4K3NA

Phosphonic arginine mimetics as inhibitors of the m17 aminopeptidases from plasmodium falciparum
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
publication title Synthesis and Structure-Activity Relationships of Phosphonic Arginine Mimetics as Inhibitors of the M1 and M17 Aminopeptidases from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 179
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4k3nA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4k3nA02
1OBRA 1ZG8A 4F9UA 2G9DA 2QVPA 1CX8A 2IJZA 4O23A 1BPMA 2EK9A 2NYQA 2PJ8A 2PJBA 3KHZA 5D29A 2PJ0A 2POKA 6CPAA 3PB7X 3NFZA 4OC0A 1F2PA 4OC3A 4IK2A 5HVHA 1YW4A 1LCPA 2CF4A 1F2OA 5HXDA 3N5FA 2PVWA 4TWEA 3GPQA 3DLJA 3EWQA 3CDXA 4ETKA 2ABZA 3KR4A 4NGMA 2L8RA 5CMSA 2PJ9A 3SI0A 1LANA 1TY8A 2IQ6A 3S9MA 1ZLHA 4J4ZA 3RZAA 3I1UA 4NGQA 2GLJA 4MRIA 3TX8A 2ZOGA 3GB0A 2O4HA 2ZEMA 4IAVA 2V8GA 5JH9A 4UEEA 3V45A 1AYEA 5K8PA 3NH8A 4KYBA 3D68A 4UMLA 2XEFA 2AFWA 2RFHA 3PBEA 3EWRA 4ABKA 4OC2A 2C6PA 4JLLA 2EWBA 1UWYA 2C1CA 4P4DA 3EWOA 1VGYA 2PJ3A 2RB7A 3EW5A 3LWUA 5JGFA 4GM5A 3IIFA 4PXDA 5HIHA 2ZEGA 3GPGA 4MCPA 5ELYA 5JM6A 3MN8A 4OC5A 3SI1A 5K8MA 4MXUA 4MHYA 1TKFA 2ZEDA 3FECA 3DGVA 3KZWA 3EKEA 4KSIA 4P44A 2ZELA 1TKHA 2DX6A 4AXVA 4ONWA 2AFUA 4F9VA 4JCAA 4ZY2A 1DE4C 4P4JA 4A38A 2AFMA 2XEGA 5K8NA 2HB6A 4NGRA 4OIWA 1VIXA 1HJZA 4A39A 3SIIA 4R7MA 2F7VA 4WWVA 4P4EA 3IJ3A 4A37A 4UF4A 4MCQA 1Y0YA 4FWUA 2PJ4A 2EEEA 3GUXA 2BCOA 5D8NA 2AFSA 5LRKA 2C6CA 1Z8LA 4MHPA 2PJ1A 4P45A 2OR4A 4TU0A 1ARLA 2BFRA 1FNOA 4WJBA 5F09A 2GREA 3VFQA 3KQZA 3PB9X 5I4MA 4R76A 1XMBA 1XBUA 2O53A 3LMSA 4LQGA 3IC1A 2FXKA 4P4BA 3SJEA 3SIJA 4CPAA 2QYVA 3WC5A 2F8HA 2I3CA 4ZYQA 3GPOA 2PJ7A 2CIJA 2AFZA 2XD7A 3H8FA 1XJOA 3RBUA 2V8HA 4PXCA 2QJ8A 3NH4A 3SJGA 1YLOA 4ETJA 3IFEA 5LYDA 1NJRA 1CBXA 3JRUA 2HC9A 1CP7A 4UIAA 3SIHA 1LFWA 3FEDA 3PB8X 5IB9A 5CBMA 3K9TA 3FVLA 1Z5RA 3HLPA 5LRJA 1XFOA 2JEWA 3EJFA 1PYTB 3ISZA 7CPAA 2XEJA 2VL1A 4NJRA 2GU2A 3BI1A 3WC7A 4BD9A 3PBBA 2ZENA 4JZ0A 4X3RA 3IWWA 4NJQA 4OC4A 1ELMP 3QNVA 4ZX9A 4IQYA 2AFCA 3EWPA 3K2KA 3B3TA 4NGSA 1IGBA 5CB5A 5FSZA 3V38A 8CPAA 5LYIA 3WT4A 5LRGA 5LYFA 1F57A 5E3BA 5J1QA 3PB6X 2Q43A 2ZEFA 5FSYA 2PJ6A 4GVVA 4EFDA 3B35A 3PRTA 2X47A 3FJUA 3SJFA 2JBKA 3KL9A 1FT7A 1M4LA 4OKOA 4YU9A 1SPVA 4Q7AA 1H8LA 3H8GA 4Z65A 4JVVA 4NGTA 2BFQA 2XEIA 1NSAA 4ESSA 1TF9A 3GQOA 4A94A 4P4FA 2BOAA 3PFOA 1RTQA 2WYRA 3ISXA 3Q6ZA 2IMOA 4X2TA 3D67A 2GLFA 2ZEPA 3D66A 2WZNA 3VATA 3D4UA 3B7IA 2VRIA 1LAMA 2PJCA 3L2NA 2V77A 4P6YA 2OOTA 4DJLA 3KR5A 4R6TA 4ZX8A 3IO1A 3RAMA 3VH9A 2FVGA 4PXBA 1Z2LA 2Q4ZA 1BAVA 3PEIA 2ZEEA 3HUVA 4MMOA 3FEEA 3BHXA 3KGQA 4DUKA 4FAIA 4K3NA 4OMEA 3JZTA 4F8ZA 5FSXA 4JYWA 3TC8A 2FAVA 3KASA 1CPSA 4ZI6A 5CPAA 1KWMA 3ETIA 1TF8A 1AMPA 2FG1A 2ZEOA 2V8VA 1YSJA 2PIYA 5HVFA 1ZG7A 3CPAA 4NGPA 4GVWA 4ABLA 3S9LA 3FMCA 3NH5A 4EWTA 3Q71A 1BPNA 1XRYA 1DTDA 2DEAA 2PRQA 4OIDA 1R3NA 1TKJA 4RUHA 2AFOA 1ZG9A 3NA6A 1LAPA 4PQAA 1QMUA 4GUAA 4J5RA 4UEZA 5THWA 1Y7EA 1ZLIA 2Q51A 2CTBA 3CPXA 5DUSA 3FX6A 4FBEA 4DYOA 3SI2A 1TXZA 3B3WA 4R8FA 1R43A 3B3CA 1JQGA 3SJXA 3IEHA 3B2YA 2LGRA 3KQXA 3BXMA 5K8OA 4YWYA 3H8EA 1Q7LA 4MHZA 5HOLA 2PIZA 4IHMA 1CP6A 4NGNA 2ANPA 4UEFA 4PXEA 3FH4A 2PJ2A 1ELLP 3IIBA 3WC6A 4TNUA 3GLJA 4UIBA 1QQ9A 3FF3A 2PE3A 2JBJA 2EK8A 3IIDA 3V2BA 5LYLA 2ACFA 4ZY0A 1VHOA 2J9AA 4NFRA 4J5SA 2PJ5A 3PFEA 2PVVA 3V7ZA 4D86A 1HDQA 1YW6A 4EMEA 1HDUA 4P10A 5AILA 4FUUA 5HVGA 3B3SA 2ZOFA 1ARMA 4W9YA 1YMEA 4MCSA 4OC1A 4JGKA 4ZY1A 1ZR3A 4OP4A 3B3VA 3T8WA 1IY7A 5CB3A 4X8IA 1GYTA 3BI0A 1Y0RA 3D7GA 2BO9A 3MRUA 1HEEA 3CT9A 1ZR5A 3D7FA 3PB4X 3VARA 4K0CA 1LOKA 3EJGA 5FSUA 3GQEA 4MHNA 3SIGA 3D7DA 1VHUA 2ZEHA 1TXRA 5DS0A 4H2KA 3KHXA 2PJAA 4J5QA 4G1PA 1BLLE 3S9NA 4P4IA 2CTCA 2NSMA 4B6ZA 3KI9A 1PCAA 1YD9A 1VHEA 1CPXA 3D7HA 1EE3P 2PCUA 1CG2A 4PPZA 5FSVA 4MCRA 2AFXA 2C6GA 2V8DA 3WABA
chains in the Genus database with same CATH superfamily
