4K3NA

Phosphonic arginine mimetics as inhibitors of the m17 aminopeptidases from plasmodium falciparum
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Structure-Activity Relationships of Phosphonic Arginine Mimetics as Inhibitors of the M1 and M17 Aminopeptidases from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
total genus 179
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4k3nA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4k3nA02
2AFMA 3D7FA 4JVVA 3T8WA 5D8NA 8CPAA 3WC7A 2FG1A 3GPQA 3BXMA 3FF3A 3EWRA 3IIFA 3D4UA 1LCPA 2POKA 2V8GA 2BFQA 3IJ3A 5LYLA 3S9MA 5HVGA 5CB5A 1IGBA 2HC9A 3Q71A 5E3BA 4UEEA 5HVFA 3PFEA 1Q7LA 2G9DA 1PCAA 3SIJA 5FSUA 4UIAA 1YW6A 4YU9A 1QMUA 2ZEEA 3WT4A 3EJGA 4GVVA 3CT9A 1BLLE 2JBKA 2V8VA 3PB8X 3GPGA 3D7HA 1VGYA 3B3VA 4W9YA 2EWBA 1JQGA 5FSYA 2GU2A 1F2PA 4UEFA 4MHNA 4MRIA 4MMOA 4NGQA 3NFZA 3PB6X 4TWEA 5FSZA 1F57A 7CPAA 3FEDA 3BHXA 1YSJA 2O4HA 4OIWA 3H8GA 1Y0YA 3HLPA 2C6GA 3K2KA 4ABKA 4IQYA 1R43A 1Z8LA 4FAIA 4GM5A 4P4JA 2PJ2A 3EJFA 3IIDA 2IQ6A 3FJUA 3DLJA 1Y7EA 4FWUA 1TY8A 1CP6A 2ZEFA 4R8FA 4F8ZA 1TXRA 4R6TA 2Q43A 4OC3A 1ZG7A 2C6PA 1DE4C 4A39A 4NGTA 2V8HA 2PJBA 1ARLA 3SI1A 5DUSA 5CB3A 4OIDA 5FSXA 1LFWA 2BOAA 2QVPA 2I3CA 3SJGA 2QYVA 1PYTB 4P4BA 1XRYA 1YMEA 4A37A 4FBEA 3L2NA 1TXZA 2ZOFA 3KR4A 3Q6ZA 3N5FA 3SJFA 3EKEA 5DS0A 3NH5A 4F9UA 2NYQA 4ZYQA 4IAVA 4ZX8A 2PJ6A 4PQAA 5HXDA 4OMEA 4ONWA 4D86A 1ZR5A 1VIXA 3B3TA 3SIHA 2EK9A 2CTBA 4NGMA 2AFSA 2HB6A 2ACFA 4JCAA 2DEAA 2PIYA 4NGSA 4NGPA 4EMEA 2CIJA 4ZI6A 4F9VA 2AFUA 4MHZA 1DTDA 2XEIA 4WJBA 3SIGA 5HIHA 4OC5A 4J5QA 2ZEDA 4PXBA 2F8HA 5F09A 1CX8A 1HEEA 4FUUA 4GVWA 3GQEA 4PXCA 2ZEPA 1QQ9A 2PVVA 1ZLIA 3GQOA 2NSMA 4RUHA 3D7GA 1VHOA 5HOLA 4Z65A 3IEHA 4MHYA 3B3CA 3FVLA 4YWYA 3IO1A 2L8RA 3PB7X 3PB4X 3D67A 2PJ0A 4J5SA 2PJ8A 1ARMA 1IY7A 4DUKA 1GYTA 2IJZA 5D29A 3ISXA 4LQGA 3FEEA 6CPAA 1HJZA 4TU0A 1EE3P 4UF4A 3VATA 3IC1A 2PVWA 3K9TA 3KASA 4H2KA 1HDQA 3RZAA 2WZNA 1CPXA 1TF8A 3VARA 4KYBA 2DX6A 4P44A 4P4DA 3EWPA 3SJXA 4OC2A 2BO9A 5JGFA 4OC4A 3ETIA 2CTCA 2ZEGA 4IK2A 1AYEA 3EW5A 3CDXA 5THWA 3FX6A 2EK8A 5LRGA 1AMPA 3SIIA 2EEEA 4MXUA 4ESSA 3PRTA 4PXDA 4JLLA 3FH4A 4OC1A 2LGRA 1FT7A 2GREA 4P10A 4J5RA 3LWUA 4UIBA 4NJRA 5LYDA 1YD9A 4JYWA 4TNUA 4A38A 2CF4A 4ZY0A 4MCPA 1ZLHA 3BI0A 3JZTA 3NA6A 5AILA 3IWWA 2PE3A 3SJEA 5HVHA 4EWTA 1BPNA 5LRJA 2OR4A 5I4MA 1UWYA 3PB9X 2JBJA 5K8PA 4DYOA 5LYIA 2PJ9A 3BI1A 5FSVA 2PCUA 3KQXA 2J9AA 2XD7A 2RFHA 3S9LA 3D66A 3H8FA 5CPAA 3B2YA 4ZY1A 3MN8A 1TKFA 4PPZA 3SI2A 4IHMA 2AFZA 3PFOA 4K0CA 1ELLP 2V77A 2ANPA 3PBEA 2VRIA 2V8DA 2FAVA 5IB9A 3KI9A 2WYRA 3H8EA 3GLJA 5J1QA 1BPMA 4P4EA 3I1UA 3V7ZA 2F7VA 4MCQA 1ZR3A 4NGNA 3PEIA 3KHZA 3WC5A 1SPVA 4J4ZA 1R3NA 4G1PA 3B7IA 5ELYA 2AFCA 1LAPA 3DGVA 4CPAA 3CPXA 3V45A 2O53A 1XBUA 4UEZA 2JEWA 2Q4ZA 1LOKA 4Q7AA 2PJAA 3B3SA 4P45A 1CP7A 3IIBA 2IMOA 1LAMA 3KZWA 3RBUA 4WWVA 4NJQA 5JM6A 4K3NA 1XMBA 2PRQA 4JGKA 2GLJA 1VHEA 3B3WA 1BAVA 2PJ3A 2PJ4A 2ZEOA 3S9NA 4X3RA 3VH9A 3FECA 4OP4A 3D68A 2ZENA 1M4LA 5K8MA 3GUXA 2ZELA 4R76A 1KWMA 4NFRA 3NH4A 2X47A 1NSAA 2C1CA 4P4FA 4ETKA 3IFEA 4KSIA 2QJ8A 5CBMA 2C6CA 2FVGA 5LYFA 1FNOA 2ZOGA 4OKOA 1NJRA 3HUVA 1Z2LA 2AFWA 3JRUA 2PIZA 2Q51A 3GB0A 4UMLA 4A94A 2GLFA 1YLOA 3TC8A 2PJ5A 3PBBA 1TKHA 2XEFA 4O23A 1Y0RA 3B35A 1ZG8A 2ZEHA 3FMCA 1HDUA 2BFRA 3KGQA 2VL1A 4MHPA 3GPOA 1OBRA 3KHXA 1Z5RA 1XFOA 2OOTA 1F2OA 3SI0A 5CMSA 3VFQA 1CG2A 1TKJA 3EWOA 5K8OA 3KQZA 3RAMA 5LRKA 4NGRA 2PJ7A 1CBXA 2PJCA 3LMSA 5JH9A 3KR5A 3CPAA 4ZY2A 3KL9A 2ZEMA 4JZ0A 4R7MA 2BCOA 3QNVA 4MCSA 2AFOA 1LANA 4GUAA 2XEJA 3D7DA 4EFDA 4BD9A 1ZG9A 2ABZA 2FXKA 1ELMP 2PJ1A 2XEGA 4ETJA 1TF9A 4DJLA 2AFXA 4P4IA 3EWQA 3TX8A 1CPSA 3WC6A 4ABLA 4ZX9A 3V38A 4AXVA 4PXEA 4P6YA 1XJOA 4MCRA 3ISZA 3WABA 5K8NA 3NH8A 1H8LA 3V2BA 3MRUA 1YW4A 2RB7A 1RTQA 1VHUA 4B6ZA 4OC0A 4X2TA 4X8IA
chains in the Genus database with same CATH superfamily
