG7 A;  4CPA A;  4OAD A;  4KOX A;  4K30 A;  4OLL A;  3FNC A;  2ZEL A;  4ZX8 A;  1Z8L A;  2ZEE A;  2VZZ A;  4MFZ A;  5EMI A;  4C2Z A;  1TIQ A;  4A32 A;  3FXT A;  3KL9 A;  2B58 A;  3SXN A;  5HXD A;  1H8L A;  4CYQ A;  2V77 A;  4AVB A;  4NCZ A;  3FF3 A;  2D4P A;  2Y0M A;  4XPD B;  5K8M A;  2OU2 A;  2AFU A;  4ETK A;  3PEI A;  2EK8 A;  1TKF A;  1UFH A;  2PVW A;  5THW A;  1YSJ A;  2HC9 A;  2JDD A;  3GLJ A;  2WYR A;  5F48 A;  1LAM A;  2HUZ A;  3N7Z A;  1M4D A;  2WPW A;  4Y49 C;  1CP6 A;  4JXQ A;  3SI2 A;  3GQO A;  4P4F A;  4CAF A;  4UF4 A;  2GE3 A;  1S5K A;  1Z8X A;  4DNC A;  1U6M A;  1LRZ A;  4OC0 A;  2CNS A;  2F5I A;  3SIJ A;  3BXM A;  3OWC A;  4NEX A;  5K8P A;  3SXO A;  1Z2L A;  2Q43 A;  2V8V A;  3BHX A;  3K9U A;  3B35 A;  4BIN A;  1CPX A;  2FIW A;  5F09 A;  4B5P B;  4J3G A;  4CYP A;  2IMO A;  4K3N A;  5HVG A;  1LCP A;  4KSI A;  4MCS A;  4CYN A;  5KTD A;  3GY9 A;  3WC5 A;  3SIG A;  1R3N A;  3NE8 A;  3F0A A;  3P2H A;  1QSN A;  4B13 A;  2ZXV A;  3KZW A;  5ISV A;  2NMT A;  3S6K A;  1ELM P;  3DR8 A;  1NE9 A;  2EUI A;  3D7H A;  1OZP A;  3CPA A;  4C2Y A;  2GIV A;  3L2N A;  5LYI A;  2J9A A;  5FSY A;  3GQE A;  4B5P A;  4M6I A;  2B5G B;  2DX6 A;  5AIL A;  4X2T A;  3B3T A;  4CGM A;  1QST A;  4G1P A;  3IU2 A;  4UCM A;  4P4J A;  4J5R A;  4MCQ A;  5IB0 A;  4MFK A;  4PXC A;  2QVP A;  3IGR A;  4WJB A;  1FNO A;  4FD4 A;  3WT4 A;  2AFX A;  1AUG A;  4ABK A;  2FSR A;  4UFV A;  4A94 A;  2HQY A;  4OME A;  1YGH A;  1MK4 A;  3F8K A;  2V8H A;  4R3L A;  1VHO A;  4P4E A;  2B5G A;  2KQV A;  4OC2 A;  1LAP A;  4MY0 A;  4AB7 A;  2CNM A;  4KOW A;  1B6B A;  2G3T A;  3TO7 A;  2GAN A;  3EWR A;  2RB7 A;  3B3W A;  3H8E A;  1Q7L A;  3CPX A;  5FSU A;  4OC5 A;  3S6H A;  1IID A;  2FE7 A;  3DGV A;  4ZI6 A;  5JQ4 A;  3I1U A;  4KOY A;  4UA3 A;  4PV6 A;  2Q51 A;  3FBU A;  3PRT A;  2ZW4 A;  4X8I A;  1RTQ A;  3RBU A;  5I4M A;  1XF8 A;  3TTH A;  4M6G A;  1M4L A;  2CNT A;  1ZR3 A;  2Z10 A;  5JPH A;  2POK A;  4P6Y A;  4AG7 A;  4NGM A;  4PSX A;  4C68 A;  4ZGY B;  4MY3 A;  1K4J A;  1BO4 A;  3NA6 A;  2JEV A;  4M85 A;  2PC1 A;  4UCN A;  4YWY A;  5IB9 A;  4E2A A;  3D8P A;  3LD2 A;  1YLO A;  2P0W A;  4KZT A;  4AXV A;  4YRH A;  2PJ8 A;  