1OBRA 1ZG8A 4PSXA 1L0CA 4F9UA 3FRMA 2B3UA 3DSBA 2G9DA 4KSAA 2QVPA 1CX8A 4A31A 4JJXA 1S60A 2IJZA 4O23A 2X7BA 2AE6A 1Z4EA 1BPMA 4U5YA 2ATRA 2EK9A 1Q2CA 1X10A 2NYQA 1S7KA 2PJBA 2PJ8A 4BINA 3KHZA 2FE7A 5D29A 4KOYA 2PJ0A 1BO4A 1OZPA 2POKA 1QSNA 3B8GA 3TFYA 6CPAA 2REFA 3PB7X 1Q2DA 2RC4A 3NFZA 4OC0A 1F2PA 4OC3A 4IK2A 3IU1A 2FS5A 1YREA 1YW4A 5HVHA 1LCPA 2CF4A 1F2OA 2FXFA 5JQ4A 5HXDA 3N5FA 1AUGA 2PVWA 4TWEA 3GPQA 3DLJA 5JPHA 3ZJ0A 3W6SA 3EWQA 3CDXA 3TO9A 4ETKA 3NE8A 3DDDA 2P6EA 2VZZA 2ABZA 3KR4A 2G0BA 4NGMA 2L8RA 5CMSA 2PJ9A 3KKWA 4LUAA 3SI0A 1LANA 1TY8A 2IQ6A 2ODFA 3S9MA 4KVXA 1ZLHA 4J4ZA 3RZAA 3I1UA 4KSFA 4NGQA 2GLJA 3IWGA 4CYNA 4XPDC 4MRIA 5AG5A 1NSLA 3TX8A 2ZOGA 2Q4YA 5EC4A 4MHDA 4B5OA 2PSWA 2O4HA 3GB0A 2FCKA 2ZEMA 4IAVA 2V8GA 5JH9A 4UEEA 3V45A 1AYEA 5K8PA 3NH8A 3CXQA 4KYBA 3D68A 1R57A 2BL1A 1XF8A 4UMLA 4M85A 3GY9A 5J8FA 4YGOA 2XEFA 2AFWA 2RFHA 3PBEA 2WPWA 3EWRA 4ABKA 4OC2A 2C6PA 4JLLA 3JVNA 2EWBA 4OADA 1UWYA 2C1CA 4P4DA 1M4GA 3R9GA 3EWOA 1VGYA 2CNMA 2PJ3A 3EC4A 2RB7A 4QUSA 2JZEA 3EW5A 2B4BA 3WC5A 3LWUA 5JGFA 4GM5A 3IIFA 4PXDA 5HIHA 1P0HA 4L89A 2ZEGA 3GPGA 3EFAA 4MFQA 4MCPA 5ELYA 4F0YA 3OWCA 3R9FA 3MN8A 4OC5A 3TTHA 4KUBA 3EY5A 5JM6A 5DWNA 2FSRA 4R3KA 3SI1A 2JEVA 5K8MA 1YX0A 4IF5A 4MXUA 2CNSA 4MHYA 2J8MA 1V0CA 2VI7A 1TKFA 2ZEDA 2ZW6A 3FECA 3TE4A 2CNTA 3DGVA 4MY0A 3KZWA 3QB8A 3EKEA 2VXKA 2VQYA 4KSIA 4JLYA 4FBEA 2D4PA 2R8VA 4B12A 4P44A 2ZELA 4DNCA 4KOTA 5A28A 2KQVA 1TKHA 4Y49C 4K30A 4FD7A 2DX6A 4M6IA 4AXVA 4ONWA 1X12A 2AFUA 4F9VA 4JCAA 4ZY2A 1DE4C 4P4JA 4A38A 2AFMA 2YNCC 3R1KA 4UBRA 4CYOA 2BSWA 2XEGA 3QAHA 1M44A 5K8NA 2DPSA 3N7ZA 4KLVA 2CXAA 2EVNA 2HB6A 4NGRA 2HV2A 4OIWA 1VIXA 4U9YA 4C2ZA 1WWZA 1HJZA 4A39A 1MJ9A 1RXTA 4I49A 3LODA 3W6XA 2P6GA 3SIIA 4R7MA 1TIQA 2F7VA 3S6KA 4WWVA 4P4EA 3IJ3A 4A37A 4UF4A 2PR8A 1XOVA 3D2MA 4MCQA 1Y0YA 4FWUA 2PJ4A 1Z8WA 4EVYA 1Y9KA 3CZXA 2EEEA 3F8KA 1IU8A 1KUVA 4UA3A 3GUXA 5G21A 4R57A 4CGOA 2BCOA 5D8NA 2AFSA 2GFQA 4KORA 4CAVA 5LRKA 2C6CA 2BUEA 1LRZA 1Z8LA 4MHPA 2J8NA 2PC1A 2PJ1A 3D3SA 2DF5A 3SXNA 4HNWB 4P45A 1XMTA 3CXSA 1XIXA 4AG7A 2GANA 2FL4A 2YGWA 2OR4A 4TU0A 1ARLA 2BFRA 1FNOA 3G8WA 4WJBA 5F09A 4NEXA 4FD5A 2WSAA 2H5MA 2GREA 2Z0ZA 2Q44A 3R95A 3VFQA 3KQZA 2O28A 3PB9X 2FIAA 5I4MA 4NXYA 4R76A 2YNCA 1IB1E 5F47A 4M6HA 1XMBA 1XBUA 2O53A 1NMTA 4RUHA 3FIXA 3JUWA 1GHEA 2RNKA 4KOSA 2OZHA 4HPSA 4UWJA 5AG6A 3TO6A 3LMSA 4LQGA 3IC1A 2FXKA 4P4BA 3SJEA 3SIJA 2GE3A 2Q0YA 4XNHB 4CPAA 2CY2A 4BBHA 1YR0A 2QYVA 2B5GB 4MFKA 4RS2A 2C27A 2F8HA 4ZYQA 2I3CA 4KOWA 4QVTA 3GPOA 5EMIA 3RYOA 2PJ7A 4ZBGA 1BOBA 5DWMA 2Z3NA 2HUZA 3ZZIA 1S7LA 2CIJA 2AFZA 4AVBA 5EBVA 2XD7A 3H8FA 1XJOA 2ARHA 4NF1A 2EO8A 3RBUA 2V8HA 4PXCA 1J4JA 2QJ8A 4B5PA 5J8CA 2OU2A 3NH4A 3SJGA 4KLWA 1YLOA 4ETJA 3IFEA 2OZUA 3BJ8A 1NJRA 3IWEA 4MI4A 1CBXA 5LYDA 3LACA 3V8IA 3JRUA 2AJ6A 2HC9A 1CP7A 2J8RA 3PP9A 3SIHA 1LFWA 2FIWA 3FEDA 3PB8X 4UIAA 5IB9A 5CBMA 2EUIA 3S6FA 1YQEA 3FVLA 3K9TA 1Z5RA 3HLPA 5LRJA 1XFOA 3GKRA 2JEWA 2OB0A 4NCZA 1VKCA 5IB0A 3EJFA 1PYTB 3ISZA 1QSMA 7CPAA 2XEJA 2VL1A 1Z8XA 2GU2A 3FNCA 4NJRA 2KCWA 3T90A 4B10A 4QBJA 4AB7A 2P0WA 5A27A 3BI1A 3DR6A 3JTKA 3WC7A 2JZDA 5KTDA 1JWQA 1PUAA 4U9ZA 4JXQA 4BD9A 3PBBA 2ZENA 4JZ0A 4X3RA 3IWWA 2B58A 4NJQA 4OC4A 4XNHC 4XPKA 2JZFA 2DPTA 1ELMP 3QNVA 4PK2A 4ZX9A 4UFWA 5E96A 4IQYA 2AFCA 1S3ZA 3EWPA 1PU9A 2NMTA 3K2KA 3B3TA 1IIDA 5ISVA 3TCVA 2JDCA 4NGSA 1IGBA 5CB5A 5FSZA 3V38A 8CPAA 1Z8TA 5LYIA 3WT4A 1KUYA 2Y0MA 4R9MA 4C68A 4CAXA 4CYPA 4MJ8A 3TT2A 5LRGA 2I00A 2R7HA 5BWAB 5LYFA 4E8OA 1F57A 5E3BA 5J1QA 3EXNA 3PB6X 3C26A 4FD6A 2Q43A 2ZEFA 5FSYA 3TOBA 4ORFA 5AG7A 2PJ6A 4GVVA 4EFDA 3B35A 2B4DB 2X47A 3FJUA 3PRTA 2A4NA 3SJFA 2JBKA 3KL9A 4A33A 1FT7A 1M4LA 4OKOA 4YU9A 1SPVA 4Q7AA 2R1IA 1H8LA 3H8GA 2P6FA 4JVVA 2ZXVA 4NGTA 4Z65A 2BFQA 1P4NA 4CGNA 3PZJA 1Q2YA 1MK4A 1A2ZA 3S6HA 4CYQA 1NE9A 4UCMA 5F48A 2PR1A 2XEIA 5IV0A 4CRYB 4XPLA 1NSAA 4E0AA 4ESSA 1TF9A 4JWPA 3RO0A 4A30A 3W91A 1M4IA 3CXPA 4Q38A 2GIVA 3VWDA 3WR7A 3GQOA 4A94A 4HNXB 4P4FA 1I21A 2BOAA 3PFOA 5GCNA 2VEZA 4KOXA 4PSWA 1RTQA 1WK4A 2WYRA 3Q6ZA 3ISXA 1I12A 1YGHA 5AGEA 2IMOA 4X2TA 4OLLA 2OH1A 3D67A 4M3SA 2GLFA 2ZEPA 3D66A 3SXOA 2FT0A 1MJBA 1YLEA 2BEIA 2WZNA 4C2XA 3G3SA 3VATA 2B3VA 3D4UA 1CJWA 4QB9A 4YFJA 4KZTA 2F5IA 3B7IA 2G3TA 2VRIA 2VZYA 1LAMA 3DNSA 2WUUA 2PJCA 1YVKA 3L2NA 2V77A 2PRBA 4ONUA 4P6YA 2OOTA 2WCTA 4DJLA 4II9A 2OZGA 3KR5A 4R6TA 4ZX8A 3IO1A 3RAMA 3F0AA 1I1DA 4J3GA 3VH9A 3MGDA 2FVGA 1IYKA 3FB3A 1Z2LA 2Q4ZA 4PXBA 1BAVA 1QSRA 3PEIA 2WPXA 2ZEEA 3HUVA 4H89A 4MMOA 5H86A 2Z3KA 3FEEA 4XPDB 1Z9UA 3BHXA 3FYNA 3KGQA 5G22A 2PQ8A 4DUKA 2IL4A 3PGPA 4FAIA 4K3NA 1B6BA 1B87A 2Z10A 3FBUA 4OMEA 4PK3A 3JZTA 4F8ZA 4MFLA 5FSXA 4X5KA 5AG4A 3LD2A 1VHSA 4JYWA 3TC8A 2FAVA 3KASA 4AVCA 2REEA 4B13A 1CPSA 3R9EA 4ZI6A 4JD6A 2YNEA 1CM0A 1KWMA 5CPAA 2Z3PA 3TOAA 1UFHA 3ETIA 1TF8A 1AMPA 2FG1A 