2AFMA 3D7FA 5BWAB 4JVVA 3T8WA 4XPDC 5D8NA 3D3SA 4AXVA 2QECA 8CPAA 2B58A 4MBUA 3WC7A 4AVCA 2FG1A 3GPQA 1RXTA 3BXMA 1KZFA 3FF3A 3D8PA 1PU9A 2JDDA 3EWRA 4AG9A 4AB7A 1S5KA 4KOYA 4FD4A 3IIFA 3D4UA 1LCPA 2I79A 1IB1E 2YNDA 3W6XA 2POKA 5F48A 1Z4RA 2CNMA 1I21A 4PK2A 2V8GA 2BFQA 3ZJ0A 4HNYB 1IOIA 5KTCA 3IJ3A 5LYLA 3LODA 1L0CA 3S9MA 5HVGA 2YNCC 4XPKA 5CB5A 5H86A 4U9ZA 1IGBA 5FVJA 2HC9A 4KOTA 3Q71A 4UFWA 4B5OA 5E3BA 4JWPA 4UEEA 5HVFA 1IICA 2ZXVA 3PFEA 1Q7LA 2G9DA 2FCKA 1PCAA 2HUZA 3SIJA 2Q4VA 3EO4A 5FSUA 1QSTA 1X10A 4MFPA 4UIAA 1RO5A 4Q36A 3GYAA 2G3TA 1YW6A 4YU9A 1QMUA 2ZEEA 3WT4A 3EJGA 4GVVA 3IU1A 2ARHA 4CGLA 3SXNA 3CT9A 1BLLE 3VWEA 2JBKA 2JDCA 2V8VA 3GPGA 2Z11A 3PB8X 3D7HA 1VGYA 2WPWA 3B3VA 4W9YA 2EWBA 2WSAA 1YGHA 2OB0A 1U6MA 1JQGA 5FSYA 4M6IA 5C88A 2GU2A 1F2PA 3PZJA 3CXSA 4C2XA 4C2YA 3VWDA 4UEFA 1WWZA 3JTKA 2DPTA 1S7FA 4MHNA 5AGEA 4CGNA 3TFYA 4MRIA 4UBRA 4MMOA 4QC6A 4CYOA 1Y9KA 1Z9UA 4KVOE 1NSLA 3TE4A 4NGQA 2ZPAA 3NFZA 3PB6X 1Z8WA 4TWEA 4Y49B 5FSZA 3MGDA 1F57A 7CPAA 3FEDA 3BHXA 5A27A 5EBVA 1S7NA 2FIAA 4H89A 1YSJA 2O4HA 3S6HA 4OIWA 3T90A 3H8GA 2PQ8A 1Y0YA 2C27A 2YGWA 2C6GA 3HLPA 5JPHA 2W2GA 3K2KA 4ABKA 4IQYA 1R43A 1Z8LA 4YGOA 4L8AA 4A33A 3BJ8A 4FAIA 4KORA 4GM5A 1YR0A 4CYNA 4P4JA 3TO9A 1YLEA 2PJ2A 5AG5A 2PR1A 2A4NA 3GKRA 1YX0A 2VZZA 2Q0YA 4NF1A 3W6SA 3EJFA 2QIRA 3IIDA 2IQ6A 1I1DA 3FJUA 4CRZB 2JZEA 3DLJA 4RI1A 2WCTA 1Y7EA 4FD7A 1TY8A 4FWUA 1CP6A 2ZEFA 4Y49C 4R8FA 3TT2A 4F8ZA 3WR7A 4GXHA 4R9MA 1TXRA 4R6TA 1N71A 3CZXA 2Q43A 4OC3A 1SQHA 1ZG7A 2H5MA 2C6PA 1DE4C 4PSWA 4A39A 5AG4A 4KOVA 1S7KA 2DPSA 4XPLA 1WK4A 2V8HA 4NGTA 2EUIA 2OU2A 2PJBA 4QVTA 4F6AA 4M6HA 2F5IA 1ARLA 3SI1A 5DUSA 1Q2DA 1TIQA 2VQYA 5CB3A 3OWCA 4H6UA 4IUSA 1XIXA 5FSXA 1LFWA 2BOAA 2QVPA 4OIDA 4PV6A 5H84A 2I3CA 4CAWA 1Z8XA 1PYTB 2QYVA 4MI4A 1XRYA 1YMEA 2PC1A 4PK3A 3L2NA 4KOSA 4P4BA 1TXZA 3QB8A 4FBEA 2Q44A 1KUVA 2PDOA 2DXQA 4C68A 2ZOFA 2Q4YA 3KR4A 3Q6ZA 3N5FA 4NEXA 3SJFA 3TOAA 3EKEA 2ODFA 4B5PB 2JLMA 4KVME 5DS0A 3NH5A 4F9UA 4NCZA 2J8NA 2NYQA 4ZYQA 3S6KA 4IAVA 4ZX8A 1CM0A 2PJ6A 4PQAA 5HXDA 5AG7A 4OMEA 2D4PA 2B4DA 4ONWA 3R95A 4D86A 1ZR5A 1VIXA 5G1ZA 2RNKA 1P4NA 1A2ZA 2GANA 4JD6A 4NSQA 5CNPA 3B3TA 2KQVA 3SIHA 2EK9A 2R7HA 2CTBA 5DWNA 1YVKA 3P2HA 4GS4A 4MFKA 2AFSA 4NGMA 3QAHA 2HB6A 4U5YA 2ACFA 4JCAA 2FIWA 2DEAA 2PIYA 4Q38A 2D4OA 3N7ZA 4NGSA 4UCMA 4UWIA 4DNCA 4NGPA 4EMEA 2CIJA 3C26A 2G0BA 3EC4A 4ZI6A 4KOWA 1XEBA 4YFJA 4F9VA 2AFUA 5HH1A 4MHZA 2GFQA 4II9A 3R1KA 1DTDA 2XEIA 4A30A 4WJBA 3SIGA 2PR8A 4CAXA 3DNSA 5HIHA 1FY7A 4OC5A 4J5QA 5IX3A 3D2MA 2ZEDA 4PXBA 2REFA 2F8HA 4B14A 3FIXA 4LQ6A 4XPDB 5F09A 1CX8A 1HEEA 2HQYA 4FUUA 4J3GA 4L89A 3R9GA 2P6EA 3B8GA 4GVWA 2ZW4A 3R9EA 3GQEA 4PXCA 4C2ZA 4E2AA 4QBJA 2ZEPA 1QQ9A 2PVVA 4LUAA 3F0AA 1ZLIA 3BJ7A 3GQOA 2NSMA 4RUHA 3NE7A 3D7GA 1VHOA 2B4DB 1X12A 5HOLA 2FE7A 3IEHA 4Z65A 4MHYA 2FSRA 3B3CA 3FVLA 4YWYA 2Z3KA 3IO1A 4UWJA 2L8RA 3PB7X 3PB4X 4JJXA 4ZGYB 3D67A 2PJ0A 4J5SA 4ONUA 2PJ8A 3GIUA 1ARMA 1IY7A 1IYLA 3K9UA 4DUKA 2Y0MA 1GYTA 2IJZA 2B4BA 5D29A 2AJ6A 2B3UA 3ISXA 4JXQA 2QMLA 4LQGA 3FEEA 1B6BA 4JXRA 6CPAA 1HJZA 1MJ9A 5I0CA 4TU0A 1EE3P 4UF4A 3VATA 3SJGA 3IC1A 2PVWA 3K9TA 1S7LA 3FYNA 1ON0A 3EXNA 1XMTA 3KASA 2ZW5A 4H2KA 2OZUA 1HDQA 3RZAA 2WZNA 3D2PA 1CPXA 1TF8A 1JWQA 2Z3PA 3VARA 4B13A 2J8RA 4KYBA 3EFAA 4C7HA 2DX6A 2P0WA 4P44A 4BMHA 1P0HA 2EBJA 4OAEA 4P4DA 2Z3NA 3EWPA 3SJXA 4OC2A 1KUXA 2BO9A 3ZZIA 5JGFA 4OC4A 1XE4A 3ETIA 2CTCA 2ZEGA 3G3SA 4IK2A 2KCWA 1AYEA 3EW5A 3CDXA 4CAFA 5THWA 3FX6A 3R96A 4LX9A 2EK8A 1AUGA 2CXAA 5LRGA 3F8KA 1AMPA 3SIIA 2EEEA 2YNEA 3IU2A 3P2FA 4MXUA 5F46A 4ESSA 3PRTA 4PXDA 4MY3A 4JLLA 1BOBA 2OZGA 3FH4A 4A31A 4OC1A 1Y9WA 4ZBGA 2LGRA 1FT7A 2GREA 1IU8A 4P10A 4J5RA 3LWUA 4KVXA 2EVNA 4UIBA 4NJRA 5LYDA 1YD9A 4JYWA 4TNUA 2Z3MA 3S6FA 1I12A 4A38A 5IB0A 2CF4A 3FB3A 4ZY0A 3DSBA 3E0KA 4MCPA 1ZLHA 3BI0A 3JZTA 3NA6A 1S3ZA 5AILA 3FBUA 3IWWA 2Z10A 2G3AA 2PE3A 3SJEA 1OZPA 2Z3LA 5HVHA 4EWTA 1BPNA 5LRJA 2OR4A 5I4MA 1J4JA 1UWYA 3PB9X 2JBJA 5K8PA 4DYOA 5LYIA 2PJ9A 2VI7A 2Q7SA 3BI1A 1QSOA 4QUSA 4UCPA 3TTHA 5FSVA 3RNZA 2AE6A 2PCUA 3KQXA 2VEZA 2J9AA 2XD7A 2RFHA 4HNWB 4UCNA 4CGPA 3D66A 1KUYA 2YNCA 4HNXB 3S9LA 3H8FA 3IWEA 5CPAA 3TO6A 3JVNA 2PSWA 3B2YA 4ZY1A 2DF5A 4XNHB 2WPXA 2GIVA 4MFZA 3MN8A 1TKFA 2OH1A 4KSFA 4FD6A 4I49A 4K30A 4PPZA 3SI2A 4IHMA 1IYKA 3LD2A 3QAYA 2AFZA 5DWMA 3TO7A 3PFOA 4K0CA 1ELLP 2V77A 2ANPA 1M4DA 3PBEA 2Z0ZA 1S60A 2VRIA 2V8DA 2FAVA 4A37A 5IB9A 4AG7A 3KI9A 2WYRA 4R3LA 3H8EA 1QSMA 2FL4A 3GLJA 2IL4A 4C7IA 4E0AA 4B12A 5J1QA 4KSAA 3G8WA 1BPMA 4CS0B 4P4EA 3I1UA 3V7ZA 2F7VA 4MCQA 1ZR3A 4NGNA 3PEIA 3KHZA 3WC5A 1SPVA 4J4ZA 1R3NA 4G1PA 2ZW6A 3B7IA 5ELYA 2AFCA 1LAPA 3DGVA 4CAVA 4CPAA 4BBHA 2CNSA 2O28A 3CPXA 3V45A 1VHSA 2O53A 4M3SA 1XBUA 4MY0A 4UEZA 1IOFA 1Q2CA 2JEWA 2X7BA 2FXFA 2Q4ZA 2REEA 2VXKA 1LOKA 3H4QA 4KZTA 4B10A 4Q7AA 2PJAA 3B3SA 4P45A 5EMIA 5KTAA 