3CXS A;  3TC8 A;  2ZED A;  3QAH A;  5K8N A;  4DJL A;  2AFC A;  2ATR A;  5DWN A;  4TU0 A;  3SI1 A;  5AGE A;  4EVY A;  2YNE A;  4CRY B;  4JD6 A;  3JRU A;  2I00 A;  1ZR5 A;  3I9S A;  2RNK A;  2ZOF A;  5CBM A;  4CGL A;  4EFD A;  3D67 A;  4MCR A;  4MHN A;  1ON0 A;  1GHE A;  3HUV A;  1R43 A;  3JUW A;  4JJX A;  2AFS A;  3V8I A;  2FL4 A;  2I3C A;  5LRK A;  2O53 A;  4E8O A;  4KOS A;  1TF9 A;  1XOV A;  2P6F A;  3EWO A;  3FRM A;  2ZEG A;  1Z8T A;  5EC4 A;  4UEF A;  1VKC A;  5HVH A;  2A4N A;  1BPN A;  2DF5 A;  1KZF A;  6CPA A;  1EE3 P;  2VZY A;  1LAN A;  3FMC A;  4UML A;  2R98 A;  2VBQ A;  2V8G A;  4OIW A;  5K8O A;  2FIA A;  2I79 A;  4P10 A;  1YW6 A;  4ZY1 A;  1M44 A;  2OZU A;  3BI1 A;  1BPM A;  4MFQ A;  1IOI A;  2PJ9 A;  4UIB A;  1PU9 A;  4RN7 A;  5FSZ A;  4JCA A;  2ZEF A;  2QJ8 A;  2PJC A;  3W6X A;  4K0C A;  4KLV A;  4EWT A;  5CB5 A;  3BI0 A;  1YW4 A;  4LX9 A;  4CGO A;  4CRZ B;  1WK4 A;  3KHX A;  4GS4 A;  4MXU A;  4QB9 A;  3DLJ A;  4PSW A;  1S7F A;  2ZW7 A;  1F2O A;  1XMT A;  4ESS A;  4M3S A;  4Q38 A;  2DPS A;  1IY7 A;  5H86 A;  3R9F A;  3Q6Z A;  5F49 A;  2REE A;  2JZE A;  2O4H A;  4FD7 A;  4CAX A;  3BJ7 A;  4U9Y A;  3CT9 A;  3D2M A;  4ONU A;  2J8R A;  3SJF A;  2CXA A;  3V38 A;  2JEW A;  2CTC A;  2NYQ A;  3FIX A;  2Z0Z A;  3DSB A;  1M4G A;  3RAM A;  5KTA A;  3SJG A;  2F8H A;  4MCP A;  1YD9 A;  3V7Z A;  2X47 A;  4UFX A;  4ONW A;  4KVX A;  4YGO A;  2C6G A;  2IJZ A;  2Q44 A;  4QC6 A;  1KUX A;  4KUA A;  2Q04 A;  3D68 A;  2WUU A;  2WZN A;  5IX3 A;  5FSV A;  3EO4 A; 
#chains in the Genus database with same CATH homology
 3H8G A;  3D7D A;  2PJA A;  3GUX A;  4D86 A;  2OR4 A;  4KYB A;  4A39 A;  4Q7A A;  3KR5 A;  3NH5 A;  4OC3 A;  4J4Z A;  1IGB A;  3FEC A;  2BOA A;  4JYW A;  1TKH A;  3EW5 A;  3ISX A;  2PJ0 A;  1AMP A;  3S9M A;  3S9N A;  3IC1 A;  3SII A;  4Z65 A;  4NGN A;  4PPZ A;  4PXD A;  3MRU A;  3PFO A;  2EEE A;  4A37 A;  4H2K A;  2BFR A;  2BO9 A;  4JVV A;  4J5S A;  2XEJ A;  1CP7 A;  4JLL A;  3EWP A;  4ETJ A;  1BLL E;  4ZY0 A;  4TNU A;  4P45 A;  2ZOG A;  3PB9 X;  1TXR A;  3VAR A;  2XD7 A;  2PVV A;  4MMO A;  3WC6 A;  1ELL P;  2GLF A;  2PJ4 A;  2CTB A;  2RFH A;  4MRI A;  2OOT A;  1GYT A;  5DS0 