4K3NA

Phosphonic arginine mimetics as inhibitors of the m17 aminopeptidases from plasmodium falciparum
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Synthesis and Structure-Activity Relationships of Phosphonic Arginine Mimetics as Inhibitors of the M1 and M17 Aminopeptidases from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
total genus 179
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4k3nA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4k3nA02
1BPNA 4K3NA 2ZENA 2AFUA 2Q4ZA 1R3NA 2AFWA 3RZAA 3WC7A 3L2NA 3KGQA 4FUUA 3KL9A 1CPSA 1TXRA 4RUHA 3CPXA 3IEHA 3PB8X 1ELLP 2CIJA 5CBMA 2IMOA 5HIHA 3NH8A 3I1UA 4ZX8A 2GREA 3D7FA 3EKEA 3SI0A 5E3BA 4YWYA 3D7DA 2EK9A 5K8OA 3HLPA 2ZEEA 3D67A 3WABA 2FVGA 3IC1A 4P10A 4JGKA 3FMCA 2C1CA 1VHEA 4KYBA 4OC0A 2PJ4A 2AFZA 3B3VA 4IHMA 4P4BA 1CP6A 6CPAA 4OIWA 4CPAA 1TF9A 4YU9A 1H8LA 1VGYA 5D8NA 1LAMA 5AILA 1DE4C 3B3WA 3PB6X 4OMEA 4OC2A 1BLLE 2ZEMA 3EWPA 4P44A 1YW6A 3SI1A 3TC8A 4A94A 4ZY2A 4O23A 4W9YA 3CDXA 3GUXA 1HDQA 3PBEA 4PXEA 3V7ZA 3ETIA 4P45A 2PVWA 3GQEA 2BO9A 4DUKA 2C6GA 2JBJA 4J4ZA 1LAPA 3PFOA 4Q7AA 3D7GA 5ELYA 3GB0A 4ESSA 1ZLHA 4P4IA 4ZX9A 3KQXA 3NFZA 4MCSA 4MHPA 4JZ0A 3Q71A 2ZEGA 3PB7X 4OC3A 3SIGA 1IGBA 2Q51A 2ABZA 3FH4A 1CBXA 1HDUA 2AFOA 4P4JA 1HEEA 1TF8A 4FBEA 3S9LA 4MCPA 5HVFA 2O4HA 2CTCA 2PJ9A 2PJBA 2F7VA 4JYWA 4D86A 1TKFA 4DJLA 1FT7A 1DTDA 3PBBA 4A39A 3GLJA 4OP4A 4UIAA 2WZNA 3B7IA 3FEEA 3FEDA 5HVHA 4F9UA 3H8EA 3KR5A 2L8RA 2VL1A 5J1QA 2ZEOA 3EJGA 1VHUA 1YSJA 4OC4A 3S9NA 4PXCA 2FXKA 3B3SA 2HB6A 5JGFA 3FX6A 2BFRA 2PJ5A 4Z65A 3ISXA 4P4DA 2VRIA 3JZTA 3SJGA 1XJOA 4MMOA 2NYQA 2XEFA 3MRUA 3QNVA 4UEZA 2PJ3A 4EMEA 1YLOA 4A37A 3SJEA 5THWA 4NGSA 3V38A 2PJAA 3BHXA 1Z2LA 2FAVA 3FF3A 4PXDA 4R8FA 4DYOA 1LFWA 3PEIA 1CPXA 3CPAA 3BI0A 3IWWA 2EK8A 5DS0A 2XD7A 2PJ0A 4NFRA 3KI9A 2OR4A 3IO1A 1XRYA 8CPAA 1BPMA 2ZELA 2DEAA 2IQ6A 3NA6A 4NGNA 3WC6A 4UIBA 1NSAA 3H8FA 3HUVA 4ZY0A 1ZG9A 4UEFA 2V8VA 3LMSA 2EEEA 5CMSA 2ACFA 2AFCA 1F2OA 4B6ZA 3N5FA 5LRJA 3B2YA 3BI1A 2V8DA 1XMBA 1AYEA 4A38A 4MRIA 2PVVA 1XFOA 3Q6ZA 2EWBA 4NJQA 3EJFA 3DGVA 3FJUA 3IFEA 4LQGA 3V45A 3VARA 2ZOFA 3V2BA 2PIYA 2AFMA 3NH4A 5F09A 5K8MA 4OIDA 2Q43A 4P4FA 5K8PA 2AFXA 4OKOA 4P4EA 4J5QA 4ONWA 4OC5A 5LYIA 5JH9A 4IK2A 4P6YA 4X3RA 3EWRA 2PJCA 4WWVA 3KQZA 1IY7A 2CF4A 1LOKA 4MHZA 4MCRA 3EWQA 4BD9A 3S9MA 2J9AA 4MCQA 5LRGA 2XEJA 1TXZA 2JEWA 1JQGA 3PB9X 5HOLA 1HJZA 3EW5A 3RBUA 1Y0YA 5FSYA 5LYDA 2BFQA 4X2TA 2C6CA 4UEEA 2PRQA 4NJRA 1LANA 4NGRA 3GQOA 2IJZA 3GPQA 2V77A 4G1PA 2PJ6A 5FSZA 5I4MA 1FNOA 4PXBA 3SJFA 3TX8A 1ZG7A 4F8ZA 2NSMA 1LCPA 2ZOGA 3B3TA 4K0CA 4JLLA 3SIHA 5CB5A 2GLFA 3WT4A 1UWYA 2PJ1A 1BAVA 1EE3P 3FECA 4TWEA 2PJ7A 2ZEDA 4ZI6A 4EFDA 1PYTB 3K9TA 1KWMA 3PRTA 3VH9A 2QYVA 3CT9A 3IJ3A 4NGPA 1ZG8A 3K2KA 4IAVA 4ABLA 4KSIA 4MHNA 1SPVA 3IIFA 7CPAA 3KR4A 3KZWA 2V8HA 3IIDA 2I3CA 3SI2A 3IIBA 1ZR3A 3SIJA 2ZEFA 5D29A 4GVVA 4TNUA 4R7MA 4ZYQA 4ETJA 4FWUA 2GLJA 1F57A 2DX6A 2AFSA 2ANPA 2PE3A 1QMUA 4GUAA 4AXVA 2RB7A 3D68A 2XEIA 2RFHA 1ELMP 1PCAA 1YW4A 3H8GA 5HVGA 1NJRA 1R43A 2C6PA 5FSVA 1CX8A 5JM6A 1Q7LA 2LGRA 3LWUA 1TY8A 1TKJA 4NGTA 4JVVA 1OBRA 1F2PA 4ETKA 5FSUA 1Y7EA 3PFEA 2QJ8A 1CG2A 3MN8A 4MHYA 3B3CA 1ARLA 2G9DA 2PIZA 2X47A 4X8IA 