2Z3OA 2ZEOA 2V8VA 3DR8A 2DXQA 3GYAA 1YSJA 2PIYA 4PV6A 5HH1A 1ZG7A 3CPAA 3P2HA 4NGPA 5HVFA 4AVAA 1N71A 1KUXA 4GVWA 4ABLA 4KVOE 4BMHA 3FMCA 3NH5A 3S9LA 4EWTA 4C7IA 4UWIA 1U6MA 3Q71A 1BPNA 1XRYA 1DTDA 2DEAA 2PRQA 4H6ZA 2R98A 1IOFA 4A2ZA 4CRZB 4B11A 4OIDA 1M4DA 1R3NA 1TKJA 1FY7A 2AFOA 1ZG9A 2Q7SA 2Z11A 3NA6A 4LX9A 4C2YA 3UY5A 1LAPA 1YK3A 4HKFA 4PQAA 4C7HA 1QMUA 4GUAA 4J5RA 4MFZA 5G1ZA 3T9YA 4A95A 4UEZA 2ZPAA 1Y7EA 1ZLIA 2Q51A 2CTBA 3CPXA 5DUSA 3FX6A 4MBUA 5THWA 4DYOA 4F6AA 4GS4A 1S7NA 3SI2A 1TXZA 3B3WA 4R8FA 4GXHA 1R43A 3B3CA 4H6UA 3K9UA 4IUSA 1JQGA 3SHPA 4QC6A 3SJXA 4Y49B 1S7FA 3VWEA 5IX3A 2B4DA 4R87A 3IEHA 3B2YA 5CNPA 4CS0B 2LGRA 3KQXA 2QIRA 3I9SA 4KOUA 4LQ6A 4UFVA 3BXMA 5K8OA 4YWYA 3H8EA 1Q7LA 4MHZA 5HOLA 2W2GA 2VBQA 1XEBA 2PIZA 4R3LA 4IHMA 1CP6A 4YRHA 4F0XA 4NGNA 3IGRA 4UFXA 2ANPA 4UEFA 4UCPA 4M6GA 4PXEA 3FH4A 3RNZA 2PJ2A 2ZW5A 1IICA 1ELLP 2G3AA 4L8AA 3IIBA 4UCNA 3WC6A 4TNUA 3GLJA 2JLMA 4UIBA 1QQ9A 1ZO0A 3FF3A 2PE3A 2Q4VA 2JBJA 4B14A 2EK8A 4FD4A 4KOVA 3IIDA 3V2BA 3BLNA 5F46A 5LYLA 4RN7A 4NSQA 2ACFA 4ZY0A 4A32A 4B5PB 2ZW7A 1VHOA 2Q7BA 4KUAA 1M1DA 4Q36A 2J9AA 2K5TA 1QSTA 4NFRA 4CAEA 4J5SA 1SQHA 2PJ5A 3PFEA 1Y7RA 2PVVA 1Y9WA 3V7ZA 3E0KA 5HMNA 3S6GA 2D4OA 5G20A 5H84A 4D86A 3I3GA 1HDQA 4OAEA 1YW6A 3FXTA 3TO7A 4EMEA 5I0CA 1HDUA 2EBJA 2PDOA 4P10A 5AILA 4FUUA 2QECA 5HVGA 3B3SA 2ZOFA 3D2PA 2Z3LA 4KS9A 1ARMA 4W9YA 3EO4A 1YMEA 2Z3MA 1RO5A 3P2FA 4MCSA 3D8PA 4OC1A 4JGKA 5F49A 4ZY1A 4CGMA 1ZR3A 4OP4A 3B3VA 3T8WA 1QSOA 4MFJA 1IY7A 3IU2A 5CB3A 5C82A 4X8IA 1GYTA 3BI0A 2I79A 1K4JA 1Y0RA 2BO9A 2B5GA 3D7GA 3MRUA 4CGLA 1HEEA 4CAWA 4ZGYB 3CT9A 1ZR5A 3D7FA 3H4QA 1IOIA 1ON0A 3PB4X 3VARA 1Z4RA 4K0CA 1LOKA 4E2AA 3EJGA 5FSUA 3GQEA 2ZW4A 1IYLA 1YVOA 3SIGA 4MHNA 3D7DA 4HNYB 1VHUA 1MJAA 1TXRA 2ZEHA 1S5KA 5DS0A 5FVJA 4H2KA 3KHXA 2PJAA 4CGPA 1XE4A 4J5QA 4G1PA 1BLLE 2YNDA 4RI1A 3NE7A 3QAYA 4MFPA 4CAFA 2HQYA 3BJ7A 4AG9A 3S9NA 3H5ZA 4P4IA 2JDDA 2CTCA 3A9LA 3R96A 5KTAA 4KVME 2NSMA 4MY3A 4B6ZA 3F5BA 1PCAA 1YD9A 3KI9A 5C88A 1VHEA 4JXRA 1CPXA 3D7HA 1EE3P 2PCUA 1CG2A 3GIUA 5KTCA 2QMLA 1KZFA 4PPZA 5FSVA 2Q04A 2AFXA 4MCRA 2C6GA 2V8DA 3WABA
chains in the Genus database with same CATH topology
1OBRA 1ZG8A 4F9UA 2G9DA 2QVPA 1CX8A 2IJZA 4O23A 1BPMA 2EK9A 2NYQA 2PJ8A 2PJBA 3KHZA 5D29A 2PJ0A 2POKA 6CPAA 3PB7X 3NFZA 4OC0A 1F2PA 4OC3A 4IK2A 5HVHA 1YW4A 1LCPA 2CF4A 1F2OA 5HXDA 3N5FA 2PVWA 4TWEA 3GPQA 3DLJA 3EWQA 3CDXA 4ETKA 2ABZA 3KR4A 4NGMA 2L8RA 5CMSA 2PJ9A 3SI0A 1LANA 1TY8A 2IQ6A 3S9MA 1ZLHA 4J4ZA 3RZAA 3I1UA 4NGQA 2GLJA 4MRIA 3TX8A 2ZOGA 3GB0A 2O4HA 2ZEMA 4IAVA 2V8GA 5JH9A 4UEEA 3V45A 1AYEA 5K8PA 3NH8A 4KYBA 3D68A 4UMLA 2XEFA 2AFWA 2RFHA 3PBEA 3EWRA 4ABKA 4OC2A 2C6PA 4JLLA 2EWBA 1UWYA 2C1CA 4P4DA 3EWOA 1VGYA 2PJ3A 2RB7A 3EW5A 3LWUA 5JGFA 4GM5A 3IIFA 4PXDA 5HIHA 2ZEGA 3GPGA 4MCPA 5ELYA 5JM6A 3MN8A 4OC5A 3SI1A 5K8MA 4MXUA 4MHYA 1TKFA 2ZEDA 3FECA 3DGVA 3KZWA 3EKEA 4KSIA 4P44A 2ZELA 1TKHA 2DX6A 4AXVA 4ONWA 2AFUA 4F9VA 4JCAA 4ZY2A 1DE4C 4P4JA 4A38A 2AFMA 2XEGA 5K8NA 2HB6A 4NGRA 4OIWA 1VIXA 1HJZA 4A39A 3SIIA 4R7MA 2F7VA 4WWVA 4P4EA 3IJ3A 4A37A 4UF4A 4MCQA 1Y0YA 4FWUA 2PJ4A 2EEEA 3GUXA 2BCOA 5D8NA 2AFSA 5LRKA 2C6CA 1Z8LA 4MHPA 2PJ1A 4P45A 2OR4A 4TU0A 1ARLA 2BFRA 1FNOA 4WJBA 5F09A 2GREA 3VFQA 3KQZA 3PB9X 5I4MA 4R76A 1XMBA 1XBUA 2O53A 3LMSA 4LQGA 3IC1A 2FXKA 4P4BA 3SJEA 3SIJA 4CPAA 2QYVA 3WC5A 2F8HA 2I3CA 4ZYQA 3GPOA 2PJ7A 2CIJA 2AFZA 2XD7A 3H8FA 1XJOA 3RBUA 2V8HA 4PXCA 2QJ8A 3NH4A 3SJGA 1YLOA 4ETJA 3IFEA 5LYDA 1NJRA 1CBXA 3JRUA 2HC9A 1CP7A 4UIAA 3SIHA 1LFWA 3FEDA 3PB8X 5IB9A 5CBMA 3K9TA 3FVLA 1Z5RA 3HLPA 5LRJA 1XFOA 2JEWA 3EJFA 1PYTB 3ISZA 7CPAA 2XEJA 2VL1A 4NJRA 2GU2A 3BI1A 3WC7A 4BD9A 3PBBA 2ZENA 4JZ0A 4X3RA 3IWWA 4NJQA 4OC4A 1ELMP 3QNVA 4ZX9A 4IQYA 2AFCA 3EWPA 3K2KA 3B3TA 4NGSA 1IGBA 5CB5A 5FSZA 3V38A 8CPAA 5LYIA 3WT4A 5LRGA 5LYFA 1F57A 5E3BA 5J1QA 3PB6X 2Q43A 2ZEFA 5FSYA 2PJ6A 4GVVA 4EFDA 3B35A 3PRTA 2X47A 3FJUA 3SJFA 2JBKA 3KL9A 1FT7A 1M4LA 4OKOA 4YU9A 1SPVA 4Q7AA 1H8LA 3H8GA 4Z65A 4JVVA 4NGTA 2BFQA 2XEIA 1NSAA 4ESSA 1TF9A 3GQOA 4A94A 4P4FA 2BOAA 3PFOA 1RTQA 2WYRA 3ISXA 3Q6ZA 2IMOA 4X2TA 3D67A 2GLFA 2ZEPA 3D66A 2WZNA 3VATA 3D4UA 3B7IA 2VRIA 1LAMA 2PJCA 3L2NA 2V77A 4P6YA 2OOTA 4DJLA 3KR5A 4R6TA 4ZX8A 3IO1A 3RAMA 3VH9A 2FVGA 4PXBA 1Z2LA 2Q4ZA 1BAVA 3PEIA 2ZEEA 3HUVA 4MMOA 3FEEA 3BHXA 3KGQA 4DUKA 4FAIA 4K3NA 4OMEA 3JZTA 4F8ZA 