A;  3SJX A;  3SIH A;  4NFR A;  2ZEP A;  4PXE A;  1XFO A;  2ABZ A;  1QQ9 A;  2FVG A;  1ARM A;  3VAT A;  5ELY A;  2G9D A;  2EWB A;  5D29 A;  1ZG9 A;  1YME A;  4IK2 A;  2F7V A;  1PCA A;  5LRJ A;  2L8R A;  3IIB A;  4TWE A;  5HOL A;  2JBJ A;  4BD9 A;  3WC7 A;  3MN8 A;  3IID A;  4JGK A;  4P4I A;  5LYL A;  4R76 A;  1Y0Y A;  3IEH A;  2ZEH A;  1QMU A;  3PB6 X;  2PJ1 A;  4X3R A;  4OC1 A;  2PJ2 A;  5CPA A;  7CPA A;  2ZEN A;  4NJQ A;  4MHZ A;  3D7F A;  1SPV A;  3D66 A;  4LQG A;  4GVV A;  2IQ6 A;  3FED A;  2GRE A;  4ZX9 A;  3B3C A;  4ABL A;  4MHP A;  5HIH A;  5FSX A;  3KAS A;  2JBK A;  2XEG A;  4JZ0 A;  1XMB A;  4PXB A;  2AFO A;  3WAB A;  1TY8 A;  1XJO A;  2BCO A;  3LMS A;  4DYO A;  3H8F A;  4MHY A;  2FXK A;  2C1C A;  2C6C A;  4NJR A;  2EK9 A;  3GPQ A;  2ZEO A;  2QYV A;  3EJG A;  2XEF A;  4GM5 A;  3JZT A;  2VL1 A;  4RUH A;  3LWU A;  3QNV A;  2XEI A;  3GPO A;  2FAV A;  3B3V A;  4P4D A;  3GPG A;  1HEE A;  2AFW A;  2PJB A;  4UIA A;  1Y7E A;  3VH9 A;  3K9T A;  2AFZ A;  5CMS A;  4IAV A;  1NJR A;  2DEA A;  4ZYQ A;  2C6P A;  1OBR A;  4A38 A;  3D4U A;  3S9L A;  4NGS A;  1VHE A;  4J5Q A;  5LYF A;  2HB6 A;  5JH9 A;  4F9U A;  4W9Y A;  1HJZ A;  4UEE A;  1VHU A;  4FBE A;  2Q4Z A;  3B7I A;  3KGQ A;  1Z5R A;  3B3S A;  4OID A;  1KWM A;  3T8W A;  5J1Q A;  1CBX A;  4FAI A;  1CG2 A;  3CDX A;  1TKJ A;  3PB8 X;  3KHZ A;  3KQX A;  3PB7 X;  4R6T A;  2NSM A;  1HDU A;  3IJ3 A;  2PJ6 A;  2VRI A;  4B6Z A;  2PIY A;  4OC4 A;  5HVF A;  1F57 A;  3FJU A;  3IWW A;  4IQY A;  3V2B A;  2ZEM A;  3RZA A;  4IHM A;  1DTD A;  5LYD A;  3PFE A;  1ARL A;  4UEZ A;  3PB4 X;  3Q71 A;  3IFE A;  4NGQ A;  3NH4 A;  4GUA A;  3ISZ A;  4PQA A;  2PJ3 A;  3PBB A;  3KQZ A;  1LFW A;  4FUU A;  5JGF A;  1AYE A;  2ACF A;  2BFQ A;  1XBU A;  5CB3 A;  3EJF A;  4R8F A;  3IIF A;  3PBE A;  1FT7 A;  3TX8 A;  2GU2 A;  4OP4 A;  2PE3 A;  4ZY2 A;  3FH4 A;  3D7G A;  4FWU A;  1VGY A;  3IO1 A;  1F2P A;  1VIX A;  1Y0R A;  2PIZ A;  3SI0 A;  4NGT A;  1UWY A;  2V8D A;  4R7M A;  4NGR A;  3HLP A;  3VFQ A;  1ZG8 A;  4P4B A;  5D8N A;  4OKO A;  3FX6 A;  1DE4 C;  1PYT B;  1LOK A;  1TF8 A;  3ETI A;  4P44 A;  2PRQ A;  4GVW A;  4NGP A;  4DUK A;  3NH8 A;  3EWQ A;  2GLJ A;  