1CP7A 4A95A 1ZO0A 1NE9A 1Z4EA 2B3VA 2FT0A 2IMOA 1LAMA 3IIBA 3NE8A 2NMTA 4KUBA 4UFXA 1V0CA 3KZWA 2JEVA 3RBUA 4CGMA 2K5TA 2HV2A 4WWVA 1MK4A 4NJQA 4EVYA 5JM6A 4K3NA 1XMBA 2P6GA 2R8VA 2CNTA 2PRQA 4JGKA 2GLJA 1VHEA 3EY5A 4KS9A 3B3WA 1BAVA 4KOXA 1QSNA 4RN7A 2PJ3A 2ATRA 2PJ4A 2JZDA 2ZEOA 4M6GA 4M85A 1Q2YA 4MFJA 4RS2A 3RYOA 4A32A 3S9NA 5ISVA 2P6FA 4X3RA 5G20A 5F47A 3VH9A 2B5GA 3FECA 4OP4A 2CY2A 3D68A 2ZENA 5J8CA 1M4LA 1IIDA 5K8MA 1YQEA 2OZHA 3GUXA 2ZELA 4R76A 2ZW7A 1KWMA 4NFRA 4XNHC 3W91A 3NH4A 4UA3A 2X47A 3CXPA 4CYPA 4H6ZA 1VKCA 2Q04A 4KOUA 1NSAA 1YREA 2C1CA 4P4FA 4ETKA 3IFEA 3PGPA 2BEIA 4KSIA 2QJ8A 5CBMA 2C6CA 2FVGA 5LYFA 1FNOA 2ZOGA 4OKOA 1NJRA 4F0YA 3HUVA 3I9SA 1Z2LA 2AFWA 4E8OA 2EO8A 3JRUA 2Z3OA 4QB9A 5J8FA 3S6GA 2PIZA 2Q51A 3GB0A 1M1DA 4UMLA 3DDDA 4A94A 1MJBA 2GLFA 1YLOA 3TC8A 2BSWA 4R57A 4CAEA 1XF8A 2PJ5A 4OADA 5G21A 3A9LA 3PBBA 1LRZA 1TKHA 1UFHA 5E96A 5IV0A 2XEFA 5JQ4A 4O23A 2FS5A 1Y0RA 2BL1A 3H5ZA 3B35A 3TCVA 3TOBA 2I00A 1ZG8A 2ZEHA 3FMCA 1HDUA 3DR8A 2GE3A 2BFRA 1QSRA 2PRBA 1GHEA 3PP9A 3DR6A 3KGQA 1BO4A 2VL1A 3SHPA 4MHPA 4FD5A 3GPOA 1OBRA 3KHXA 3JUWA 1Z5RA 1XFOA 2OOTA 1F2OA 3V8IA 5HMNA 2R1IA 2VZYA 3SI0A 1YVOA 4KLVA 3I3GA 1Z8TA 4CYQA 4UFVA 5CMSA 5A28A 3VFQA 1CG2A 1MJAA 3EWOA 1TKJA 5K8OA 3KQZA 1R57A 2R98A 3RAMA 1B87A 1M4IA 1NMTA 4KLWA 5G22A 4A2ZA 4NGRA 5EC4A 4F0XA 5LRKA 4R87A 2PJ7A 1CBXA 2PJCA 3LMSA 4U9YA 4MHDA 5JH9A 3KR5A 3CPAA 4ZY2A 3KL9A 2ZEMA 4NXYA 4X5KA 4JZ0A 4R7MA 2VBQA 4CGOA 4YRHA 3FRMA 2BCOA 4B11A 2JZFA 4AVBA 3QNVA 1K4JA 4MCSA 4B5PA 2AFOA 2B5GB 1LANA 3T9YA 4GUAA 4MJ8A 2XEJA 3D7DA 4JLYA 4HPSA 5F49A 1PUAA 2J8MA 4AVAA 5KTDA 4MFLA 2RC4A 5GCNA 4BD9A 1ZG9A 4EFDA 4KUAA 2ABZA 2FXKA 3RO0A 1ELMP 1Y7RA 2PJ1A 2XEGA 4ETJA 4IF5A 4PSXA 1TF9A 5C82A 3GY9A 4DJLA 2AFXA 4P4IA 3FXTA 3EWQA 1M4GA 2WUUA 3TX8A 3UY5A 1CPSA 1YK3A 3IWGA 3WC6A 4R3KA 3LACA 4ABLA 4MFQA 4ZX9A 1M44A 3V38A 4PXEA 4P6YA 1XJOA 4MCRA 1XOVA 3ISZA 3KKWA 1CJWA 5AG6A 3NH8A 3WABA 3F5BA 5K8NA 1H8LA 3V2BA 2BUEA 3MRUA 1YW4A 3FNCA 2RB7A 3CXQA 4BINA 1RTQA 4HKFA 1VHUA 4B6ZA 3BLNA 3IGRA 4OC0A 4ORFA 3R9FA 4OLLA 3SXOA 4X2TA 4CRYB 4X8IA 2Q7BA
chains in the Genus database with same CATH topology
2AFMA 3D7FA 4JVVA 3T8WA 5D8NA 8CPAA 3WC7A 2FG1A 3GPQA 3BXMA 3FF3A 3EWRA 3IIFA 3D4UA 1LCPA 2POKA 2V8GA 2BFQA 3IJ3A 5LYLA 3S9MA 5HVGA 5CB5A 1IGBA 2HC9A 3Q71A 5E3BA 4UEEA 5HVFA 3PFEA 1Q7LA 2G9DA 1PCAA 3SIJA 5FSUA 4UIAA 1YW6A 4YU9A 1QMUA 2ZEEA 3WT4A 3EJGA 4GVVA 3CT9A 1BLLE 2JBKA 2V8VA 3PB8X 3GPGA 3D7HA 1VGYA 3B3VA 4W9YA 2EWBA 1JQGA 5FSYA 2GU2A 1F2PA 4UEFA 4MHNA 4MRIA 4MMOA 4NGQA 3NFZA 3PB6X 4TWEA 5FSZA 1F57A 7CPAA 3FEDA 3BHXA 1YSJA 2O4HA 4OIWA 3H8GA 1Y0YA 3HLPA 2C6GA 3K2KA 4ABKA 4IQYA 1R43A 1Z8LA 4FAIA 4GM5A 4P4JA 2PJ2A 3EJFA 3IIDA 2IQ6A 3FJUA 3DLJA 1Y7EA 4FWUA 1TY8A 1CP6A 2ZEFA 4R8FA 4F8ZA 1TXRA 4R6TA 2Q43A 4OC3A 1ZG7A 2C6PA 1DE4C 4A39A 4NGTA 2V8HA 2PJBA 1ARLA 3SI1A 5DUSA 5CB3A 4OIDA 5FSXA 1LFWA 2BOAA 2QVPA 2I3CA 3SJGA 2QYVA 1PYTB 4P4BA 1XRYA 1YMEA 4A37A 4FBEA 3L2NA 1TXZA 2ZOFA 3KR4A 3Q6ZA 3N5FA 3SJFA 3EKEA 5DS0A 3NH5A 4F9UA 2NYQA 4ZYQA 4IAVA 4ZX8A 2PJ6A 4PQAA 5HXDA 4OMEA 4ONWA 4D86A 1ZR5A 1VIXA 3B3TA 3SIHA 2EK9A 2CTBA 4NGMA 2AFSA 2HB6A 2ACFA 4JCAA 2DEAA 2PIYA 4NGSA 4NGPA 4EMEA 2CIJA 4ZI6A 4F9VA 2AFUA 4MHZA 1DTDA 2XEIA 4WJBA 3SIGA 5HIHA 4OC5A 4J5QA 2ZEDA 4PXBA 2F8HA 5F09A 1CX8A 1HEEA 4FUUA 4GVWA 3GQEA 4PXCA 2ZEPA 1QQ9A 2PVVA 1ZLIA 3GQOA 2NSMA 4RUHA 3D7GA 1VHOA 5HOLA 4Z65A 3IEHA 4MHYA 3B3CA 3FVLA 4YWYA 3IO1A 2L8RA 3PB7X 3PB4X 3D67A 2PJ0A 4J5SA 2PJ8A 1ARMA 1IY7A 4DUKA 1GYTA 2IJZA 5D29A 3ISXA 4LQGA 3FEEA 6CPAA 1HJZA 4TU0A 1EE3P 4UF4A 3VATA 3IC1A 2PVWA 3K9TA 3KASA 4H2KA 1HDQA 3RZAA 2WZNA 1CPXA 1TF8A 3VARA 4KYBA 2DX6A 4P44A 4P4DA 3EWPA 3SJXA 4OC2A 2BO9A 5JGFA 4OC4A 3ETIA 2CTCA 2ZEGA 4IK2A 1AYEA 3EW5A 3CDXA 5THWA 3FX6A 2EK8A 5LRGA 1AMPA 3SIIA 2EEEA 4MXUA 4ESSA 3PRTA 4PXDA 4JLLA 3FH4A 4OC1A 2LGRA 1FT7A 2GREA 4P10A 4J5RA 3LWUA 4UIBA 4NJRA 5LYDA 1YD9A 4JYWA 4TNUA 4A38A 2CF4A 4ZY0A 4MCPA 1ZLHA 3BI0A 3JZTA 3NA6A 5AILA 3IWWA 2PE3A 3SJEA 5HVHA 4EWTA 1BPNA 5LRJA 2OR4A 5I4MA 1UWYA 3PB9X 2JBJA 5K8PA 4DYOA 5LYIA 2PJ9A 3BI1A 5FSVA 2PCUA 3KQXA 2J9AA 2XD7A 2RFHA 3S9LA 3D66A 3H8FA 5CPAA 3B2YA 4ZY1A 3MN8A 1TKFA 4PPZA 3SI2A 4IHMA 2AFZA 3PFOA 4K0CA 1ELLP 2V77A 2ANPA 3PBEA 2VRIA 2V8DA 2FAVA 5IB9A 3KI9A 2WYRA 3H8EA 3GLJA 5J1QA 1BPMA 4P4EA 3I1UA 3V7ZA 2F7VA 4MCQA 1ZR3A 