5FSXA 4JYWA 3TC8A 2FAVA 3KASA 1CPSA 4ZI6A 5CPAA 1KWMA 3ETIA 1TF8A 1AMPA 2FG1A 2ZEOA 2V8VA 1YSJA 2PIYA 5HVFA 1ZG7A 3CPAA 4NGPA 4GVWA 4ABLA 3S9LA 3FMCA 3NH5A 4EWTA 3Q71A 1BPNA 1XRYA 1DTDA 2DEAA 2PRQA 4OIDA 1R3NA 1TKJA 4RUHA 2AFOA 1ZG9A 3NA6A 1LAPA 4PQAA 1QMUA 4GUAA 4J5RA 4UEZA 5THWA 1Y7EA 1ZLIA 2Q51A 2CTBA 3CPXA 5DUSA 3FX6A 4FBEA 4DYOA 3SI2A 1TXZA 3B3WA 4R8FA 1R43A 3B3CA 1JQGA 3SJXA 3IEHA 3B2YA 2LGRA 3KQXA 3BXMA 5K8OA 4YWYA 3H8EA 1Q7LA 4MHZA 5HOLA 2PIZA 4IHMA 1CP6A 4NGNA 2ANPA 4UEFA 4PXEA 3FH4A 2PJ2A 1ELLP 3IIBA 3WC6A 4TNUA 3GLJA 4UIBA 1QQ9A 3FF3A 2PE3A 2JBJA 2EK8A 3IIDA 3V2BA 5LYLA 2ACFA 4ZY0A 1VHOA 2J9AA 4NFRA 4J5SA 2PJ5A 3PFEA 2PVVA 3V7ZA 4D86A 1HDQA 1YW6A 4EMEA 1HDUA 4P10A 5AILA 4FUUA 5HVGA 3B3SA 2ZOFA 1ARMA 4W9YA 1YMEA 4MCSA 4OC1A 4JGKA 4ZY1A 1ZR3A 4OP4A 3B3VA 3T8WA 1IY7A 5CB3A 4X8IA 1GYTA 3BI0A 1Y0RA 3D7GA 2BO9A 3MRUA 1HEEA 3CT9A 1ZR5A 3D7FA 3PB4X 3VARA 4K0CA 1LOKA 3EJGA 5FSUA 3GQEA 4MHNA 3SIGA 3D7DA 1VHUA 2ZEHA 1TXRA 5DS0A 4H2KA 3KHXA 2PJAA 4J5QA 4G1PA 1BLLE 3S9NA 4P4IA 2CTCA 2NSMA 4B6ZA 3KI9A 1PCAA 1YD9A 1VHEA 1CPXA 3D7HA 1EE3P 2PCUA 1CG2A 4PPZA 5FSVA 4MCRA 2AFXA 2C6GA 2V8DA 3WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OBR A;  1ZG8 A;  4F9U A;  2G9D A;  2QVP A;  1CX8 A;  2IJZ A;  4O23 A;  1BPM A;  2EK9 A;  2NYQ A;  2PJ8 A;  2PJB A;  3KHZ A;  5D29 A;  2PJ0 A;  2POK A;  6CPA A;  3PB7 X;  3NFZ A;  4OC0 A;  1F2P A;  4OC3 A;  4IK2 A;  5HVH A;  1YW4 A;  1LCP A;  2CF4 A;  1F2O A;  5HXD A;  3N5F A;  2PVW A;  4TWE A;  3GPQ A;  3DLJ A;  3EWQ A;  3CDX A;  4ETK A;  2ABZ A;  3KR4 A;  4NGM A;  2L8R A;  5CMS A;  2PJ9 A;  3SI0 A;  1LAN A;  1TY8 A;  2IQ6 A;  3S9M A;  1ZLH A;  4J4Z A;  3RZA A;  3I1U A;  4NGQ A;  2GLJ A;  4MRI A;  3TX8 A;  2ZOG A;  3GB0 A;  2O4H A;  2ZEM A;  4IAV A;  2V8G A;  5JH9 A;  4UEE A;  3V45 A;  1AYE A;  5K8P A;  3NH8 A;  4KYB A;  3D68 A;  4UML A;  2XEF A;  2AFW A;  2RFH A;  3PBE A;  3EWR A;  4ABK A;  4OC2 A;  2C6P A;  4JLL A;  2EWB A;  1UWY A;  2C1C A;  4P4D A;  3EWO A;  1VGY A;  2PJ3 A;  2RB7 A;  3EW5 A;  3LWU A;  5JGF A;  4GM5 A;  3IIF A;  4PXD A;  5HIH A;  2ZEG A;  3GPG A;  4MCP A;  5ELY A;  5JM6 A;  3MN8 A;  4OC5 A;  3SI1 A;  5K8M A;  4MXU A;  4MHY A;  1TKF A;  2ZED A;  3FEC A;  3DGV A;  3KZW A;  3EKE A;  4KSI A;  4P44 A;  2ZEL A;  1TKH A;  2DX6 A;  4AXV A;  4ONW A;  2AFU A;  4F9V A;  4JCA A;  4ZY2 A;  1DE4 C;  4P4J A;  4A38 A;  2AFM A;  2XEG A;  5K8N A;  2HB6 A;  4NGR A;  4OIW A;  1VIX A;  1HJZ A;  4A39 A;  3SII A;  4R7M A;  2F7V A;  4WWV A;  4P4E A;  3IJ3 A;  4A37 A;  4UF4 A;  4MCQ A;  1Y0Y A;  4FWU A;  2PJ4 A;  2EEE A;  3GUX A;  2BCO A;  5D8N A;  2AFS A;  5LRK A;  2C6C A;  1Z8L A;  4MHP A;  2PJ1 A;  4P45 A;  2OR4 A;  4TU0 A;  1ARL A;  2BFR A;  1FNO A;  4WJB A;  5F09 A;  2GRE A;  3VFQ A;  3KQZ A;  3PB9 X;  5I4M A;  4R76 A;  1XMB A;  1XBU A;  2O53 A;  3LMS A;  4LQG A;  3IC1 A;  2FXK A;  4P4B A;  3SJE A;  3SIJ A;  4CPA A;  2QYV A;  3WC5 A;  2F8H A;  2I3C A;  4ZYQ A;  3GPO A;  2PJ7 A;  2CIJ A;  2AFZ A;  2XD7 A;  3H8F A;  1XJO A;  3RBU A;  2V8H A;  4PXC A;  2QJ8 A;  3NH4 A;  3SJG A;  1YLO A;  4ETJ A;  3IFE A;  5LYD A;  1NJR A;  1CBX A;  3JRU A;  2HC9 A;  1CP7 A;  4UIA A;  3SIH A;  1LFW A;  3FED A;  3PB8 X;  5IB9 A;  5CBM A;  3K9T A;  3FVL A;  1Z5R A;  3HLP A;  5LRJ A;  1XFO A;  2JEW A;  3EJF A;  1PYT B;  3ISZ A;  7CPA A;  2XEJ A;  2VL1 A;  4NJR A;  2GU2 A;  3BI1 A;  3WC7 A;  4BD9 A;  3PBB A;  2ZEN A;  4JZ0 A;  4X3R A;  3IWW A;  4NJQ A;  4OC4 A;  1ELM P;  3QNV A;  4ZX9 A;  4IQY A;  2AFC A;  3EWP A;  3K2K A;  3B3T A;  4NGS A;  1IGB A;  5CB5 A;  5FSZ A;  3V38 A;  8CPA A;  5LYI A;  3WT4 A;  5LRG A;  5LYF A;  1F57 A;  5E3B A;  5J1Q A;  3PB6 X;  2Q43 A;  2ZEF A;  5FSY A;  2PJ6 A;  4GVV A;  4EFD A;  3B35 A;  3PRT A;  2X47 A;  3FJU A;  3SJF A;  2JBK A;  3KL9 A;  1FT7 A;  1M4L A;  4OKO A;  4YU9 A;  1SPV A;  4Q7A A;  1H8L A;  3H8G A;  4Z65 A;  4JVV A;  4NGT A;  2BFQ A;  2XEI A;  1NSA A;  4ESS A;  1TF9 A;  3GQO A;  4A94 A;  4P4F A;  2BOA A;  3PFO A;  1RTQ A;  2WYR A;  3ISX A;  3Q6Z A;  2IMO A;  4X2T A;  3D67 A;  2GLF A;  2ZEP A;  3D66 A;  2WZN A;  3VAT A;  3D4U A;  3B7I A;  2VRI A;  1LAM A;  2PJC A;  3L2N A;  2V77 A;  4P6Y A;  2OOT A;  4DJL A;  3KR5 A;  4R6T A;  4ZX8 A;  3IO1 A;  3RAM A;  3VH9 A;  2FVG A;  4PXB A;  1Z2L A;  2Q4Z A;  1BAV A;  3PEI A;  2ZEE A;  