4F8Z A;  2PJ5 A;  1CX8 A;  2PCU A;  5LRG A;  1CPS A;  4F9V A;  1ZLI A;  3N5F A;  3KR4 A;  1NSA A;  3B2Y A;  4YU9 A;  2ANP A;  3NFZ A;  3EKE A;  1BAV A;  3FVL A;  3FEE A;  1TXZ A;  2PJ7 A;  2FG1 A;  3GB0 A;  3K2K A;  4O23 A;  2AFM A;  2CF4 A;  2CIJ A;  3SJE A;  5E3B A;  3V45 A;  1JQG A;  5DUS A;  4WWV A;  3KI9 A;  8CPA A;  1XRY A;  2LGR A;  1ZLH A;  1HDQ A;  4EME A;  5JM6 A;  1ZG7 A;  4CPA A;  2ZEL A;  4ZX8 A;  1Z8L A;  2ZEE A;  3KL9 A;  5HXD A;  1H8L A;  2V77 A;  3FF3 A;  5K8M A;  2AFU A;  4ETK A;  3PEI A;  2EK8 A;  1TKF A;  2PVW A;  5THW A;  1YSJ A;  2HC9 A;  3GLJ A;  2WYR A;  1LAM A;  1CP6 A;  3SI2 A;  3GQO A;  4P4F A;  4UF4 A;  4OC0 A;  3SIJ A;  3BXM A;  5K8P A;  1Z2L A;  2Q43 A;  2V8V A;  3BHX A;  3B35 A;  1CPX A;  5F09 A;  2IMO A;  4K3N A;  5HVG A;  1LCP A;  4KSI A;  4MCS A;  3WC5 A;  3SIG A;  1R3N A;  3KZW A;  1ELM P;  3D7H A;  3CPA A;  3L2N A;  5LYI A;  2J9A A;  5FSY A;  3GQE A;  2DX6 A;  5AIL A;  4X2T A;  3B3T A;  4G1P A;  4P4J A;  4J5R A;  4MCQ A;  4PXC A;  2QVP A;  4WJB A;  1FNO A;  3WT4 A;  2AFX A;  4ABK A;  4A94 A;  4OME A;  2V8H A;  1VHO A;  4P4E A;  4OC2 A;  1LAP A;  2RB7 A;  3EWR A;  3B3W A;  3CPX A;  3H8E A;  1Q7L A;  4OC5 A;  5FSU A;  3DGV A;  4ZI6 A;  3I1U A;  4X8I A;  2Q51 A;  3PRT A;  1RTQ A;  3RBU A;  5I4M A;  1M4L A;  1ZR3 A;  2POK A;  4P6Y A;  4NGM A;  3NA6 A;  4YWY A;  5IB9 A;  1YLO A;  4AXV A;  3TC8 A;  2PJ8 A;  2ZED A;  5K8N A;  4DJL A;  2AFC A;  4TU0 A;  3SI1 A;  3JRU A;  1ZR5 A;  2ZOF A;  5CBM A;  4EFD A;  3D67 A;  4MCR A;  4MHN A;  3HUV A;  1R43 A;  2AFS A;  2I3C A;  5LRK A;  2O53 A;  1TF9 A;  3EWO A;  2ZEG A;  4UEF A;  5HVH A;  1BPN A;  6CPA A;  1EE3 P;  5K8O A;  1LAN A;  3FMC A;  4UML A;  4OIW A;  2V8G A;  1YW6 A;  4ZY1 A;  3BI1 A;  1BPM A;  2PJ9 A;  4UIB A;  5FSZ A;  4JCA A;  2ZEF A;  2QJ8 A;  2PJC A;  4K0C A;  4EWT A;  5CB5 A;  3BI0 A;  1YW4 A;  3KHX A;  4MXU A;  3DLJ A;  1F2O A;  4ESS A;  1IY7 A;  3Q6Z A;  2O4H A;  3CT9 A;  3V38 A;  3SJF A;  2JEW A;  2CTC A;  2NYQ A;  3RAM A;  3SJG A;  2F8H A;  4MCP A;  1YD9 A;  3V7Z A;  2X47 A;  4ONW A;  2C6G A;  2IJZ A;  3D68 A;  2WZN A;  5FSV A;  4P10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...