2BOAA 3GPOA 3VATA 3KHZA 3NH5A 2OOTA 4GVWA 3T8WA 3ISZA 3RAMA 2POKA 3KHXA 4UF4A 1YMEA 5HXDA 4NGQA 2JBKA 4OC1A 5CPAA 1M4LA 5FSXA 3VFQA 1ZLIA 4H2KA 2PJ2A 1VHOA 1Y0RA 5CB3A 1GYTA 1VIXA 3B35A 4R6TA 3DLJA 3PB4X 1ARMA 2BCOA 4J5RA 4F9VA 5K8NA 4J5SA 4ABKA 2PCUA 3SIIA 2ZEHA 4NGMA 3D66A 4TU0A 3WC5A 4R76A 5LYFA 3FVLA 1TKHA 1YD9A 2F8HA 4WJBA 4IQYA 2CTBA 5LRKA 2V8GA 3GPGA 1XBUA 2HC9A 2WYRA 3D4UA 4UMLA 5DUSA 2QVPA 2O53A 4EWTA 2FG1A 1Z8LA 2ZEPA 1CP7A 2XEGA 5IB9A 1ZR5A 4FAIA 3JRUA 3EWOA 4GM5A 3BXMA 2GU2A 5LYLA 4MXUA 2PJ8A 4JCAA 4PPZA 3SJXA 4PQAA 1QQ9A 3D7HA 4ZY1A 1AMPA 3KASA 1Z5RA 1RTQA
chains in the Genus database with same CATH superfamily
1BPNA 4K3NA 2ZENA 2AFUA 2Q4ZA 4DNCA 1R3NA 2AFWA 2Q4YA 3RZAA 4OLLA 3WC7A 3L2NA 2YNEA 3BLNA 5DWNA 3KGQA 4RS2A 1YGHA 1YREA 5E96A 4R9MA 3FIXA 2JEVA 5J8FA 4FUUA 2ZXVA 2DXQA 3KL9A 1CPSA 4CYOA 1IIDA 1TXRA 2DF5A 3CPXA 2GANA 4RUHA 4R3LA 5IB0A 4AG9A 2J8NA 3IEHA 2WPXA 3D8PA 2G3AA 4Y49B 2PSWA 4R3KA 3DNSA 2D4OA 2FT0A 4KOSA 3PB8X 1ELLP 2CIJA 1XEBA 4E0AA 5CBMA 2IMOA 3F5BA 4UFVA 2GE3A 5HIHA 3IWGA 2JZFA 1YR0A 4ZX8A 2GREA 3D7FA 1Y9WA 3EKEA 2B3UA 3I1UA 3SI0A 4BMHA 1S7KA 3P2FA 1RXTA 5AG6A 5E3BA 1NSLA 1QSOA 4UFXA 4YWYA 3D7DA 2EK9A 4B14A 3HLPA 2O28A 2ZEEA 3D67A 5K8OA 4NF1A 1Z8XA 2FVGA 4IF5A 3WABA 3IC1A 3TCVA 4P10A 5F48A 5HH1A 4JGKA 2BL1A 2ARHA 2BSWA 1Z8TA 3IWEA 2RNKA 1KUXA 3FMCA 4OADA 2C1CA 4MJ8A 3R9FA 3RO0A 4EVYA 4H6UA 3QB8A 1TIQA 4UBRA 1P4NA 1VHEA 3TOBA 4KYBA 4M3SA 1RO5A 4OC0A 2PJ4A 1QSNA 2AFZA 2Y0MA 3B3VA 4UWJA 4IHMA 4P4BA 2B58A 1CP6A 6CPAA 3PP9A 2PC1A 4OIWA 4CPAA 4KOTA 1TF9A 1MJBA 4YU9A 1H8LA 3UY5A 1VGYA 2AJ6A 5D8NA 1LAMA 5AILA 3EFAA 1DE4C 4QUSA 5J8CA 4PK2A 3B3WA 3PB6X 2EO8A 4OC2A 4OMEA 1BLLE 2ZEMA 1R57A 2DPTA 3EWPA 3K9UA 4P44A 1YW6A 2JZDA 2P0WA 3JVNA 3SI1A 3TC8A 4A94A 4ZY2A 4O23A 3FB3A 4W9YA 3CDXA 3GUXA 1HDQA 3CXPA 4MFZA 4R87A 4A33A 4AG7A 4U9YA 2PR1A 4C7IA 1MJ9A 3PBEA 4PXEA 3V7ZA 3ETIA 3CZXA 4B13A 4P45A 3GQEA 2PVWA 1YVKA 2BO9A 2R98A 4KOXA 4DUKA 3TO9A 2C6GA 1IICA 2CNSA 3EXNA 3TOAA 2JBJA 4J4ZA 1LAPA 1Z8WA 3PFOA 4Q7AA 4LUAA 4XNHC 3D7GA 5ELYA 3GB0A 4ESSA 4CGPA 1ZLHA 4CAWA 3TT2A 1AUGA 4P4IA 5AG5A 4ZX9A 3KQXA 3NFZA 4MCSA 5ISVA 4MHPA 4JZ0A 1YVOA 3NE8A 3Q71A 2VI7A 3E0KA 2ZEGA 3PB7X 4OC3A 3SIGA 1J4JA 2FE7A 5F49A 3FXTA 1IGBA 2Q51A 2ABZA 4CAXA 3FH4A 2PRBA 4HNYB 3TO6A 2JDDA 2AE6A 1CBXA 1M4DA 1WK4A 4F6AA 1HDUA 2OU2A 2AFOA 2Q7SA 4P4JA 1HEEA 1TF8A 4FBEA 2EUIA 4A95A 3S9LA 4MCPA 4A2ZA 5HVFA 2O4HA 1YK3A 2CTCA 2PJ9A 2PJBA 2CXAA 2F7VA 4JYWA 4RN7A 4D86A 1TKFA 4DJLA 4HKFA 3TTHA 1FT7A 1DTDA 3PBBA 4A39A 3GLJA 4OP4A 5AG7A 4C2XA 4UIAA 2WZNA 2EBJA 4AVCA 3B7IA 3FEEA 4JWPA 3FEDA 5HVHA 1P0HA 4NSQA 4F9UA 1ON0A 5AGEA 3SHPA 2F5IA 2RC4A 3IU2A 3H8EA 3KR5A 2L8RA 2VL1A 2VZYA 3LACA 1QSTA 5J1QA 2ZEOA 3DSBA 3EJGA 3NH8A 1VHUA 1YSJA 4OC4A 1S3ZA 3S9NA 2ZW4A 4PXCA 3T9YA 2FXKA 2Z10A 4UA3A 5JPHA 3B3SA 4C68A 2R7HA 2HB6A 5JGFA 3FX6A 2BFRA 4M6IA 2PJ5A 4Z65A 3ISXA 4P4DA 2VRIA 3JZTA 3SJGA 1XJOA 3W6XA 4FD4A 4MMOA 2NYQA 4K30A 2XEFA 4QBJA 3MRUA 3N7ZA 3QNVA 1V0CA 4J3GA 2B5GB 4UEZA 2PJ3A 3EO4A 4YGOA 1YLOA 4A37A 4EMEA 3SJEA 2ZW5A 3ZZIA 5C82A 5THWA 3V8IA 4CYPA 2Z11A 4NGSA 3V38A 2BEIA 2PJAA 3BHXA 2Z3OA 3QAYA 1Z2LA 2FAVA 2H5MA 3FF3A 4PXDA 4L8AA 4R8FA 4DYOA 2DPSA 1LFWA 3ZJ0A 