3HUV A;  4MMO A;  3FEE A;  3BHX A;  3KGQ A;  4DUK A;  4FAI A;  4K3N A;  4OME A;  3JZT A;  4F8Z A;  5FSX A;  4JYW A;  3TC8 A;  2FAV A;  3KAS A;  1CPS A;  4ZI6 A;  5CPA A;  1KWM A;  3ETI A;  1TF8 A;  1AMP A;  2FG1 A;  2ZEO A;  2V8V A;  1YSJ A;  2PIY A;  5HVF A;  1ZG7 A;  3CPA A;  4NGP A;  4GVW A;  4ABL A;  3S9L A;  3FMC A;  3NH5 A;  4EWT A;  3Q71 A;  1BPN A;  1XRY A;  1DTD A;  2DEA A;  2PRQ A;  4OID A;  1R3N A;  1TKJ A;  4RUH A;  2AFO A;  1ZG9 A;  3NA6 A;  1LAP A;  4PQA A;  1QMU A;  4GUA A;  4J5R A;  4UEZ A;  5THW A;  1Y7E A;  1ZLI A;  2Q51 A;  2CTB A;  3CPX A;  5DUS A;  3FX6 A;  4FBE A;  4DYO A;  3SI2 A;  1TXZ A;  3B3W A;  4R8F A;  1R43 A;  3B3C A;  1JQG A;  3SJX A;  3IEH A;  3B2Y A;  2LGR A;  3KQX A;  3BXM A;  5K8O A;  4YWY A;  3H8E A;  1Q7L A;  4MHZ A;  5HOL A;  2PIZ A;  4IHM A;  1CP6 A;  4NGN A;  2ANP A;  4UEF A;  4PXE A;  3FH4 A;  2PJ2 A;  1ELL P;  3IIB A;  3WC6 A;  4TNU A;  3GLJ A;  4UIB A;  1QQ9 A;  3FF3 A;  2PE3 A;  2JBJ A;  2EK8 A;  3IID A;  3V2B A;  5LYL A;  2ACF A;  4ZY0 A;  1VHO A;  2J9A A;  4NFR A;  4J5S A;  2PJ5 A;  3PFE A;  2PVV A;  3V7Z A;  4D86 A;  1HDQ A;  1YW6 A;  4EME A;  1HDU A;  4P10 A;  5AIL A;  4FUU A;  5HVG A;  3B3S A;  2ZOF A;  1ARM A;  4W9Y A;  1YME A;  4MCS A;  4OC1 A;  4JGK A;  4ZY1 A;  1ZR3 A;  4OP4 A;  3B3V A;  3T8W A;  1IY7 A;  5CB3 A;  4X8I A;  1GYT A;  3BI0 A;  1Y0R A;  3D7G A;  2BO9 A;  3MRU A;  1HEE A;  3CT9 A;  1ZR5 A;  3D7F A;  3PB4 X;  3VAR A;  4K0C A;  1LOK A;  3EJG A;  5FSU A;  3GQE A;  4MHN A;  3SIG A;  3D7D A;  1VHU A;  2ZEH A;  1TXR A;  5DS0 A;  4H2K A;  3KHX A;  2PJA A;  4J5Q A;  4G1P A;  1BLL E;  3S9N A;  4P4I A;  2CTC A;  2NSM A;  4B6Z A;  3KI9 A;  1PCA A;  1YD9 A;  1VHE A;  1CPX A;  3D7H A;  1EE3 P;  2PCU A;  1CG2 A;  4PPZ A;  5FSV A;  4MCR A;  2AFX A;  2C6G A;  2V8D A;  3WAB A; 
#chains in the Genus database with same CATH topology
 1OBR A;  1ZG8 A;  4PSX A;  1L0C A;  4F9U A;  3FRM A;  2B3U A;  3DSB A;  2G9D A;  4KSA A;  2QVP A;  1CX8 A;  4A31 A;  4JJX A;  1S60 A;  2IJZ A;  4O23 A;  2X7B A;  2AE6 A;  1Z4E A;  1BPM A;  4U5Y A;  2ATR A;  2EK9 A;  1Q2C A;  1X10 A;  2NYQ A;  1S7K A;  2PJB A;  2PJ8 A;  4BIN A;  3KHZ A;  2FE7 A;  5D29 A;  4KOY A;  2PJ0 A;  1BO4 A;  1OZP A;  2POK A;  1QSN A;  3B8G A;  3TFY A;  6CPA A;  2REF A;  3PB7 X;  1Q2D A;  2RC4 A;  3NFZ A;  4OC0 A;  1F2P A;  4OC3 A;  4IK2 A;  3IU1 A;  2FS5 A;  1YRE A;  1YW4 A;  5HVH A;  1LCP A;  2CF4 A;  1F2O A;  2FXF A;  5JQ4 A;  5HXD A;  3N5F A;  1AUG A;  2PVW A;  4TWE A;  3GPQ A;  3DLJ A;  5JPH A;  3ZJ0 A;  3W6S A;  3EWQ A;  3CDX A;  3TO9 A;  4ETK A;  3NE8 A;  3DDD A;  2P6E A;  2VZZ A;  2ABZ A;  3KR4 A;  2G0B A;  4NGM A;  2L8R A;  5CMS A;  2PJ9 A;  3KKW A;  4LUA A;  3SI0 A;  1LAN A;  1TY8 A;  2IQ6 A;  2ODF A;  3S9M A;  4KVX A;  1ZLH A;  4J4Z A;  3RZA A;  3I1U A;  4KSF A;  4NGQ A;  2GLJ A;  3IWG A;  4CYN A;  4XPD C;  4MRI A;  5AG5 A;  1NSL A;  3TX8 A;  2ZOG A;  2Q4Y A;  5EC4 A;  4MHD A;  4B5O A;  2PSW A;  2O4H A;  3GB0 A;  2FCK A;  2ZEM A;  4IAV A;  2V8G A;  5JH9 A;  4UEE A;  3V45 A;  1AYE A;  5K8P A;  3NH8 A;  3CXQ A;  4KYB A;  3D68 A;  1R57 A;  2BL1 A;  1XF8 A;  4UML A;  4M85 A;  3GY9 A;  5J8F A;  4YGO A;  2XEF A;  2AFW A;  2RFH A;  3PBE A;  2WPW A;  3EWR A;  4ABK A;  4OC2 A;  2C6P A;  4JLL A;  3JVN A;  2EWB A;  4OAD A;  1UWY A;  2C1C A;  4P4D A;  1M4G A;  3R9G A;  3EWO A;  1VGY A;  2CNM A;  2PJ3 A;  3EC4 A;  2RB7 A;  4QUS A;  2JZE A;  3EW5 A;  2B4B A;  3WC5 A;  3LWU A;  5JGF A;  4GM5 A;  3IIF A;  4PXD A;  5HIH A;  1P0H A;  4L89 A;  2ZEG A;  3GPG A;  3EFA A;  4MFQ A;  4MCP A;  5ELY A;  4F0Y A;  3OWC A;  3R9F A;  3MN8 A;  4OC5 A;  3TTH A;  4KUB A;  3EY5 A;  5JM6 A;  5DWN A;  2FSR A;  4R3K A;  3SI1 A;  2JEV A;  5K8M A;  1YX0 A;  4IF5 A;  4MXU A;  2CNS A;  4MHY A;  2J8M A;  1V0C A;  2VI7 A;  1TKF A;  2ZED A;  2ZW6 A;  3FEC A;  3TE4 A;  2CNT A;  3DGV A;  4MY0 A;  3KZW A;  3QB8 A;  3EKE A;  2VXK A;  2VQY A;  4KSI A;  4JLY A;  4FBE A;  2D4P A;  2R8V A;  4B12 A;  4P44 A;  2ZEL A;  4DNC A;  4KOT A;  5A28 A;  2KQV A;  1TKH A;  4Y49 C;  4K30 A;  4FD7 A;  2DX6 A;  4M6I A;  4AXV A;  4ONW A;  1X12 A;  2AFU A;  4F9V A;  4JCA A;  4ZY2 A;  1DE4 C;  4P4J A;  4A38 A;  2AFM A;  2YNC C;  3R1K A;  4UBR A;  4CYO A;  2BSW A;  2XEG A;  3QAH A;  1M44 A;  5K8N A;  2DPS A;  3N7Z A;  4KLV A;  2CXA A;  