4NGNA 3PEIA 3KHZA 3WC5A 1SPVA 4J4ZA 1R3NA 4G1PA 3B7IA 5ELYA 2AFCA 1LAPA 3DGVA 4CPAA 3CPXA 3V45A 2O53A 1XBUA 4UEZA 2JEWA 2Q4ZA 1LOKA 4Q7AA 2PJAA 3B3SA 4P45A 1CP7A 3IIBA 2IMOA 1LAMA 3KZWA 3RBUA 4WWVA 4NJQA 5JM6A 4K3NA 1XMBA 2PRQA 4JGKA 2GLJA 1VHEA 3B3WA 1BAVA 2PJ3A 2PJ4A 2ZEOA 3S9NA 4X3RA 3VH9A 3FECA 4OP4A 3D68A 2ZENA 1M4LA 5K8MA 3GUXA 2ZELA 4R76A 1KWMA 4NFRA 3NH4A 2X47A 1NSAA 2C1CA 4P4FA 4ETKA 3IFEA 4KSIA 2QJ8A 5CBMA 2C6CA 2FVGA 5LYFA 1FNOA 2ZOGA 4OKOA 1NJRA 3HUVA 1Z2LA 2AFWA 3JRUA 2PIZA 2Q51A 3GB0A 4UMLA 4A94A 2GLFA 1YLOA 3TC8A 2PJ5A 3PBBA 1TKHA 2XEFA 4O23A 1Y0RA 3B35A 1ZG8A 2ZEHA 3FMCA 1HDUA 2BFRA 3KGQA 2VL1A 4MHPA 3GPOA 1OBRA 3KHXA 1Z5RA 1XFOA 2OOTA 1F2OA 3SI0A 5CMSA 3VFQA 1CG2A 1TKJA 3EWOA 5K8OA 3KQZA 3RAMA 5LRKA 4NGRA 2PJ7A 1CBXA 2PJCA 3LMSA 5JH9A 3KR5A 3CPAA 4ZY2A 3KL9A 2ZEMA 4JZ0A 4R7MA 2BCOA 3QNVA 4MCSA 2AFOA 1LANA 4GUAA 2XEJA 3D7DA 4EFDA 4BD9A 1ZG9A 2ABZA 2FXKA 1ELMP 2PJ1A 2XEGA 4ETJA 1TF9A 4DJLA 2AFXA 4P4IA 3EWQA 3TX8A 1CPSA 3WC6A 4ABLA 4ZX9A 3V38A 4AXVA 4PXEA 4P6YA 1XJOA 4MCRA 3ISZA 3WABA 5K8NA 3NH8A 1H8LA 3V2BA 3MRUA 1YW4A 2RB7A 1RTQA 1VHUA 4B6ZA 4OC0A 4X2TA 4X8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFM A;  3D7F A;  4JVV A;  3T8W A;  5D8N A;  8CPA A;  3WC7 A;  2FG1 A;  3GPQ A;  3BXM A;  3FF3 A;  3EWR A;  3IIF A;  3D4U A;  1LCP A;  2POK A;  2V8G A;  2BFQ A;  3IJ3 A;  5LYL A;  3S9M A;  5HVG A;  5CB5 A;  1IGB A;  2HC9 A;  3Q71 A;  5E3B A;  4UEE A;  5HVF A;  3PFE A;  1Q7L A;  2G9D A;  1PCA A;  3SIJ A;  5FSU A;  4UIA A;  1YW6 A;  4YU9 A;  1QMU A;  2ZEE A;  3WT4 A;  3EJG A;  4GVV A;  3CT9 A;  1BLL E;  2JBK A;  2V8V A;  3PB8 X;  3GPG A;  3D7H A;  1VGY A;  3B3V A;  4W9Y A;  2EWB A;  1JQG A;  5FSY A;  2GU2 A;  1F2P A;  4UEF A;  4MHN A;  4MRI A;  4MMO A;  4NGQ A;  3NFZ A;  3PB6 X;  4TWE A;  5FSZ A;  1F57 A;  7CPA A;  3FED A;  3BHX A;  1YSJ A;  2O4H A;  4OIW A;  3H8G A;  1Y0Y A;  3HLP A;  2C6G A;  3K2K A;  4ABK A;  4IQY A;  1R43 A;  1Z8L A;  4FAI A;  4GM5 A;  4P4J A;  2PJ2 A;  3EJF A;  3IID A;  2IQ6 A;  3FJU A;  3DLJ A;  1Y7E A;  4FWU A;  1TY8 A;  1CP6 A;  2ZEF A;  4R8F A;  4F8Z A;  1TXR A;  4R6T A;  2Q43 A;  4OC3 A;  1ZG7 A;  2C6P A;  1DE4 C;  4A39 A;  4NGT A;  2V8H A;  2PJB A;  1ARL A;  3SI1 A;  5DUS A;  5CB3 A;  4OID A;  5FSX A;  1LFW A;  2BOA A;  2QVP A;  2I3C A;  3SJG A;  2QYV A;  1PYT B;  4P4B A;  1XRY A;  1YME A;  4A37 A;  4FBE A;  3L2N A;  1TXZ A;  2ZOF A;  3KR4 A;  3Q6Z A;  3N5F A;  3SJF A;  3EKE A;  5DS0 A;  3NH5 A;  4F9U A;  2NYQ A;  4ZYQ A;  4IAV A;  4ZX8 A;  2PJ6 A;  4PQA A;  5HXD A;  4OME A;  4ONW A;  4D86 A;  1ZR5 A;  1VIX A;  3B3T A;  3SIH A;  2EK9 A;  2CTB A;  4NGM A;  2AFS A;  2HB6 A;  2ACF A;  4JCA A;  2DEA A;  2PIY A;  4NGS A;  4NGP A;  4EME A;  2CIJ A;  4ZI6 A;  4F9V A;  2AFU A;  4MHZ A;  1DTD A;  2XEI A;  4WJB A;  3SIG A;  5HIH A;  4OC5 A;  4J5Q A;  2ZED A;  4PXB A;  2F8H A;  5F09 A;  1CX8 A;  1HEE A;  4FUU A;  4GVW A;  3GQE A;  4PXC A;  2ZEP A;  1QQ9 A;  2PVV A;  1ZLI A;  3GQO A;  2NSM A;  4RUH A;  3D7G A;  1VHO A;  5HOL A;  4Z65 A;  3IEH A;  4MHY A;  3B3C A;  3FVL A;  4YWY A;  3IO1 A;  2L8R A;  3PB7 X;  3PB4 X;  3D67 A;  2PJ0 A;  4J5S A;  2PJ8 A;  1ARM A;  1IY7 A;  4DUK A;  1GYT A;  2IJZ A;  5D29 A;  3ISX A;  4LQG A;  3FEE A;  6CPA A;  1HJZ A;  4TU0 A;  1EE3 P;  4UF4 A;  3VAT A;  3IC1 A;  2PVW A;  3K9T A;  3KAS A;  4H2K A;  1HDQ A;  3RZA A;  2WZN A;  1CPX A;  1TF8 A;  3VAR A;  4KYB A;  2DX6 A;  4P44 A;  4P4D A;  3EWP A;  3SJX A;  4OC2 A;  2BO9 A;  5JGF A;  4OC4 A;  3ETI A;  2CTC A;  2ZEG A;  4IK2 A;  1AYE A;  3EW5 A;  3CDX A;  5THW A;  3FX6 A;  2EK8 A;  5LRG A;  1AMP A;  3SII A;  2EEE A;  4MXU A;  4ESS A;  3PRT A;  4PXD A;  4JLL A;  3FH4 A;  4OC1 A;  2LGR A;  1FT7 A;  2GRE A;  4P10 A;  4J5R A;  3LWU A;  4UIB A;  4NJR A;  5LYD A;  1YD9 A;  4JYW A;  4TNU A;  4A38 A;  2CF4 A;  4ZY0 A;  4MCP A;  1ZLH A;  3BI0 A;  3JZT A;  3NA6 A;  5AIL A;  3IWW A;  2PE3 A;  3SJE A;  5HVH A;  4EWT A;  1BPN A;  5LRJ A;  2OR4 A;  5I4M A;  1UWY A;  3PB9 X;  2JBJ A;  5K8P A;  4DYO A;  5LYI A;  2PJ9 A;  3BI1 A;  5FSV A;  2PCU A;  3KQX A;  2J9A A;  2XD7 A;  2RFH A;  3S9L A;  3D66 A;  3H8F A;  5CPA A;  3B2Y A;  4ZY1 A;  3MN8 A;  1TKF A;  4PPZ A;  3SI2 A;  4IHM A;  2AFZ A;  3PFO A;  4K0C A;  1ELL P;  2V77 A;  2ANP A;  3PBE A;  2VRI A;  2V8D A;  2FAV A;  5IB9 A;  3KI9 