3PEIA 4CRYB 4MBUA 1CPXA 4QB9A 3CPAA 4BINA 4KOVA 3BI0A 3IWWA 2EK8A 2FS5A 1BOBA 3GYAA 5DS0A 2XD7A 4IUSA 2PJ0A 4NFRA 2JZEA 2OR4A 3KI9A 1IOFA 1IYKA 2HV2A 3IO1A 4KZTA 1XRYA 4KSAA 1XIXA 3RYOA 4JXRA 3TO7A 4CGOA 8CPAA 1BPMA 2B5GA 2ZELA 2DEAA 2IQ6A 3NA6A 4NGNA 1N71A 4HNXB 1Q2CA 4M85A 3WC6A 3JUWA 4UIBA 1NSAA 5EC4A 4B12A 4AB7A 2QMLA 3H8FA 3HUVA 2I79A 5DWMA 4ZY0A 3R96A 4QC6A 4FD5A 4E8OA 1ZG9A 5AG4A 1GHEA 2R8VA 2V8VA 4UEFA 3LMSA 2EEEA 5CMSA 2ACFA 2AFCA 1F2OA 4QVTA 4UWIA 3W91A 4B5PA 4B6ZA 3N5FA 4KUBA 5LRJA 3B2YA 4XPDC 3H5ZA 4B5OA 3BI1A 2V8DA 4JD6A 2QIRA 4UCNA 1XMBA 1AYEA 3T90A 4A38A 4MRIA 2PVVA 1LRZA 1XFOA 5G22A 2Q0YA 4YRHA 1M44A 3LODA 3Q6ZA 2EWBA 2VZZA 4NJQA 5G1ZA 1QSRA 3EJFA 3DGVA 3FJUA 3IFEA 4LQGA 3V45A 2Z3LA 3VARA 3V2BA 2ZOFA 4CAFA 1I12A 1B6BA 2PIYA 2AFMA 3NH4A 4B10A 5F09A 3P2HA 5K8MA 4OIDA 1A2ZA 1Y9KA 2Q43A 4C2ZA 1I21A 4P4FA 4L89A 3SXOA 5K8PA 1CJWA 2AFXA 2Q04A 3JTKA 4OKOA 1YX0A 4P4EA 4J5QA 4ONWA 3A9LA 3FYNA 2ATRA 4OC5A 4Q36A 5LYIA 5JH9A 4IK2A 4P6YA 4X3RA 3R9EA 3EWRA 2PJCA 4WWVA 3S6KA 2NMTA 3KQZA 3F8KA 4PSXA 4XPKA 1IY7A 2CF4A 2G0BA 1LOKA 4KVXA 4MHZA 2WPWA 2D4PA 4MCRA 3EWQA 1KUYA 3W6SA 4BD9A 3S9MA 2J9AA 2VEZA 1WWZA 4H89A 4LQ6A 4MCQA 5I0CA 1X12A 2XEJA 5LRGA 3F0AA 1TXZA 1Z9UA 2P6EA 1XMTA 3TE4A 2JEWA 1JQGA 3PB9X 5HOLA 1HJZA 4BBHA 2Z3MA 3EW5A 1K4JA 2FL4A 4E2AA 2FIAA 4H6ZA 3RBUA 4II9A 2C27A 1Y0YA 5FSYA 5EMIA 4NEXA 5LYDA 2BFQA 1PU9A 3BJ8A 4X2TA 2R1IA 4KVME 2KQVA 4KVOE 2C6CA 5BWAB 4JLYA 4UEEA 2PRQA 2Q7BA 1ZO0A 4NJRA 1LANA 4NGRA 3GQOA 4F0XA 3EC4A 2IJZA 2J8RA 2PQ8A 1XOVA 3FNCA 3GPQA 2V77A 3C26A 4CGLA 4KLWA 5F46A 4CYNA 1X10A 3VWDA 2Z3PA 4G1PA 2P6FA 2VBQA 2YNCC 4LX9A 2PJ6A 2PR8A 4CYQA 4Y49C 5KTDA 2OH1A 1I1DA 5FSZA 1L0CA 1FNOA 4PXBA 5I4MA 3PZJA 3SJFA 4MFJA 1ZG7A 4M6GA 2OZGA 3TX8A 3B8GA 4F8ZA 4XNHB 2NSMA 5IV0A 1U6MA 3DDDA 1LCPA 2REEA 2B4DB 2K5TA 2ZOGA 3B3TA 4K0CA 4JLLA 3SIHA 5CB5A 2GLFA 3GKRA 3WT4A 1UWYA 2PJ1A 3SXNA 4JJXA 1BAVA 1EE3P 2IL4A 4C2YA 3FECA 1M4GA 2PJ7A 3IU1A 4MY0A 4ORFA 4TWEA 3S6HA 4KORA 4B11A 4CRZB 4A30A 3S6GA 2ZEDA 4ZI6A 3G3SA 4EFDA 1PYTB 3K9TA 2Z3NA 1KWMA 4NXYA 3I3GA 2J8MA 2P6GA 3R1KA 3PRTA 3VH9A 3GY9A 3VWEA 5KTCA 1Z4EA 2QYVA 3CT9A 3IJ3A 1OZPA 4HPSA 4NGPA 4PV6A 2GFQA 5HMNA 1XF8A 1ZG8A 1IOIA 1S7FA 2B4DA 3K2KA 4IAVA 3PGPA 4ABLA 4KSIA 3D2MA 4MHNA 1SPVA 1NMTA 1B87A 2ZW6A 3DR8A 3IIFA 4Q38A 4CAVA 7CPAA 5IX3A 3KR4A 1Q2DA 3KZWA 2V8HA 4B5PB 1Z4RA 4PSWA 3IIDA 2I3CA 1KUVA 2G3TA 4UCPA 4KSFA 5CNPA 3SI2A 4KOWA 3IIBA 4FD7A 1ZR3A 3SIJA 3D2PA 2ZEFA 5D29A 4MHDA 5FVJA 3R95A 4GVVA 3LD2A 4TNUA 4MFQA 4R7MA 4ZYQA 4ETJA 4YFJA 2WUUA 4XPLA 4FWUA 1IYLA 5GCNA 4M6HA 1M1DA 2GLJA 1F57A 4GS4A 4MFLA 2OZHA 2DX6A 2AFSA 2ANPA 2PE3A 3GIUA 4AVBA 3FRMA 1QMUA 3DR6A 2WCTA 4KOYA 4GUAA 4AXVA 2RB7A 4KLVA 1S7LA 3D68A 2XEIA 3IGRA 4KOUA 1QSMA 2RFHA 1ELMP 3OWCA 1PCAA 4CGMA 1YW4A 4A32A 2Z0ZA 3H8GA 4U5YA 5HVGA 2CNMA 2REFA 1NJRA 1S5KA 2YNDA 2YNCA 3QAHA 4OAEA 2BUEA 5A28A 2GIVA 1R43A 5H86A 1BO4A 5FSVA 1CX8A 2C6PA 1M4IA 1Q7LA 2LGRA 2OB0A 5JM6A 3FBUA 1TY8A 1TKJA 3LWUA 4NGTA 4JVVA 1YLEA 4MI4A 2Z3KA 1OBRA 1F2PA 2Q44A 4CAEA 4ETKA 2HUZA 2VQYA 5FSUA 1Y7EA 1FY7A 1PUAA 3PFEA 2QJ8A 1CG2A 3MN8A 4MHYA 3B3CA 1ARLA 2G9DA 2PIZA 2X47A 4X8IA 2BOAA 5JQ4A 4FD6A 4KUAA 5G20A 2OZUA 3GPOA 1S60A 3H4QA 