2EVN A;  2HB6 A;  4NGR A;  2HV2 A;  4OIW A;  1VIX A;  4U9Y A;  4C2Z A;  1WWZ A;  1HJZ A;  4A39 A;  1MJ9 A;  1RXT A;  4I49 A;  3LOD A;  3W6X A;  2P6G A;  3SII A;  4R7M A;  1TIQ A;  2F7V A;  3S6K A;  4WWV A;  4P4E A;  3IJ3 A;  4A37 A;  4UF4 A;  2PR8 A;  1XOV A;  3D2M A;  4MCQ A;  1Y0Y A;  4FWU A;  2PJ4 A;  1Z8W A;  4EVY A;  1Y9K A;  3CZX A;  2EEE A;  3F8K A;  1IU8 A;  1KUV A;  4UA3 A;  3GUX A;  5G21 A;  4R57 A;  4CGO A;  2BCO A;  5D8N A;  2AFS A;  2GFQ A;  4KOR A;  4CAV A;  5LRK A;  2C6C A;  2BUE A;  1LRZ A;  1Z8L A;  4MHP A;  2J8N A;  2PC1 A;  2PJ1 A;  3D3S A;  2DF5 A;  3SXN A;  4HNW B;  4P45 A;  1XMT A;  3CXS A;  1XIX A;  4AG7 A;  2GAN A;  2FL4 A;  2YGW A;  2OR4 A;  4TU0 A;  1ARL A;  2BFR A;  1FNO A;  3G8W A;  4WJB A;  5F09 A;  4NEX A;  4FD5 A;  2WSA A;  2H5M A;  2GRE A;  2Z0Z A;  2Q44 A;  3R95 A;  3VFQ A;  3KQZ A;  2O28 A;  3PB9 X;  2FIA A;  5I4M A;  4NXY A;  4R76 A;  2YNC A;  1IB1 E;  5F47 A;  4M6H A;  1XMB A;  1XBU A;  2O53 A;  1NMT A;  4RUH A;  3FIX A;  3JUW A;  1GHE A;  2RNK A;  4KOS A;  2OZH A;  4HPS A;  4UWJ A;  5AG6 A;  3TO6 A;  3LMS A;  4LQG A;  3IC1 A;  2FXK A;  4P4B A;  3SJE A;  3SIJ A;  2GE3 A;  2Q0Y A;  4XNH B;  4CPA A;  2CY2 A;  4BBH A;  1YR0 A;  2QYV A;  2B5G B;  4MFK A;  4RS2 A;  2C27 A;  2F8H A;  4ZYQ A;  2I3C A;  4KOW A;  4QVT A;  3GPO A;  5EMI A;  3RYO A;  2PJ7 A;  4ZBG A;  1BOB A;  5DWM A;  2Z3N A;  2HUZ A;  3ZZI A;  1S7L A;  2CIJ A;  2AFZ A;  4AVB A;  5EBV A;  2XD7 A;  3H8F A;  1XJO A;  2ARH A;  4NF1 A;  2EO8 A;  3RBU A;  2V8H A;  4PXC A;  1J4J A;  2QJ8 A;  4B5P A;  5J8C A;  2OU2 A;  3NH4 A;  3SJG A;  4KLW A;  1YLO A;  4ETJ A;  3IFE A;  2OZU A;  3BJ8 A;  1NJR A;  3IWE A;  4MI4 A;  1CBX A;  5LYD A;  3LAC A;  3V8I A;  3JRU A;  2AJ6 A;  2HC9 A;  1CP7 A;  2J8R A;  3PP9 A;  3SIH A;  1LFW A;  2FIW A;  3FED A;  3PB8 X;  4UIA A;  5IB9 A;  5CBM A;  2EUI A;  3S6F A;  1YQE A;  3FVL A;  3K9T A;  1Z5R A;  3HLP A;  5LRJ A;  1XFO A;  3GKR A;  2JEW A;  2OB0 A;  4NCZ A;  1VKC A;  5IB0 A;  3EJF A;  1PYT B;  3ISZ A;  1QSM A;  7CPA A;  2XEJ A;  2VL1 A;  1Z8X A;  2GU2 A;  3FNC A;  4NJR A;  2KCW A;  3T90 A;  4B10 A;  4QBJ A;  4AB7 A;  2P0W A;  5A27 A;  3BI1 A;  3DR6 A;  3JTK A;  3WC7 A;  2JZD A;  5KTD A;  1JWQ A;  1PUA A;  4U9Z A;  4JXQ A;  4BD9 A;  3PBB A;  2ZEN A;  4JZ0 A;  4X3R A;  3IWW A;  2B58 A;  4NJQ A;  4OC4 A;  4XNH C;  4XPK A;  2JZF A;  2DPT A;  1ELM P;  3QNV A;  4PK2 A;  4ZX9 A;  4UFW A;  5E96 A;  4IQY A;  2AFC A;  1S3Z A;  3EWP A;  1PU9 A;  2NMT A;  3K2K A;  3B3T A;  1IID A;  5ISV A;  3TCV A;  2JDC A;  4NGS A;  1IGB A;  5CB5 A;  5FSZ A;  3V38 A;  8CPA A;  1Z8T A;  5LYI A;  3WT4 A;  1KUY A;  2Y0M A;  4R9M A;  4C68 A;  4CAX A;  4CYP A;  4MJ8 A;  3TT2 A;  5LRG A;  2I00 A;  2R7H A;  5BWA B;  5LYF A;  4E8O A;  1F57 A;  5E3B A;  5J1Q A;  3EXN A;  3PB6 X;  3C26 A;  4FD6 A;  2Q43 A;  2ZEF A;  5FSY A;  3TOB A;  4ORF A;  5AG7 A;  2PJ6 A;  4GVV A;  4EFD A;  3B35 A;  2B4D B;  2X47 A;  3FJU A;  3PRT A;  2A4N A;  3SJF A;  2JBK A;  3KL9 A;  4A33 A;  1FT7 A;  1M4L A;  4OKO A;  4YU9 A;  1SPV A;  4Q7A A;  2R1I A;  1H8L A;  3H8G A;  2P6F A;  4JVV A;  2ZXV A;  4NGT A;  4Z65 A;  2BFQ A;  1P4N A;  4CGN A;  3PZJ A;  1Q2Y A;  1MK4 A;  1A2Z A;  3S6H A;  4CYQ A;  1NE9 A;  4UCM A;  5F48 A;  2PR1 A;  2XEI A;  5IV0 A;  4CRY B;  4XPL A;  1NSA A;  4E0A A;  4ESS A;  1TF9 A;  4JWP A;  3RO0 A;  4A30 A;  3W91 A;  1M4I A;  3CXP A;  4Q38 A;  2GIV A;  3VWD A;  3WR7 A;  3GQO A;  4A94 A;  4HNX B;  4P4F A;  1I21 A;  2BOA A;  3PFO A;  5GCN A;  2VEZ A;  4KOX A;  4PSW A;  1RTQ A;  1WK4 A;  2WYR A;  3Q6Z A;  3ISX A;  1I12 A;  1YGH A;  5AGE A;  2IMO A;  4X2T A;  4OLL A;  2OH1 A;  3D67 A;  4M3S A;  2GLF A;  2ZEP A;  3D66 A;  3SXO A;  2FT0 A;  1MJB A;  1YLE A;  2BEI A;  2WZN A;  4C2X A;  3G3S A;  3VAT A;  2B3V A;  3D4U A;  1CJW A;  4QB9 A;  4YFJ A;  4KZT A;  2F5I A;  3B7I A;  2G3T A;  2VRI A;  2VZY A;  1LAM A;  3DNS A;  2WUU A;  2PJC A;  1YVK A;  3L2N A;  2V77 A;  2PRB A;  4ONU A;  4P6Y A;  2OOT A;  2WCT A;  4DJL A;  4II9 A;  2OZG A;  3KR5 A;  4R6T A;  4ZX8 A;  3IO1 A;  3RAM A;  3F0A A;  1I1D A;  4J3G A;  3VH9 A;  3MGD A;  2FVG A;  1IYK A;  3FB3 A;  1Z2L A;  2Q4Z A;  4PXB A;  1BAV A;  1QSR A;  3PEI A;  2WPX A;  2ZEE A;  3HUV A;  4H89 A;  4MMO A;  5H86 A;  2Z3K A;  3FEE A;  4XPD B;  1Z9U A;  3BHX A;  3FYN A;  3KGQ A;  5G22 A;  2PQ8 A;  4DUK A;  2IL4 A;  3PGP A;  4FAI A;  4K3N A;  1B6B A;  1B87 A;  2Z10 A;  3FBU A;  4OME A;  4PK3 A;  3JZT A;  4F8Z A;  4MFL A;  5FSX A;  4X5K A;  5AG4 A;  3LD2 A;  1VHS A;  4JYW A;  3TC8 A;  2FAV A;  3KAS A;  4AVC A;  2REE A;  4B13 A;  1CPS A;  3R9E A;  4ZI6 A;  4JD6 A;  2YNE A;  1CM0 A;  1KWM A;  5CPA A;  2Z3P A;  3TOA A;  1UFH A;  3ETI A;  1TF8 A;  1AMP A;  2FG1 A;  2Z3O A;  2ZEO A;  2V8V A;  3DR8 A;  2DXQ A;  3GYA A;  1YSJ A;  2PIY A;  4PV6 A;  5HH1 A;  1ZG7 A;  3CPA A;  3P2H A;  4NGP A;  5HVF A;  4AVA A;  1N71 A;  1KUX A;  4GVW A;  4ABL A;  4KVO E;  4BMH A;  3FMC A;  3NH5 A;  3S9L A;  4EWT A;  4C7I A;  4UWI A;  1U6M A;  3Q71 A;  1BPN A;  1XRY A;  1DTD A;  2DEA A;  2PRQ A;  4H6Z A;  2R98 A;  1IOF A;  4A2Z A;  4CRZ B;  4B11 A;  4OID A;  1M4D A;  1R3N A;  1TKJ A;  1FY7 A;  2AFO A;  1ZG9 A;  2Q7S A;  2Z11 A;  3NA6 A;  4LX9 A;  4C2Y A;  3UY5 A;  1LAP A;  1YK3 A;  4HKF A;  4PQA A;  4C7H A;  1QMU A;  4GUA A;  4J5R A;  4MFZ A;  5G1Z A;  3T9Y A;  4A95 A;  4UEZ A;  2ZPA A;  1Y7E A;  1ZLI A;  2Q51 A;  2CTB A;  3CPX A;  5DUS A;  3FX6 A;  4MBU A;  5THW A;  4DYO A;  4F6A A;  4GS4 A;  1S7N A;  3SI2 A;  1TXZ A;  3B3W A;  4R8F A;  4GXH A;  1R43 A;  3B3C A;  4H6U A;  3K9U A;  4IUS A;  1JQG A;  3SHP A;  4QC6 A;  3SJX A;  4Y49 B;  1S7F A;  3VWE A;  5IX3 A;  2B4D A;  4R87 A;  3IEH A;  3B2Y A;  5CNP A;  4CS0 B;  2LGR A;  3KQX A;  2QIR A;  3I9S A;  4KOU A;  4LQ6 A;  4UFV A;  3BXM A;  5K8O A;  4YWY A;  3H8E A;  1Q7L A;  4MHZ A;  5HOL A;  2W2G A;  2VBQ A;  1XEB A;  2PIZ A;  4R3L A;  4IHM A;  1CP6 A;  4YRH A;  4F0X A;  4NGN A;  3IGR A;  4UFX A;  2ANP A;  4UEF A;  4UCP A;  4M6G A;  4PXE A;  3FH4 A;  3RNZ A;  2PJ2 A;  2ZW5 A;  1IIC A;  1ELL P;  2G3A A;  4L8A A;  3IIB A;  4UCN A;  3WC6 A;  4TNU A;  3GLJ A;  2JLM A;  4UIB A;  1QQ9 A;  1ZO0 A;  3FF3 A;  2PE3 A;  2Q4V A;  2JBJ A;  4B14 A;  2EK8 A;  4FD4 A;  4KOV A;  3IID A;  3V2B A;  3BLN A;  5F46 A;  5LYL A;  4RN7 A;  4NSQ A;  2ACF A;  4ZY0 A;  4A32 A;  4B5P B;  2ZW7 A;  1VHO A;  2Q7B A;  4KUA A;  1M1D A;  4Q36 A;  2J9A A;  2K5T A;  1QST A;  4NFR A;  4CAE A;  4J5S A;  1SQH A;  2PJ5 A;  3PFE A;  1Y7R A;  2PVV A;  1Y9W A;  3V7Z A;  3E0K A;  5HMN A;  3S6G A;  2D4O A;  5G20 A;  5H84 A;  4D86 A;  3I3G A;  1HDQ A;  4OAE A;  1YW6 A;  3FXT A;  3TO7 A;  4EME A;  5I0C A;  1HDU A;  2EBJ A;  2PDO A;  4P10 A;  5AIL A;  4FUU A;  2QEC A;  5HVG A;  3B3S A;  2ZOF A;  3D2P A;  2Z3L A;  4KS9 A;  1ARM A;  4W9Y A;  3EO4 A;  1YME A;  2Z3M A;  1RO5 A;  3P2F A;  4MCS A;  3D8P A;  4OC1 A;  4JGK A;  5F49 A;  4ZY1 A;  4CGM A;  1ZR3 A;  4OP4 A;  3B3V A;  3T8W A;  1QSO A;  4MFJ A;  1IY7 A;  3IU2 A;  5CB3 A;  5C82 A;  4X8I A;  1GYT A;  3BI0 A;  2I79 A;  1K4J A;  1Y0R A;  2BO9 A;  2B5G A;  3D7G A;  3MRU A;  4CGL A;  1HEE A;  4CAW A;  4ZGY B;  3CT9 A;  1ZR5 A;  3D7F A;  3H4Q A;  1IOI A;  1ON0 A;  3PB4 X;  3VAR A;  1Z4R A;  4K0C A;  1LOK A;  4E2A A;  3EJG A;  5FSU A;  3GQE A;  2ZW4 A;  1IYL A;  1YVO A;  3SIG A;  4MHN A;  3D7D A;  4HNY B;  1VHU A;  1MJA A;  1TXR A;  2ZEH A;  1S5K A;  5DS0 A;  5FVJ A;  4H2K A;  3KHX A;  2PJA A;  4CGP A;  1XE4 A;  4J5Q A;  4G1P A;  1BLL E;  2YND A;  4RI1 A;  3NE7 A;  3QAY A;  4MFP A;  4CAF A;  2HQY A;  3BJ7 A;  4AG9 A;  3S9N A;  3H5Z A;  4P4I A;  2JDD A;  2CTC A;  3A9L A;  3R96 A;  5KTA A;  4KVM E;  2NSM A;  4MY3 A;  4B6Z A;  3F5B A;  1PCA A;  1YD9 A;  3KI9 A;  5C88 A;  1VHE A;  4JXR A;  1CPX A;  3D7H A;  1EE3 P;  2PCU A;  1CG2 A;  3GIU A;  5KTC A;  2QML A;  1KZF A;  4PPZ A;  5FSV A;  2Q04 A;  2AFX A;  4MCR A;  2C6G A;  2V8D A;  3WAB A; 
#chains in the Genus database with same CATH homology
 1OBR A;  1ZG8 A;  4F9U A;  2G9D A;  2QVP A;  1CX8 A;  2IJZ A;  4O23 A;  1BPM A;  2EK9 A;  2NYQ A;  2PJ8 A;  2PJB A;  3KHZ A;  5D29 A;  2PJ0 A;  2POK A;  6CPA A;  3PB7 X;  3NFZ A;  4OC0 A;  1F2P A;  4OC3 A;  4IK2 A;  5HVH A;  1YW4 A;  1LCP A;  2CF4 A;  1F2O A;  5HXD A;  3N5F A;  2PVW A;  4TWE A;  3GPQ A;  3DLJ A;  3EWQ A;  3CDX A;  4ETK A;  2ABZ A;  3KR4 A;  4NGM A;  2L8R A;  5CMS A;  2PJ9 A;  3SI0 A;  1LAN A;  1TY8 A;  2IQ6 A;  3S9M A;  1ZLH A;  4J4Z A;  3RZA A;  3I1U A;  4NGQ A;  2GLJ A;  4MRI A;  3TX8 A;  2ZOG A;  3GB0 A;  2O4H A;  2ZEM A;  4IAV A;  2V8G A;  5JH9 A;  4UEE A;  3V45 A;  1AYE A;  5K8P A;  3NH8 A;  4KYB A;  3D68 A;  4UML A;  2XEF