A;  2WYR A;  3H8E A;  3GLJ A;  5J1Q A;  1BPM A;  4P4E A;  3I1U A;  3V7Z A;  2F7V A;  4MCQ A;  1ZR3 A;  4NGN A;  3PEI A;  3KHZ A;  3WC5 A;  1SPV A;  4J4Z A;  1R3N A;  4G1P A;  3B7I A;  5ELY A;  2AFC A;  1LAP A;  3DGV A;  4CPA A;  3CPX A;  3V45 A;  2O53 A;  1XBU A;  4UEZ A;  2JEW A;  2Q4Z A;  1LOK A;  4Q7A A;  2PJA A;  3B3S A;  4P45 A;  1CP7 A;  3IIB A;  2IMO A;  1LAM A;  3KZW A;  3RBU A;  4WWV A;  4NJQ A;  5JM6 A;  4K3N A;  1XMB A;  2PRQ A;  4JGK A;  2GLJ A;  1VHE A;  3B3W A;  1BAV A;  2PJ3 A;  2PJ4 A;  2ZEO A;  3S9N A;  4X3R A;  3VH9 A;  3FEC A;  4OP4 A;  3D68 A;  2ZEN A;  1M4L A;  5K8M A;  3GUX A;  2ZEL A;  4R76 A;  1KWM A;  4NFR A;  3NH4 A;  2X47 A;  1NSA A;  2C1C A;  4P4F A;  4ETK A;  3IFE A;  4KSI A;  2QJ8 A;  5CBM A;  2C6C A;  2FVG A;  5LYF A;  1FNO A;  2ZOG A;  4OKO A;  1NJR A;  3HUV A;  1Z2L A;  2AFW A;  3JRU A;  2PIZ A;  2Q51 A;  3GB0 A;  4UML A;  4A94 A;  2GLF A;  1YLO A;  3TC8 A;  2PJ5 A;  3PBB A;  1TKH A;  2XEF A;  4O23 A;  1Y0R A;  3B35 A;  1ZG8 A;  2ZEH A;  3FMC A;  1HDU A;  2BFR A;  3KGQ A;  2VL1 A;  4MHP A;  3GPO A;  1OBR A;  3KHX A;  1Z5R A;  1XFO A;  2OOT A;  1F2O A;  3SI0 A;  5CMS A;  3VFQ A;  1CG2 A;  1TKJ A;  3EWO A;  5K8O A;  3KQZ A;  3RAM A;  5LRK A;  4NGR A;  2PJ7 A;  1CBX A;  2PJC A;  3LMS A;  5JH9 A;  3KR5 A;  3CPA A;  4ZY2 A;  3KL9 A;  2ZEM A;  4JZ0 A;  4R7M A;  2BCO A;  3QNV A;  4MCS A;  2AFO A;  1LAN A;  4GUA A;  2XEJ A;  3D7D A;  4EFD A;  4BD9 A;  1ZG9 A;  2ABZ A;  2FXK A;  1ELM P;  2PJ1 A;  2XEG A;  4ETJ A;  1TF9 A;  4DJL A;  2AFX A;  4P4I A;  3EWQ A;  3TX8 A;  1CPS A;  3WC6 A;  4ABL A;  4ZX9 A;  3V38 A;  4AXV A;  4PXE A;  4P6Y A;  1XJO A;  4MCR A;  3ISZ A;  3WAB A;  5K8N A;  3NH8 A;  1H8L A;  3V2B A;  3MRU A;  1YW4 A;  2RB7 A;  1RTQ A;  1VHU A;  4B6Z A;  4OC0 A;  4X2T A;  4X8I A; 
#chains in the Genus database with same CATH topology
 2AFM A;  3D7F A;  5BWA B;  4JVV A;  3T8W A;  4XPD C;  5D8N A;  3D3S A;  4AXV A;  2QEC A;  8CPA A;  2B58 A;  4MBU A;  3WC7 A;  4AVC A;  2FG1 A;  3GPQ A;  1RXT A;  3BXM A;  1KZF A;  3FF3 A;  3D8P A;  1PU9 A;  2JDD A;  3EWR A;  4AG9 A;  4AB7 A;  1S5K A;  4KOY A;  4FD4 A;  3IIF A;  3D4U A;  1LCP A;  2I79 A;  1IB1 E;  2YND A;  3W6X A;  2POK A;  5F48 A;  1Z4R A;  2CNM A;  1I21 A;  4PK2 A;  2V8G A;  2BFQ A;  3ZJ0 A;  4HNY B;  1IOI A;  5KTC A;  3IJ3 A;  5LYL A;  3LOD A;  1L0C A;  3S9M A;  5HVG A;  2YNC C;  4XPK A;  5CB5 A;  5H86 A;  4U9Z A;  1IGB A;  5FVJ A;  2HC9 A;  4KOT A;  3Q71 A;  4UFW A;  4B5O A;  5E3B A;  4JWP A;  4UEE A;  5HVF A;  1IIC A;  2ZXV A;  3PFE A;  1Q7L A;  2G9D A;  2FCK A;  1PCA A;  2HUZ A;  3SIJ A;  2Q4V A;  3EO4 A;  5FSU A;  1QST A;  1X10 A;  4MFP A;  4UIA A;  1RO5 A;  4Q36 A;  3GYA A;  2G3T A;  1YW6 A;  4YU9 A;  1QMU A;  2ZEE A;  3WT4 A;  3EJG A;  4GVV A;  3IU1 A;  2ARH A;  4CGL A;  3SXN A;  3CT9 A;  1BLL E;  3VWE A;  2JBK A;  2JDC A;  2V8V A;  3GPG A;  2Z11 A;  3PB8 X;  3D7H A;  1VGY A;  2WPW A;  3B3V A;  4W9Y A;  2EWB A;  2WSA A;  1YGH A;  2OB0 A;  1U6M A;  1JQG A;  5FSY A;  4M6I A;  5C88 A;  2GU2 A;  1F2P A;  3PZJ A;  3CXS A;  4C2X A;  4C2Y A;  3VWD A;  4UEF A;  1WWZ A;  3JTK A;  2DPT A;  1S7F A;  4MHN A;  5AGE A;  4CGN A;  3TFY A;  4MRI A;  4UBR A;  4MMO A;  4QC6 A;  4CYO A;  1Y9K A;  1Z9U A;  4KVO E;  1NSL A;  3TE4 A;  4NGQ A;  2ZPA A;  3NFZ A;  3PB6 X;  1Z8W A;  4TWE A;  4Y49 B;  5FSZ A;  3MGD A;  1F57 A;  7CPA A;  3FED A;  3BHX A;  5A27 A;  5EBV A;  1S7N A;  2FIA A;  4H89 A;  1YSJ A;  2O4H A;  3S6H A;  4OIW A;  3T90 A;  3H8G A;  2PQ8 A;  1Y0Y A;  2C27 A;  2YGW A;  2C6G A;  3HLP A;  5JPH A;  2W2G A;  3K2K A;  4ABK A;  4IQY A;  1R43 A;  1Z8L A;  4YGO A;  4L8A A;  4A33 A;  3BJ8 A;  4FAI A;  4KOR A;  4GM5 A;  1YR0 A;  4CYN A;  4P4J A;  3TO9 A;  1YLE A;  2PJ2 A;  5AG5 A;  2PR1 A;  2A4N A;  3GKR A;  1YX0 A;  2VZZ A;  2Q0Y A;  4NF1 A;  3W6S A;  3EJF A;  2QIR A;  3IID A;  2IQ6 A;  1I1D A;  3FJU A;  4CRZ B;  2JZE A;  3DLJ A;  4RI1 A;  2WCT A;  1Y7E A;  4FD7 A;  1TY8 A;  4FWU A;  1CP6 A;  2ZEF A;  4Y49 C;  4R8F A;  3TT2 A;  4F8Z A;  3WR7 A;  4GXH A;  4R9M A;  1TXR A;  4R6T A;  1N71 A;  3CZX A;  2Q43 A;  4OC3 A;  1SQH A;  1ZG7 A;  2H5M A;  2C6P A;  1DE4 C;  4PSW A;  4A39 A;  5AG4 A;  4KOV A;  1S7K A;  2DPS A;  4XPL A;  1WK4 A;  2V8H A;  4NGT A;  2EUI A;  2OU2 A;  2PJB A;  4QVT A;  4F6A A;  4M6H A;  