3MGDA 3VATA 5G21A 4PK3A 3KHZA 3NH5A 2OOTA 4ZBGA 4MFKA 4GVWA 3T8WA 3D3SA 3ISZA 3RAMA 2POKA 3I9SA 3WR7A 4GXHA 3KHXA 4C7HA 2KCWA 1YMEA 4UF4A 3R9GA 5HXDA 4NGQA 2JBKA 4OC1A 5CPAA 1M4LA 5FSXA 3VFQA 4CGNA 1ZLIA 4H2KA 2PJ2A 1VHOA 2FCKA 4X5KA 3TFYA 1Y0RA 5CB3A 2CY2A 4HNWB 1GYTA 1VIXA 3B35A 4R6TA 2FXFA 2QECA 3DLJA 3PB4X 4XPDB 5KTAA 1ARMA 4R57A 2BCOA 4J5RA 4F9VA 1MJAA 4J5SA 5K8NA 2B4BA 4ABKA 2PCUA 1JWQA 3SIIA 2ZEHA 3BJ7A 5F47A 3S6FA 5EBVA 2Q4VA 2HQYA 3D66A 4NGMA 4AVAA 1S7NA 3CXQA 4TU0A 3WC5A 2CNTA 4R76A 4MFPA 2B3VA 5LYFA 3FVLA 2WSAA 1TKHA 1YD9A 2F8HA 3CXSA 4A31A 4WJBA 5H84A 4IQYA 2CTBA 4JXQA 1XE4A 1MK4A 5LRKA 1VKCA 2V8GA 2YGWA 4KS9A 2EVNA 3GPGA 1XBUA 2HC9A 1UFHA 2WYRA 1SQHA 4UCMA 1NE9A 2FIWA 3D4UA 4UMLA 2ZW7A 3G8WA 3RNZA 4MY3A 4RI1A 5A27A 5DUSA 2QVPA 2O53A 2W2GA 4EWTA 1Q2YA 2FG1A 1CM0A 1Z8LA 1CP7A 2ZEPA 2ODFA 2XEGA 4ZGYB 1ZR5A 4FAIA 2JDCA 5IB9A 3JRUA 3EWOA 4GM5A 5C88A 3BXMA 2GU2A 2PDOA 3KKWA 3NE7A 4I49A 4MXUA 4UFWA 5LYLA 2ZPAA 2PJ8A 4JCAA 1IB1E 4PPZA 3SJXA 4CS0B 2FSRA 1YQEA 4PQAA 2A4NA 1QQ9A 4ONUA 2VXKA 3D7HA 1KZFA 4ZY1A 4F0YA 2JLMA 1VHSA 3EY5A 1AMPA 3KASA 1Y7RA 1IU8A 4NCZA 2X7BA 4U9ZA 1Z5RA 2I00A 1RTQA
chains in the Genus database with same CATH topology
1BPNA 4K3NA 2ZENA 2AFUA 2Q4ZA 1R3NA 2AFWA 3RZAA 3WC7A 3L2NA 3KGQA 4FUUA 3KL9A 1CPSA 1TXRA 4RUHA 3CPXA 3IEHA 3PB8X 1ELLP 2CIJA 5CBMA 2IMOA 5HIHA 3NH8A 3I1UA 4ZX8A 2GREA 3D7FA 3EKEA 3SI0A 5E3BA 4YWYA 3D7DA 2EK9A 5K8OA 3HLPA 2ZEEA 3D67A 3WABA 2FVGA 3IC1A 4P10A 4JGKA 3FMCA 2C1CA 1VHEA 4KYBA 4OC0A 2PJ4A 2AFZA 3B3VA 4IHMA 4P4BA 1CP6A 6CPAA 4OIWA 4CPAA 1TF9A 4YU9A 1H8LA 1VGYA 5D8NA 1LAMA 5AILA 1DE4C 3B3WA 3PB6X 4OMEA 4OC2A 1BLLE 2ZEMA 3EWPA 4P44A 1YW6A 3SI1A 3TC8A 4A94A 4ZY2A 4O23A 4W9YA 3CDXA 3GUXA 1HDQA 3PBEA 4PXEA 3V7ZA 3ETIA 4P45A 2PVWA 3GQEA 2BO9A 4DUKA 2C6GA 2JBJA 4J4ZA 1LAPA 3PFOA 4Q7AA 3D7GA 5ELYA 3GB0A 4ESSA 1ZLHA 4P4IA 4ZX9A 3KQXA 3NFZA 4MCSA 4MHPA 4JZ0A 3Q71A 2ZEGA 3PB7X 4OC3A 3SIGA 1IGBA 2Q51A 2ABZA 3FH4A 1CBXA 1HDUA 2AFOA 4P4JA 1HEEA 1TF8A 4FBEA 3S9LA 4MCPA 5HVFA 2O4HA 2CTCA 2PJ9A 2PJBA 2F7VA 4JYWA 4D86A 1TKFA 4DJLA 1FT7A 1DTDA 3PBBA 4A39A 3GLJA 4OP4A 4UIAA 2WZNA 3B7IA 3FEEA 3FEDA 5HVHA 4F9UA 3H8EA 3KR5A 2L8RA 2VL1A 5J1QA 2ZEOA 3EJGA 1VHUA 1YSJA 4OC4A 3S9NA 4PXCA 2FXKA 3B3SA 2HB6A 5JGFA 3FX6A 2BFRA 2PJ5A 4Z65A 3ISXA 4P4DA 2VRIA 3JZTA 3SJGA 1XJOA 4MMOA 2NYQA 2XEFA 3MRUA 3QNVA 4UEZA 2PJ3A 4EMEA 1YLOA 4A37A 3SJEA 5THWA 4NGSA 3V38A 2PJAA 3BHXA 1Z2LA 2FAVA 3FF3A 4PXDA 4R8FA 4DYOA 1LFWA 3PEIA 1CPXA 3CPAA 3BI0A 3IWWA 2EK8A 5DS0A 2XD7A 2PJ0A 4NFRA 3KI9A 2OR4A 3IO1A 1XRYA 8CPAA 1BPMA 2ZELA 2DEAA 2IQ6A 3NA6A 4NGNA 3WC6A 4UIBA 1NSAA 3H8FA 3HUVA 4ZY0A 1ZG9A 4UEFA 2V8VA 3LMSA 2EEEA 5CMSA 2ACFA 2AFCA 1F2OA 4B6ZA 3N5FA 5LRJA 3B2YA 3BI1A 2V8DA 1XMBA 1AYEA 4A38A 4MRIA 2PVVA 1XFOA 3Q6ZA 2EWBA 4NJQA 3EJFA 3DGVA 3FJUA 3IFEA 4LQGA 3V45A 3VARA 2ZOFA 3V2BA 2PIYA 2AFMA 3NH4A 5F09A 5K8MA 4OIDA 2Q43A 4P4FA 5K8PA 2AFXA 4OKOA 4P4EA 4J5QA 4ONWA 4OC5A 5LYIA 5JH9A 4IK2A 4P6YA 4X3RA 3EWRA 2PJCA 4WWVA 3KQZA 1IY7A 2CF4A 1LOKA 4MHZA 4MCRA 3EWQA 4BD9A 3S9MA 2J9AA 4MCQA 5LRGA 2XEJA 1TXZA 2JEWA 1JQGA 3PB9X 5HOLA 1HJZA 3EW5A 3RBUA 1Y0YA 5FSYA 5LYDA 2BFQA 4X2TA 2C6CA 4UEEA 2PRQA 4NJRA 1LANA 4NGRA 3GQOA 2IJZA 3GPQA 2V77A 4G1PA 2PJ6A 5FSZA 5I4MA 1FNOA 4PXBA 3SJFA 3TX8A 1ZG7A 4F8ZA 2NSMA 1LCPA 2ZOGA 3B3TA 4K0CA 4JLLA 3SIHA 5CB5A 2GLFA 3WT4A 1UWYA 2PJ1A 1BAVA 1EE3P 3FECA 4TWEA 2PJ7A 2ZEDA 4ZI6A 4EFDA 1PYTB 3K9TA 1KWMA 3PRTA 3VH9A 2QYVA 3CT9A 3IJ3A 4NGPA 1ZG8A 3K2KA 4IAVA 4ABLA 4KSIA 4MHNA 1SPVA 3IIFA 7CPAA 3KR4A 3KZWA 2V8HA 3IIDA 2I3CA 3SI2A 3IIBA 1ZR3A 3SIJA 2ZEFA 5D29A 4GVVA 4TNUA 4R7MA 4ZYQA 4ETJA 4FWUA 2GLJA 1F57A 2DX6A 2AFSA 2ANPA 2PE3A 1QMUA 4GUAA 4AXVA 2RB7A 3D68A 2XEIA 2RFHA 1ELMP 1PCAA 1YW4A 3H8GA 5HVGA 1NJRA 1R43A 2C6PA 5FSVA 1CX8A 5JM6A 1Q7LA 2LGRA 3LWUA 1TY8A 1TKJA 4NGTA 4JVVA 1OBRA 1F2PA 4ETKA 5FSUA 1Y7EA 3PFEA 2QJ8A 1CG2A 3MN8A 4MHYA 3B3CA 1ARLA 2G9DA 2PIZA 2X47A 4X8IA 2BOAA 3GPOA 3VATA 3KHZA 3NH5A 2OOTA 4GVWA 3T8WA 3ISZA 3RAMA 2POKA 3KHXA 4UF4A 1YMEA 5HXDA 4NGQA 2JBKA 4OC1A 5CPAA 1M4LA 5FSXA 3VFQA 1ZLIA 4H2KA 2PJ2A 1VHOA 1Y0RA 5CB3A 1GYTA 1VIXA 3B35A 4R6TA 3DLJA 3PB4X 1ARMA 2BCOA 4J5RA 4F9VA 5K8NA 4J5SA 4ABKA 2PCUA 3SIIA 2ZEHA 4NGMA 3D66A 4TU0A 3WC5A 4R76A 5LYFA 3FVLA 1TKHA 1YD9A 2F8HA 4WJBA 4IQYA 2CTBA 5LRKA 2V8GA 3GPGA 1XBUA 2HC9A 2WYRA 3D4UA 4UMLA 5DUSA 2QVPA 2O53A 4EWTA 2FG1A 1Z8LA 2ZEPA 1CP7A 2XEGA 5IB9A 1ZR5A 4FAIA 3JRUA 3EWOA 4GM5A 3BXMA 2GU2A 5LYLA 4MXUA 2PJ8A 4JCAA 4PPZA 3SJXA 4PQAA 1QQ9A 3D7HA 4ZY1A 1AMPA 3KASA 1Z5RA 1RTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPN A;  4K3N A;  2ZEN A;  2AFU A;  2Q4Z A;  1R3N A;  2AFW A;  3RZA A;  3WC7 A;  3L2N A;  3KGQ A;  4FUU A;  3KL9 A;  1CPS A;  1TXR A;  4RUH A;  3CPX A;  3IEH A;  3PB8 X;  1ELL P;  2CIJ A;  5CBM A;  2IMO A;  5HIH A;  3NH8 A;  3I1U A;  4ZX8 A;  2GRE A;  3D7F A;  3EKE A;  3SI0 A;  5E3B A;  4YWY A;  3D7D A;  2EK9 A;  5K8O A;  3HLP A;  2ZEE A;  3D67 A;  3WAB A;  2FVG A;  3IC1 A;  4P10 A;  4JGK A;  3FMC A;  2C1C A;  1VHE A;  4KYB A;  4OC0 A;  2PJ4 A;  2AFZ A;  3B3V A;  4IHM A;  4P4B A;  1CP6 A;  6CPA A;  4OIW A;  4CPA A;  1TF9 A;  4YU9 A;  1H8L A;  1VGY A;  5D8N A;  1LAM A;  5AIL A;  1DE4 C;  3B3W A;  3PB6 X;  4OME A;  4OC2 A;  1BLL E;  2ZEM A;  3EWP A;  4P44 A;  1YW6 A;  3SI1 A;  3TC8 A;  4A94 A;  4ZY2 A;  4O23 A;  4W9Y A;  3CDX A;  3GUX A;  1HDQ A;  3PBE A;  4PXE A;  3V7Z A;  3ETI A;  4P45 A;  2PVW A;  3GQE A;  2BO9 A;  4DUK A;  2C6G A;  2JBJ A;  4J4Z A;  1LAP A;  3PFO A;  4Q7A A;  3D7G A;  5ELY A;  3GB0 A;  4ESS A;  1ZLH A;  4P4I A;  4ZX9 A;  3KQX A;  3NFZ A;  4MCS A;  4MHP A;  4JZ0 A;  3Q71 A;  2ZEG A;  3PB7 X;  4OC3 A;  3SIG A;  1IGB A;  2Q51 A;  2ABZ A;  3FH4 A;  1CBX A;  1HDU A;  2AFO A;  4P4J A;  1HEE A;  1TF8 A;  4FBE A;  3S9L A;  4MCP A;  5HVF A;  2O4H A;  2CTC A;  2PJ9 A;  2PJB A;  2F7V A;  4JYW A;  4D86 A;  1TKF A;  4DJL A;  1FT7 A;  1DTD A;  3PBB A;  4A39 A;  3GLJ A;  4OP4 A;  4UIA A;  2WZN A;  3B7I A;  3FEE A;  3FED A;  5HVH A;  4F9U A;  3H8E A;  3KR5 A;  2L8R A;  2VL1 A;  5J1Q A;  2ZEO A;  3EJG A;  1VHU A;  1YSJ A;  4OC4 A;  3S9N A;  4PXC A;  2FXK A;  3B3S A;  2HB6 A;  5JGF A;  3FX6 A;  2BFR A;  2PJ5 A;  4Z65 A;  3ISX A;  4P4D A;  2VRI A;  3JZT A;  3SJG A;  1XJO A;  4MMO A;  2NYQ A;  2XEF A;  3MRU A;  3QNV A;  4UEZ A;  2PJ3 A;  4EME A;  1YLO A;  4A37 A;  3SJE A;  5THW A;  4NGS A;  3V38 A;  2PJA A;  3BHX A;  1Z2L A;  2FAV A;  