A;  2AFW A;  2RFH A;  3PBE A;  3EWR A;  4ABK A;  4OC2 A;  2C6P A;  4JLL A;  2EWB A;  1UWY A;  2C1C A;  4P4D A;  3EWO A;  1VGY A;  2PJ3 A;  2RB7 A;  3EW5 A;  3LWU A;  5JGF A;  4GM5 A;  3IIF A;  4PXD A;  5HIH A;  2ZEG A;  3GPG A;  4MCP A;  5ELY A;  5JM6 A;  3MN8 A;  4OC5 A;  3SI1 A;  5K8M A;  4MXU A;  4MHY A;  1TKF A;  2ZED A;  3FEC A;  3DGV A;  3KZW A;  3EKE A;  4KSI A;  4P44 A;  2ZEL A;  1TKH A;  2DX6 A;  4AXV A;  4ONW A;  2AFU A;  4F9V A;  4JCA A;  4ZY2 A;  1DE4 C;  4P4J A;  4A38 A;  2AFM A;  2XEG A;  5K8N A;  2HB6 A;  4NGR A;  4OIW A;  1VIX A;  1HJZ A;  4A39 A;  3SII A;  4R7M A;  2F7V A;  4WWV A;  4P4E A;  3IJ3 A;  4A37 A;  4UF4 A;  4MCQ A;  1Y0Y A;  4FWU A;  2PJ4 A;  2EEE A;  3GUX A;  2BCO A;  5D8N A;  2AFS A;  5LRK A;  2C6C A;  1Z8L A;  4MHP A;  2PJ1 A;  4P45 A;  2OR4 A;  4TU0 A;  1ARL A;  2BFR A;  1FNO A;  4WJB A;  5F09 A;  2GRE A;  3VFQ A;  3KQZ A;  3PB9 X;  5I4M A;  4R76 A;  1XMB A;  1XBU A;  2O53 A;  3LMS A;  4LQG A;  3IC1 A;  2FXK A;  4P4B A;  3SJE A;  3SIJ A;  4CPA A;  2QYV A;  3WC5 A;  2F8H A;  2I3C A;  4ZYQ A;  3GPO A;  2PJ7 A;  2CIJ A;  2AFZ A;  2XD7 A;  3H8F A;  1XJO A;  3RBU A;  2V8H A;  4PXC A;  2QJ8 A;  3NH4 A;  3SJG A;  1YLO A;  4ETJ A;  3IFE A;  5LYD A;  1NJR A;  1CBX A;  3JRU A;  2HC9 A;  1CP7 A;  4UIA A;  3SIH A;  1LFW A;  3FED A;  3PB8 X;  5IB9 A;  5CBM A;  3K9T A;  3FVL A;  1Z5R A;  3HLP A;  5LRJ A;  1XFO A;  2JEW A;  3EJF A;  1PYT B;  3ISZ A;  7CPA A;  2XEJ A;  2VL1 A;  4NJR A;  2GU2 A;  3BI1 A;  3WC7 A;  4BD9 A;  3PBB A;  2ZEN A;  4JZ0 A;  4X3R A;  3IWW A;  4NJQ A;  4OC4 A;  1ELM P;  3QNV A;  4ZX9 A;  4IQY A;  2AFC A;  3EWP A;  3K2K A;  3B3T A;  4NGS A;  1IGB A;  5CB5 A;  5FSZ A;  3V38 A;  8CPA A;  5LYI A;  3WT4 A;  5LRG A;  5LYF A;  1F57 A;  5E3B A;  5J1Q A;  3PB6 X;  2Q43 A;  2ZEF A;  5FSY A;  2PJ6 A;  4GVV A;  4EFD A;  3B35 A;  3PRT A;  2X47 A;  3FJU A;  3SJF A;  2JBK A;  3KL9 A;  1FT7 A;  1M4L A;  4OKO A;  4YU9 A;  1SPV A;  4Q7A A;  1H8L A;  3H8G A;  4Z65 A;  4JVV A;  4NGT A;  2BFQ A;  2XEI A;  1NSA A;  4ESS A;  1TF9 A;  3GQO A;  4A94 A;  4P4F A;  2BOA A;  3PFO A;  1RTQ A;  2WYR A;  3ISX A;  3Q6Z A;  2IMO A;  4X2T A;  3D67 A;  2GLF A;  2ZEP A;  3D66 A;  2WZN A;  3VAT A;  3D4U A;  3B7I A;  2VRI A;  1LAM A;  2PJC A;  3L2N A;  2V77 A;  4P6Y A;  2OOT A;  4DJL A;  3KR5 A;  4R6T A;  4ZX8 A;  3IO1 A;  3RAM A;  3VH9 A;  2FVG A;  4PXB A;  1Z2L A;  2Q4Z A;  1BAV A;  3PEI A;  2ZEE A;  3HUV A;  4MMO A;  3FEE A;  3BHX A;  3KGQ A;  4DUK A;  4FAI A;  4K3N A;  4OME A;  3JZT A;  4F8Z A;  5FSX A;  4JYW A;  3TC8 A;  2FAV A;  3KAS A;  1CPS A;  4ZI6 A;  5CPA A;  1KWM A;  3ETI A;  1TF8 A;  1AMP A;  2FG1 A;  2ZEO A;  2V8V A;  1YSJ A;  2PIY A;  5HVF A;  1ZG7 A;  3CPA A;  4NGP A;  4GVW A;  4ABL A;  3S9L A;  3FMC A;  3NH5 A;  4EWT A;  3Q71 A;  1BPN A;  1XRY A;  1DTD A;  2DEA A;  2PRQ A;  4OID A;  1R3N A;  1TKJ A;  4RUH A;  2AFO A;  1ZG9 A;  3NA6 A;  1LAP A;  4PQA A;  1QMU A;  4GUA A;  4J5R A;  4UEZ A;  5THW A;  1Y7E A;  1ZLI A;  2Q51 A;  2CTB A;  3CPX A;  5DUS A;  3FX6 A;  4FBE A;  4DYO A;  3SI2 A;  1TXZ A;  3B3W A;  4R8F A;  1R43 A;  3B3C A;  1JQG A;  3SJX A;  3IEH A;  3B2Y A;  2LGR A;  3KQX A;  3BXM A;  5K8O A;  4YWY A;  3H8E A;  1Q7L A;  4MHZ A;  5HOL A;  2PIZ A;  4IHM A;  1CP6 A;  4NGN A;  2ANP A;  4UEF A;  4PXE A;  3FH4 A;  2PJ2 A;  1ELL P;  3IIB A;  3WC6 A;  4TNU A;  3GLJ A;  4UIB A;  1QQ9 A;  3FF3 A;  2PE3 A;  2JBJ A;  2EK8 A;  3IID A;  3V2B A;  5LYL A;  2ACF A;  4ZY0 A;  1VHO A;  2J9A A;  4NFR A;  4J5S A;  2PJ5 A;  3PFE A;  2PVV A;  3V7Z A;  4D86 A;  1HDQ A;  1YW6 A;  4EME A;  1HDU A;  4P10 A;  5AIL A;  4FUU A;  5HVG A;  3B3S A;  2ZOF A;  1ARM A;  4W9Y A;  1YME A;  4MCS A;  4OC1 A;  4JGK A;  4ZY1 A;  1ZR3 A;  4OP4 A;  3B3V A;  3T8W A;  1IY7 A;  5CB3 A;  4X8I A;  1GYT A;  3BI0 A;  1Y0R A;  3D7G A;  2BO9 A;  3MRU A;  1HEE A;  3CT9 A;  1ZR5 A;  3D7F A;  3PB4 X;  3VAR A;  4K0C A;  1LOK A;  3EJG A;  5FSU A;  3GQE A;  4MHN A;  3SIG A;  3D7D A;  1VHU A;  2ZEH A;  1TXR A;  5DS0 A;  4H2K A;  3KHX A;  2PJA A;  4J5Q A;  4G1P A;  1BLL E;  3S9N A;  4P4I A;  2CTC A;  2NSM A;  4B6Z A;  3KI9 A;  1PCA A;  1YD9 A;  1VHE A;  1CPX A;  3D7H A;  1EE3 P;  2PCU A;  1CG2 A;  4PPZ A;  5FSV A;  4MCR A;  2AFX A;  2C6G A;  2V8D A;  3WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...