2F5I A;  1ARL A;  3SI1 A;  5DUS A;  1Q2D A;  1TIQ A;  2VQY A;  5CB3 A;  3OWC A;  4H6U A;  4IUS A;  1XIX A;  5FSX A;  1LFW A;  2BOA A;  2QVP A;  4OID A;  4PV6 A;  5H84 A;  2I3C A;  4CAW A;  1Z8X A;  1PYT B;  2QYV A;  4MI4 A;  1XRY A;  1YME A;  2PC1 A;  4PK3 A;  3L2N A;  4KOS A;  4P4B A;  1TXZ A;  3QB8 A;  4FBE A;  2Q44 A;  1KUV A;  2PDO A;  2DXQ A;  4C68 A;  2ZOF A;  2Q4Y A;  3KR4 A;  3Q6Z A;  3N5F A;  4NEX A;  3SJF A;  3TOA A;  3EKE A;  2ODF A;  4B5P B;  2JLM A;  4KVM E;  5DS0 A;  3NH5 A;  4F9U A;  4NCZ A;  2J8N A;  2NYQ A;  4ZYQ A;  3S6K A;  4IAV A;  4ZX8 A;  1CM0 A;  2PJ6 A;  4PQA A;  5HXD A;  5AG7 A;  4OME A;  2D4P A;  2B4D A;  4ONW A;  3R95 A;  4D86 A;  1ZR5 A;  1VIX A;  5G1Z A;  2RNK A;  1P4N A;  1A2Z A;  2GAN A;  4JD6 A;  4NSQ A;  5CNP A;  3B3T A;  2KQV A;  3SIH A;  2EK9 A;  2R7H A;  2CTB A;  5DWN A;  1YVK A;  3P2H A;  4GS4 A;  4MFK A;  2AFS A;  4NGM A;  3QAH A;  2HB6 A;  4U5Y A;  2ACF A;  4JCA A;  2FIW A;  2DEA A;  2PIY A;  4Q38 A;  2D4O A;  3N7Z A;  4NGS A;  4UCM A;  4UWI A;  4DNC A;  4NGP A;  4EME A;  2CIJ A;  3C26 A;  2G0B A;  3EC4 A;  4ZI6 A;  4KOW A;  1XEB A;  4YFJ A;  4F9V A;  2AFU A;  5HH1 A;  4MHZ A;  2GFQ A;  4II9 A;  3R1K A;  1DTD A;  2XEI A;  4A30 A;  4WJB A;  3SIG A;  2PR8 A;  4CAX A;  3DNS A;  5HIH A;  1FY7 A;  4OC5 A;  4J5Q A;  5IX3 A;  3D2M A;  2ZED A;  4PXB A;  2REF A;  2F8H A;  4B14 A;  3FIX A;  4LQ6 A;  4XPD B;  5F09 A;  1CX8 A;  1HEE A;  2HQY A;  4FUU A;  4J3G A;  4L89 A;  3R9G A;  2P6E A;  3B8G A;  4GVW A;  2ZW4 A;  3R9E A;  3GQE A;  4PXC A;  4C2Z A;  4E2A A;  4QBJ A;  2ZEP A;  1QQ9 A;  2PVV A;  4LUA A;  3F0A A;  1ZLI A;  3BJ7 A;  3GQO A;  2NSM A;  4RUH A;  3NE7 A;  3D7G A;  1VHO A;  2B4D B;  1X12 A;  5HOL A;  2FE7 A;  3IEH A;  4Z65 A;  4MHY A;  2FSR A;  3B3C A;  3FVL A;  4YWY A;  2Z3K A;  3IO1 A;  4UWJ A;  2L8R A;  3PB7 X;  3PB4 X;  4JJX A;  4ZGY B;  3D67 A;  2PJ0 A;  4J5S A;  4ONU A;  2PJ8 A;  3GIU A;  1ARM A;  1IY7 A;  1IYL A;  3K9U A;  4DUK A;  2Y0M A;  1GYT A;  2IJZ A;  2B4B A;  5D29 A;  2AJ6 A;  2B3U A;  3ISX A;  4JXQ A;  2QML A;  4LQG A;  3FEE A;  1B6B A;  4JXR A;  6CPA A;  1HJZ A;  1MJ9 A;  5I0C A;  4TU0 A;  1EE3 P;  4UF4 A;  3VAT A;  3SJG A;  3IC1 A;  2PVW A;  3K9T A;  1S7L A;  3FYN A;  1ON0 A;  3EXN A;  1XMT A;  3KAS A;  2ZW5 A;  4H2K A;  2OZU A;  1HDQ A;  3RZA A;  2WZN A;  3D2P A;  1CPX A;  1TF8 A;  1JWQ A;  2Z3P A;  3VAR A;  4B13 A;  2J8R A;  4KYB A;  3EFA A;  4C7H A;  2DX6 A;  2P0W A;  4P44 A;  4BMH A;  1P0H A;  2EBJ A;  4OAE A;  4P4D A;  2Z3N A;  3EWP A;  3SJX A;  4OC2 A;  1KUX A;  2BO9 A;  3ZZI A;  5JGF A;  4OC4 A;  1XE4 A;  3ETI A;  2CTC A;  2ZEG A;  3G3S A;  4IK2 A;  2KCW A;  1AYE A;  3EW5 A;  3CDX A;  4CAF A;  5THW A;  3FX6 A;  3R96 A;  4LX9 A;  2EK8 A;  1AUG A;  2CXA A;  5LRG A;  3F8K A;  1AMP A;  3SII A;  2EEE A;  2YNE A;  3IU2 A;  3P2F A;  4MXU A;  5F46 A;  4ESS A;  3PRT A;  4PXD A;  4MY3 A;  4JLL A;  1BOB A;  2OZG A;  3FH4 A;  4A31 A;  4OC1 A;  1Y9W A;  4ZBG A;  2LGR A;  1FT7 A;  2GRE A;  1IU8 A;  4P10 A;  4J5R A;  3LWU A;  4KVX A;  2EVN A;  4UIB A;  4NJR A;  5LYD A;  1YD9 A;  4JYW A;  4TNU A;  2Z3M A;  3S6F A;  1I12 A;  4A38 A;  5IB0 A;  2CF4 A;  3FB3 A;  4ZY0 A;  3DSB A;  3E0K A;  4MCP A;  1ZLH A;  3BI0 A;  3JZT A;  3NA6 A;  1S3Z A;  5AIL A;  3FBU A;  3IWW A;  2Z10 A;  2G3A A;  2PE3 A;  3SJE A;  1OZP A;  2Z3L A;  5HVH A;  4EWT A;  1BPN A;  5LRJ A;  2OR4 A;  5I4M A;  1J4J A;  1UWY A;  3PB9 X;  2JBJ A;  5K8P A;  4DYO A;  5LYI A;  2PJ9 A;  2VI7 A;  2Q7S A;  3BI1 A;  1QSO A;  4QUS A;  4UCP A;  3TTH A;  5FSV A;  3RNZ A;  2AE6 A;  2PCU A;  3KQX A;  2VEZ A;  2J9A A;  2XD7 A;  2RFH A;  4HNW B;  4UCN A;  4CGP A;  3D66 A;  1KUY A;  2YNC A;  4HNX B;  3S9L A;  3H8F A;  3IWE A;  5CPA A;  3TO6 A;  3JVN A;  2PSW A;  3B2Y A;  4ZY1 A;  2DF5 A;  4XNH B;  2WPX A;  2GIV A;  4MFZ A;  3MN8 A;  1TKF A;  2OH1 A;  4KSF A;  4FD6 A;  4I49 A;  4K30 A;  4PPZ A;  3SI2 A;  4IHM A;  1IYK A;  3LD2 A;  3QAY A;  2AFZ A;  5DWM A;  3TO7 A;  3PFO A;  4K0C A;  1ELL P;  2V77 A;  2ANP A;  1M4D A;  3PBE A;  2Z0Z A;  1S60 A;  2VRI A;  2V8D A;  2FAV A;  4A37 A;  5IB9 A;  4AG7 A;  3KI9 A;  2WYR A;  4R3L A;  3H8E A;  1QSM A;  2FL4 A;  3GLJ A;  2IL4 A;  4C7I A;  4E0A A;  4B12 A;  5J1Q A;  4KSA A;  3G8W A;  1BPM A;  4CS0 B;  4P4E A;  3I1U A;  3V7Z A;  2F7V A;  4MCQ A;  