3FF3 A;  4PXD A;  4R8F A;  4DYO A;  1LFW A;  3PEI A;  1CPX A;  3CPA A;  3BI0 A;  3IWW A;  2EK8 A;  5DS0 A;  2XD7 A;  2PJ0 A;  4NFR A;  3KI9 A;  2OR4 A;  3IO1 A;  1XRY A;  8CPA A;  1BPM A;  2ZEL A;  2DEA A;  2IQ6 A;  3NA6 A;  4NGN A;  3WC6 A;  4UIB A;  1NSA A;  3H8F A;  3HUV A;  4ZY0 A;  1ZG9 A;  4UEF A;  2V8V A;  3LMS A;  2EEE A;  5CMS A;  2ACF A;  2AFC A;  1F2O A;  4B6Z A;  3N5F A;  5LRJ A;  3B2Y A;  3BI1 A;  2V8D A;  1XMB A;  1AYE A;  4A38 A;  4MRI A;  2PVV A;  1XFO A;  3Q6Z A;  2EWB A;  4NJQ A;  3EJF A;  3DGV A;  3FJU A;  3IFE A;  4LQG A;  3V45 A;  3VAR A;  2ZOF A;  3V2B A;  2PIY A;  2AFM A;  3NH4 A;  5F09 A;  5K8M A;  4OID A;  2Q43 A;  4P4F A;  5K8P A;  2AFX A;  4OKO A;  4P4E A;  4J5Q A;  4ONW A;  4OC5 A;  5LYI A;  5JH9 A;  4IK2 A;  4P6Y A;  4X3R A;  3EWR A;  2PJC A;  4WWV A;  3KQZ A;  1IY7 A;  2CF4 A;  1LOK A;  4MHZ A;  4MCR A;  3EWQ A;  4BD9 A;  3S9M A;  2J9A A;  4MCQ A;  5LRG A;  2XEJ A;  1TXZ A;  2JEW A;  1JQG A;  3PB9 X;  5HOL A;  1HJZ A;  3EW5 A;  3RBU A;  1Y0Y A;  5FSY A;  5LYD A;  2BFQ A;  4X2T A;  2C6C A;  4UEE A;  2PRQ A;  4NJR A;  1LAN A;  4NGR A;  3GQO A;  2IJZ A;  3GPQ A;  2V77 A;  4G1P A;  2PJ6 A;  5FSZ A;  5I4M A;  1FNO A;  4PXB A;  3SJF A;  3TX8 A;  1ZG7 A;  4F8Z A;  2NSM A;  1LCP A;  2ZOG A;  3B3T A;  4K0C A;  4JLL A;  3SIH A;  5CB5 A;  2GLF A;  3WT4 A;  1UWY A;  2PJ1 A;  1BAV A;  1EE3 P;  3FEC A;  4TWE A;  2PJ7 A;  2ZED A;  4ZI6 A;  4EFD A;  1PYT B;  3K9T A;  1KWM A;  3PRT A;  3VH9 A;  2QYV A;  3CT9 A;  3IJ3 A;  4NGP A;  1ZG8 A;  3K2K A;  4IAV A;  4ABL A;  4KSI A;  4MHN A;  1SPV A;  3IIF A;  7CPA A;  3KR4 A;  3KZW A;  2V8H A;  3IID A;  2I3C A;  3SI2 A;  3IIB A;  1ZR3 A;  3SIJ A;  2ZEF A;  5D29 A;  4GVV A;  4TNU A;  4R7M A;  4ZYQ A;  4ETJ A;  4FWU A;  2GLJ A;  1F57 A;  2DX6 A;  2AFS A;  2ANP A;  2PE3 A;  1QMU A;  4GUA A;  4AXV A;  2RB7 A;  3D68 A;  2XEI A;  2RFH A;  1ELM P;  1PCA A;  1YW4 A;  3H8G A;  5HVG A;  1NJR A;  1R43 A;  2C6P A;  5FSV A;  1CX8 A;  5JM6 A;  1Q7L A;  2LGR A;  3LWU A;  1TY8 A;  1TKJ A;  4NGT A;  4JVV A;  1OBR A;  1F2P A;  4ETK A;  5FSU A;  1Y7E A;  3PFE A;  2QJ8 A;  1CG2 A;  3MN8 A;  4MHY A;  3B3C A;  1ARL A;  2G9D A;  2PIZ A;  2X47 A;  4X8I A;  2BOA A;  3GPO A;  3VAT A;  3KHZ A;  3NH5 A;  2OOT A;  4GVW A;  3T8W A;  3ISZ A;  3RAM A;  2POK A;  3KHX A;  4UF4 A;  1YME A;  5HXD A;  4NGQ A;  2JBK A;  4OC1 A;  5CPA A;  1M4L A;  5FSX A;  3VFQ A;  1ZLI A;  4H2K A;  2PJ2 A;  1VHO A;  1Y0R A;  5CB3 A;  1GYT A;  1VIX A;  3B35 A;  4R6T A;  3DLJ A;  3PB4 X;  1ARM A;  2BCO A;  4J5R A;  4F9V A;  5K8N A;  4J5S A;  4ABK A;  2PCU A;  3SII A;  2ZEH A;  4NGM A;  3D66 A;  4TU0 A;  3WC5 A;  4R76 A;  5LYF A;  3FVL A;  1TKH A;  1YD9 A;  2F8H A;  4WJB A;  4IQY A;  2CTB A;  5LRK A;  2V8G A;  3GPG A;  1XBU A;  2HC9 A;  2WYR A;  3D4U A;  4UML A;  5DUS A;  2QVP A;  2O53 A;  4EWT A;  2FG1 A;  1Z8L A;  2ZEP A;  1CP7 A;  2XEG A;  5IB9 A;  1ZR5 A;  4FAI A;  3JRU A;  3EWO A;  4GM5 A;  3BXM A;  2GU2 A;  5LYL A;  4MXU A;  2PJ8 A;  4JCA A;  4PPZ A;  3SJX A;  4PQA A;  1QQ9 A;  3D7H A;  4ZY1 A;  1AMP A;  3KAS A;  1Z5R A;  1RTQ A; 
#chains in the Genus database with same CATH topology