1ZR3 A;  4NGN A;  3PEI A;  3KHZ A;  3WC5 A;  1SPV A;  4J4Z A;  1R3N A;  4G1P A;  2ZW6 A;  3B7I A;  5ELY A;  2AFC A;  1LAP A;  3DGV A;  4CAV A;  4CPA A;  4BBH A;  2CNS A;  2O28 A;  3CPX A;  3V45 A;  1VHS A;  2O53 A;  4M3S A;  1XBU A;  4MY0 A;  4UEZ A;  1IOF A;  1Q2C A;  2JEW A;  2X7B A;  2FXF A;  2Q4Z A;  2REE A;  2VXK A;  1LOK A;  3H4Q A;  4KZT A;  4B10 A;  4Q7A A;  2PJA A;  3B3S A;  4P45 A;  5EMI A;  5KTA A;  1CP7 A;  4A95 A;  1ZO0 A;  1NE9 A;  1Z4E A;  2B3V A;  2FT0 A;  2IMO A;  1LAM A;  3IIB A;  3NE8 A;  2NMT A;  4KUB A;  4UFX A;  1V0C A;  3KZW A;  2JEV A;  3RBU A;  4CGM A;  2K5T A;  2HV2 A;  4WWV A;  1MK4 A;  4NJQ A;  4EVY A;  5JM6 A;  4K3N A;  1XMB A;  2P6G A;  2R8V A;  2CNT A;  2PRQ A;  4JGK A;  2GLJ A;  1VHE A;  3EY5 A;  4KS9 A;  3B3W A;  1BAV A;  4KOX A;  1QSN A;  4RN7 A;  2PJ3 A;  2ATR A;  2PJ4 A;  2JZD A;  2ZEO A;  4M6G A;  4M85 A;  1Q2Y A;  4MFJ A;  4RS2 A;  3RYO A;  4A32 A;  3S9N A;  5ISV A;  2P6F A;  4X3R A;  5G20 A;  5F47 A;  3VH9 A;  2B5G A;  3FEC A;  4OP4 A;  2CY2 A;  3D68 A;  2ZEN A;  5J8C A;  1M4L A;  1IID A;  5K8M A;  1YQE A;  2OZH A;  3GUX A;  2ZEL A;  4R76 A;  2ZW7 A;  1KWM A;  4NFR A;  4XNH C;  3W91 A;  3NH4 A;  4UA3 A;  2X47 A;  3CXP A;  4CYP A;  4H6Z A;  1VKC A;  2Q04 A;  4KOU A;  1NSA A;  1YRE A;  2C1C A;  4P4F A;  4ETK A;  3IFE A;  3PGP A;  2BEI A;  4KSI A;  2QJ8 A;  5CBM A;  2C6C A;  2FVG A;  5LYF A;  1FNO A;  2ZOG A;  4OKO A;  1NJR A;  4F0Y A;  3HUV A;  3I9S A;  1Z2L A;  2AFW A;  4E8O A;  2EO8 A;  3JRU A;  2Z3O A;  4QB9 A;  5J8F A;  3S6G A;  2PIZ A;  2Q51 A;  3GB0 A;  1M1D A;  4UML A;  3DDD A;  4A94 A;  1MJB A;  2GLF A;  1YLO A;  3TC8 A;  2BSW A;  4R57 A;  4CAE A;  1XF8 A;  2PJ5 A;  4OAD A;  5G21 A;  3A9L A;  3PBB A;  1LRZ A;  1TKH A;  1UFH A;  5E96 A;  5IV0 A;  2XEF A;  5JQ4 A;  4O23 A;  2FS5 A;  1Y0R A;  2BL1 A;  3H5Z A;  3B35 A;  3TCV A;  3TOB A;  2I00 A;  1ZG8 A;  2ZEH A;  3FMC A;  1HDU A;  3DR8 A;  2GE3 A;  2BFR A;  1QSR A;  2PRB A;  1GHE A;  3PP9 A;  3DR6 A;  3KGQ A;  1BO4 A;  2VL1 A;  3SHP A;  4MHP A;  4FD5 A;  3GPO A;  1OBR A;  3KHX A;  3JUW A;  1Z5R A;  1XFO A;  2OOT A;  1F2O A;  3V8I A;  5HMN A;  2R1I A;  2VZY A;  3SI0 A;  1YVO A;  4KLV A;  3I3G A;  1Z8T A;  4CYQ A;  4UFV A;  5CMS A;  5A28 A;  3VFQ A;  1CG2 A;  1MJA A;  3EWO A;  1TKJ A;  5K8O A;  3KQZ A;  1R57 A;  2R98 A;  3RAM A;  1B87 A;  1M4I A;  1NMT A;  4KLW A;  5G22 A;  4A2Z A;  4NGR A;  5EC4 A;  4F0X A;  5LRK A;  4R87 A;  2PJ7 A;  1CBX A;  2PJC A;  3LMS A;  4U9Y A;  4MHD A;  5JH9 A;  3KR5 A;  3CPA A;  4ZY2 A;  3KL9 A;  2ZEM A;  4NXY A;  4X5K A;  4JZ0 A;  4R7M A;  2VBQ A;  4CGO A;  4YRH A;  3FRM A;  2BCO A;  4B11 A;  2JZF A;  4AVB A;  3QNV A;  1K4J A;  4MCS A;  4B5P A;  2AFO A;  2B5G B;  1LAN A;  3T9Y A;  4GUA A;  4MJ8 A;  2XEJ A;  3D7D A;  4JLY A;  4HPS A;  5F49 A;  1PUA A;  2J8M A;  4AVA A;  5KTD A;  4MFL A;  2RC4 A;  5GCN A;  4BD9 A;  1ZG9 A;  4EFD A;  4KUA A;  2ABZ A;  2FXK A;  3RO0 A;  1ELM P;  1Y7R A;  2PJ1 A;  2XEG A;  4ETJ A;  4IF5 A;  4PSX A;  1TF9 A;  5C82 A;  3GY9 A;  4DJL A;  2AFX A;  4P4I A;  3FXT A;  3EWQ A;  1M4G A;  2WUU A;  3TX8 A;  3UY5 A;  1CPS A;  1YK3 A;  3IWG A;  3WC6 A;  4R3K A;  3LAC A;  4ABL A;  4MFQ A;  4ZX9 A;  1M44 A;  3V38 A;  4PXE A;  4P6Y A;  1XJO A;  4MCR A;  1XOV A;  3ISZ A;  3KKW A;  1CJW A;  5AG6 A;  3NH8 A;  3WAB A;  3F5B A;  5K8N A;  1H8L A;  3V2B A;  2BUE A;  3MRU A;  1YW4 A;  3FNC A;  2RB7 A;  3CXQ A;  4BIN A;  1RTQ A;  4HKF A;  1VHU A;  4B6Z A;  3BLN A;  3IGR A;  4OC0 A;  4ORF A;  3R9F A;  4OLL A;  3SXO A;  4X2T A;  4CRY B;  4X8I A;  2Q7B A; 
#chains in the Genus database with same CATH homology
 2AFM A;  3D7F A;  4JVV A;  3T8W A;  5D8N A;  8CPA A;  3WC7 A;  2FG1 A;  3GPQ A;  3BXM A;  3FF3 A;  3EWR A;  3IIF A;  3D4U A;  1LCP A;  2POK A;  2V8G A;  2BFQ A;  3IJ3 A;  5LYL A;  3S9M A;  5HVG A;  5CB5 A;  1IGB A;  2HC9 A;  3Q71 A;  5E3B A;  4UEE A;  5HVF A;  3PFE A;  1Q7L A;  2G9D A;  1PCA A;  3SIJ A;  5FSU A;  4UIA A;  1YW6 A;  4YU9 A;  1QMU A;  2ZEE A;  3WT4 A;  3EJG A;  4GVV A;  3CT9 A;  1BLL E;  2JBK A;  2V8V A;  3PB8 X;  3GPG A;  3D7H A;  1VGY A;  3B3V A;  4W9Y A;  2EWB A;  1JQG A;  5FSY A;  2GU2 A;  1F2P A;  4UEF A;  4MHN A;  4MRI A;  4MMO A;  4NGQ A;  3NFZ A;  3PB6 X;  4TWE A;  5FSZ A;  1F57 A;  7CPA A;  3FED A;  3BHX A;  1YSJ A;  2O4H