 1BPN A;  4K3N A;  2ZEN A;  2AFU A;  2Q4Z A;  4DNC A;  1R3N A;  2AFW A;  2Q4Y A;  3RZA A;  4OLL A;  3WC7 A;  3L2N A;  2YNE A;  3BLN A;  5DWN A;  3KGQ A;  4RS2 A;  1YGH A;  1YRE A;  5E96 A;  4R9M A;  3FIX A;  2JEV A;  5J8F A;  4FUU A;  2ZXV A;  2DXQ A;  3KL9 A;  1CPS A;  4CYO A;  1IID A;  1TXR A;  2DF5 A;  3CPX A;  2GAN A;  4RUH A;  4R3L A;  5IB0 A;  4AG9 A;  2J8N A;  3IEH A;  2WPX A;  3D8P A;  2G3A A;  4Y49 B;  2PSW A;  4R3K A;  3DNS A;  2D4O A;  2FT0 A;  4KOS A;  3PB8 X;  1ELL P;  2CIJ A;  1XEB A;  4E0A A;  5CBM A;  2IMO A;  3F5B A;  4UFV A;  2GE3 A;  5HIH A;  3IWG A;  2JZF A;  1YR0 A;  4ZX8 A;  2GRE A;  3D7F A;  1Y9W A;  3EKE A;  2B3U A;  3I1U A;  3SI0 A;  4BMH A;  1S7K A;  3P2F A;  1RXT A;  5AG6 A;  5E3B A;  1NSL A;  1QSO A;  4UFX A;  4YWY A;  3D7D A;  2EK9 A;  4B14 A;  3HLP A;  2O28 A;  2ZEE A;  3D67 A;  5K8O A;  4NF1 A;  1Z8X A;  2FVG A;  4IF5 A;  3WAB A;  3IC1 A;  3TCV A;  4P10 A;  5F48 A;  5HH1 A;  4JGK A;  2BL1 A;  2ARH A;  2BSW A;  1Z8T A;  3IWE A;  2RNK A;  1KUX A;  3FMC A;  4OAD A;  2C1C A;  4MJ8 A;  3R9F A;  3RO0 A;  4EVY A;  4H6U A;  3QB8 A;  1TIQ A;  4UBR A;  1P4N A;  1VHE A;  3TOB A;  4KYB A;  4M3S A;  1RO5 A;  4OC0 A;  2PJ4 A;  1QSN A;  2AFZ A;  2Y0M A;  3B3V A;  4UWJ A;  4IHM A;  4P4B A;  2B58 A;  1CP6 A;  6CPA A;  3PP9 A;  2PC1 A;  4OIW A;  4CPA A;  4KOT A;  1TF9 A;  1MJB A;  4YU9 A;  1H8L A;  3UY5 A;  1VGY A;  2AJ6 A;  5D8N A;  1LAM A;  5AIL A;  3EFA A;  1DE4 C;  4QUS A;  5J8C A;  4PK2 A;  3B3W A;  3PB6 X;  2EO8 A;  4OC2 A;  4OME A;  1BLL E;  2ZEM A;  1R57 A;  2DPT A;  3EWP A;  3K9U A;  4P44 A;  1YW6 A;  2JZD A;  2P0W A;  3JVN A;  3SI1 A;  3TC8 A;  4A94 A;  4ZY2 A;  4O23 A;  3FB3 A;  4W9Y A;  3CDX A;  3GUX A;  1HDQ A;  3CXP A;  4MFZ A;  4R87 A;  4A33 A;  4AG7 A;  4U9Y A;  2PR1 A;  4C7I A;  1MJ9 A;  3PBE A;  4PXE A;  3V7Z A;  3ETI A;  3CZX A;  4B13 A;  4P45 A;  3GQE A;  2PVW A;  1YVK A;  2BO9 A;  2R98 A;  4KOX A;  4DUK A;  3TO9 A;  2C6G A;  1IIC A;  2CNS A;  3EXN A;  3TOA A;  2JBJ A;  4J4Z A;  1LAP A;  1Z8W A;  3PFO A;  4Q7A A;  4LUA A;  4XNH C;  3D7G A;  5ELY A;  3GB0 A;  4ESS A;  4CGP A;  1ZLH A;  4CAW A;  3TT2 A;  1AUG A;  4P4I A;  5AG5 A;  4ZX9 A;  3KQX A;  3NFZ A;  4MCS A;  5ISV A;  4MHP A;  4JZ0 A;  1YVO A;  3NE8 A;  3Q71 A;  2VI7 A;  3E0K A;  2ZEG A;  3PB7 X;  4OC3 A;  3SIG A;  1J4J A;  2FE7 A;  5F49 A;  3FXT A;  1IGB A;  2Q51 A;  2ABZ A;  4CAX A;  3FH4 A;  2PRB A;  4HNY B;  3TO6 A;  2JDD A;  2AE6 A;  1CBX A;  1M4D A;  1WK4 A;  4F6A A;  1HDU A;  2OU2 A;  2AFO A;  2Q7S A;  4P4J A;  1HEE A;  1TF8 A;  4FBE A;  2EUI A;  4A95 A;  3S9L A;  4MCP A;  4A2Z A;  5HVF A;  2O4H A;  1YK3 A;  2CTC A;  2PJ9 A;  2PJB A;  2CXA A;  2F7V A;  4JYW A;  4RN7 A;  4D86 A;  1TKF A;  4DJL A;  4HKF A;  3TTH A;  1FT7 A;  1DTD A;  3PBB A;  4A39 A;  3GLJ A;  4OP4 A;  5AG7 A;  4C2X A;  4UIA A;  2WZN A;  2EBJ A;  4AVC A;  3B7I A;  3FEE A;  4JWP A;  3FED A;  5HVH A;  1P0H A;  4NSQ A;  4F9U A;  1ON0 A;  5AGE A;  3SHP A;  2F5I A;  2RC4 A;  3IU2 A;  3H8E A;  3KR5 A;  2L8R A;  2VL1 A;  2VZY A;  3LAC A;  1QST A;  5J1Q A;  2ZEO A;  3DSB A;  3EJG A;  3NH8 A;  1VHU A;  1YSJ A;  4OC4 A;  1S3Z A;  3S9N A;  2ZW4 A;  4PXC A;  3T9Y A;  2FXK A;  2Z10 A;  4UA3 A;  5JPH