A;  4OIW A;  3H8G A;  1Y0Y A;  3HLP A;  2C6G A;  3K2K A;  4ABK A;  4IQY A;  1R43 A;  1Z8L A;  4FAI A;  4GM5 A;  4P4J A;  2PJ2 A;  3EJF A;  3IID A;  2IQ6 A;  3FJU A;  3DLJ A;  1Y7E A;  4FWU A;  1TY8 A;  1CP6 A;  2ZEF A;  4R8F A;  4F8Z A;  1TXR A;  4R6T A;  2Q43 A;  4OC3 A;  1ZG7 A;  2C6P A;  1DE4 C;  4A39 A;  4NGT A;  2V8H A;  2PJB A;  1ARL A;  3SI1 A;  5DUS A;  5CB3 A;  4OID A;  5FSX A;  1LFW A;  2BOA A;  2QVP A;  2I3C A;  3SJG A;  2QYV A;  1PYT B;  4P4B A;  1XRY A;  1YME A;  4A37 A;  4FBE A;  3L2N A;  1TXZ A;  2ZOF A;  3KR4 A;  3Q6Z A;  3N5F A;  3SJF A;  3EKE A;  5DS0 A;  3NH5 A;  4F9U A;  2NYQ A;  4ZYQ A;  4IAV A;  4ZX8 A;  2PJ6 A;  4PQA A;  5HXD A;  4OME A;  4ONW A;  4D86 A;  1ZR5 A;  1VIX A;  3B3T A;  3SIH A;  2EK9 A;  2CTB A;  4NGM A;  2AFS A;  2HB6 A;  2ACF A;  4JCA A;  2DEA A;  2PIY A;  4NGS A;  4NGP A;  4EME A;  2CIJ A;  4ZI6 A;  4F9V A;  2AFU A;  4MHZ A;  1DTD A;  2XEI A;  4WJB A;  3SIG A;  5HIH A;  4OC5 A;  4J5Q A;  2ZED A;  4PXB A;  2F8H A;  5F09 A;  1CX8 A;  1HEE A;  4FUU A;  4GVW A;  3GQE A;  4PXC A;  2ZEP A;  1QQ9 A;  2PVV A;  1ZLI A;  3GQO A;  2NSM A;  4RUH A;  3D7G A;  1VHO A;  5HOL A;  4Z65 A;  3IEH A;  4MHY A;  3B3C A;  3FVL A;  4YWY A;  3IO1 A;  2L8R A;  3PB7 X;  3PB4 X;  3D67 A;  2PJ0 A;  4J5S A;  2PJ8 A;  1ARM A;  1IY7 A;  4DUK A;  1GYT A;  2IJZ A;  5D29 A;  3ISX A;  4LQG A;  3FEE A;  6CPA A;  1HJZ A;  4TU0 A;  1EE3 P;  4UF4 A;  3VAT A;  3IC1 A;  2PVW A;  3K9T A;  3KAS A;  4H2K A;  1HDQ A;  3RZA A;  2WZN A;  1CPX A;  1TF8 A;  3VAR A;  4KYB A;  2DX6 A;  4P44 A;  4P4D A;  3EWP A;  3SJX A;  4OC2 A;  2BO9 A;  5JGF A;  4OC4 A;  3ETI A;  2CTC A;  2ZEG A;  4IK2 A;  1AYE A;  3EW5 A;  3CDX A;  5THW A;  3FX6 A;  2EK8 A;  5LRG A;  1AMP A;  3SII A;  2EEE A;  4MXU A;  4ESS A;  3PRT A;  4PXD A;  4JLL A;  3FH4 A;  4OC1 A;  2LGR A;  1FT7 A;  2GRE A;  4P10 A;  4J5R A;  3LWU A;  4UIB A;  4NJR A;  5LYD A;  1YD9 A;  4JYW A;  4TNU A;  4A38 A;  2CF4 A;  4ZY0 A;  4MCP A;  1ZLH A;  3BI0 A;  3JZT A;  3NA6 A;  5AIL A;  3IWW A;  2PE3 A;  3SJE A;  5HVH A;  4EWT A;  1BPN A;  5LRJ A;  2OR4 A;  5I4M A;  1UWY A;  3PB9 X;  2JBJ A;  5K8P A;  4DYO A;  5LYI A;  2PJ9 A;  3BI1 A;  5FSV A;  2PCU A;  3KQX A;  2J9A A;  2XD7 A;  2RFH A;  3S9L A;  3D66 A;  3H8F A;  5CPA A;  3B2Y A;  4ZY1 A;  3MN8 A;  1TKF A;  4PPZ A;  3SI2 A;  4IHM A;  2AFZ A;  3PFO A;  4K0C A;  1ELL P;  2V77 A;  2ANP A;  3PBE A;  2VRI A;  2V8D A;  2FAV A;  5IB9 A;  3KI9 A;  2WYR A;  3H8E A;  3GLJ A;  5J1Q A;  1BPM A;  4P4E A;  3I1U A;  3V7Z A;  2F7V A;  4MCQ A;  1ZR3 A;  4NGN A;  3PEI A;  3KHZ A;  3WC5 A;  1SPV A;  4J4Z A;  1R3N A;  4G1P A;  3B7I A;  5ELY A;  2AFC A;  1LAP A;  3DGV A;  4CPA A;  3CPX A;  3V45 A;  2O53 A;  1XBU A;  4UEZ A;  2JEW A;  2Q4Z A;  1LOK A;  4Q7A A;  2PJA A;  3B3S A;  4P45 A;  1CP7 A;  3IIB A;  2IMO A;  1LAM A;  3KZW A;  3RBU A;  4WWV A;  4NJQ A;  5JM6 A;  4K3N A;  1XMB A;  2PRQ A;  4JGK A;  2GLJ A;  1VHE A;  3B3W A;  1BAV A;  2PJ3 A;  2PJ4 A;  2ZEO A;  3S9N A;  4X3R A;  3VH9 A;  3FEC A;  4OP4 A;  3D68 A;  2ZEN A;  1M4L A;  5K8M A;  3GUX A;  2ZEL A;  4R76 A;  1KWM A;  4NFR A;  3NH4 A;  2X47 A;  1NSA A;  2C1C A;  4P4F A;  4ETK A;  3IFE A;  4KSI A;  2QJ8 A;  5CBM A;  2C6C A;  2FVG A;  5LYF A;  1FNO A;  2ZOG A;  4OKO A;  1NJR A;  3HUV A;  1Z2L A;  2AFW A;  3JRU A;  2PIZ A;  2Q51 A;  3GB0 A;  4UML A;  4A94 A;  2GLF A;  1YLO A;  3TC8 A;  2PJ5 A;  3PBB A;  1TKH A;  2XEF A;  4O23 A;  1Y0R A;  3B35 A;  1ZG8 A;  2ZEH A;  3FMC A;  1HDU A;  2BFR A;  3KGQ A;  2VL1 A;  4MHP A;  3GPO A;  1OBR A;  3KHX A;  1Z5R A;  1XFO A;  2OOT A;  1F2O A;  3SI0 A;  5CMS A;  3VFQ A;  1CG2 A;  1TKJ A;  3EWO A;  5K8O A;  3KQZ A;  3RAM A;  5LRK A;  4NGR A;  2PJ7 A;  1CBX A;  2PJC A;  3LMS A;  5JH9 A;  3KR5 A;  3CPA A;  4ZY2 A;  3KL9 A;  2ZEM A;  4JZ0 A;  4R7M A;  2BCO A;  3QNV A;  4MCS A;  2AFO A;  1LAN A;  4GUA A;  2XEJ A;  3D7D A;  4EFD A;  4BD9 A;  1ZG9 A;  2ABZ A;  2FXK A;  1ELM P;  2PJ1 A;  2XEG A;  4ETJ A;  1TF9 A;  4DJL A;  2AFX A;  4P4I A;  3EWQ A;  3TX8 A;  1CPS A;  3WC6 A;  4ABL A;  4ZX9 A;  3V38 A;  4AXV A;  4PXE A;  4P6Y A;  1XJO A;  4MCR A;  3ISZ A;  3WAB A;  5K8N A;  3NH8 A;  1H8L A;  3V2B A;  3MRU A;  1YW4 A;  2RB7 A;  1RTQ A;  1VHU A;  4B6Z A;  4OC0 A;  4X2T A;  4X8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...