A;  3B3S A;  4C68 A;  2R7H A;  2HB6 A;  5JGF A;  3FX6 A;  2BFR A;  4M6I A;  2PJ5 A;  4Z65 A;  3ISX A;  4P4D A;  2VRI A;  3JZT A;  3SJG A;  1XJO A;  3W6X A;  4FD4 A;  4MMO A;  2NYQ A;  4K30 A;  2XEF A;  4QBJ A;  3MRU A;  3N7Z A;  3QNV A;  1V0C A;  4J3G A;  2B5G B;  4UEZ A;  2PJ3 A;  3EO4 A;  4YGO A;  1YLO A;  4A37 A;  4EME A;  3SJE A;  2ZW5 A;  3ZZI A;  5C82 A;  5THW A;  3V8I A;  4CYP A;  2Z11 A;  4NGS A;  3V38 A;  2BEI A;  2PJA A;  3BHX A;  2Z3O A;  3QAY A;  1Z2L A;  2FAV A;  2H5M A;  3FF3 A;  4PXD A;  4L8A A;  4R8F A;  4DYO A;  2DPS A;  1LFW A;  3ZJ0 A;  3PEI A;  4CRY B;  4MBU A;  1CPX A;  4QB9 A;  3CPA A;  4BIN A;  4KOV A;  3BI0 A;  3IWW A;  2EK8 A;  2FS5 A;  1BOB A;  3GYA A;  5DS0 A;  2XD7 A;  4IUS A;  2PJ0 A;  4NFR A;  2JZE A;  2OR4 A;  3KI9 A;  1IOF A;  1IYK A;  2HV2 A;  3IO1 A;  4KZT A;  1XRY A;  4KSA A;  1XIX A;  3RYO A;  4JXR A;  3TO7 A;  4CGO A;  8CPA A;  1BPM A;  2B5G A;  2ZEL A;  2DEA A;  2IQ6 A;  3NA6 A;  4NGN A;  1N71 A;  4HNX B;  1Q2C A;  4M85 A;  3WC6 A;  3JUW A;  4UIB A;  1NSA A;  5EC4 A;  4B12 A;  4AB7 A;  2QML A;  3H8F A;  3HUV A;  2I79 A;  5DWM A;  4ZY0 A;  3R96 A;  4QC6 A;  4FD5 A;  4E8O A;  1ZG9 A;  5AG4 A;  1GHE A;  2R8V A;  2V8V A;  4UEF A;  3LMS A;  2EEE A;  5CMS A;  2ACF A;  2AFC A;  1F2O A;  4QVT A;  4UWI A;  3W91 A;  4B5P A;  4B6Z A;  3N5F A;  4KUB A;  5LRJ A;  3B2Y A;  4XPD C;  3H5Z A;  4B5O A;  3BI1 A;  2V8D A;  4JD6 A;  2QIR A;  4UCN A;  1XMB A;  1AYE A;  3T90 A;  4A38 A;  4MRI A;  2PVV A;  1LRZ A;  1XFO A;  5G22 A;  2Q0Y A;  4YRH A;  1M44 A;  3LOD A;  3Q6Z A;  2EWB A;  2VZZ A;  4NJQ A;  5G1Z A;  1QSR A;  3EJF A;  3DGV A;  3FJU A;  3IFE A;  4LQG A;  3V45 A;  2Z3L A;  3VAR A;  3V2B A;  2ZOF A;  4CAF A;  1I12 A;  1B6B A;  2PIY A;  2AFM A;  3NH4 A;  4B10 A;  5F09 A;  3P2H A;  5K8M A;  4OID A;  1A2Z A;  1Y9K A;  2Q43 A;  4C2Z A;  1I21 A;  4P4F A;  4L89 A;  3SXO A;  5K8P A;  1CJW A;  2AFX A;  2Q04 A;  3JTK A;  4OKO A;  1YX0 A;  4P4E A;  4J5Q A;  4ONW A;  3A9L A;  3FYN A;  2ATR A;  4OC5 A;  4Q36 A;  5LYI A;  5JH9 A;  4IK2 A;  4P6Y A;  4X3R A;  3R9E A;  3EWR A;  2PJC A;  4WWV A;  3S6K A;  2NMT A;  3KQZ A;  3F8K A;  4PSX A;  4XPK A;  1IY7 A;  2CF4 A;  2G0B A;  1LOK A;  4KVX A;  4MHZ A;  2WPW A;  2D4P A;  4MCR A;  3EWQ A;  1KUY A;  3W6S A;  4BD9 A;  3S9M A;  2J9A A;  2VEZ A;  1WWZ A;  4H89 A;  4LQ6 A;  4MCQ A;  5I0C A;  1X12 A;  2XEJ A;  5LRG A;  3F0A A;  1TXZ A;  1Z9U A;  2P6E A;  1XMT A;  3TE4 A;  2JEW A;  1JQG A;  3PB9 X;  5HOL A;  1HJZ A;  4BBH A;  2Z3M A;  3EW5 A;  1K4J A;  2FL4 A;  4E2A A;  2FIA A;  4H6Z A;  3RBU A;  4II9 A;  2C27 A;  1Y0Y A;  5FSY A;  5EMI A;  4NEX A;  5LYD A;  2BFQ A;  1PU9 A;  3BJ8 A;  4X2T A;  2R1I A;  4KVM E;  2KQV A;  4KVO E;  2C6C A;  5BWA B;  4JLY A;  4UEE A;  2PRQ A;  2Q7B A;  1ZO0 A;  4NJR A;  1LAN A;  4NGR A;  3GQO A;  4F0X A;  3EC4 A;  2IJZ A;  2J8R A;  2PQ8 A;  1XOV A;  3FNC A;  3GPQ A;  2V77 A;  3C26 A;  4CGL A;  4KLW A;  5F46 A;  4CYN A;  1X10 A;  3VWD A;  2Z3P A;  4G1P A;  2P6F A;  2VBQ A;  2YNC C;  4LX9 A;  2PJ6 A;  2PR8 A;  4CYQ A;  4Y49 C;  5KTD A;  2OH1 A;  1I1D A;  5FSZ A;  1L0C A;  1FNO A;  4PXB A;  5I4M A;  3PZJ A;  3SJF A;  4MFJ A;  1ZG7 A;  4M6G A;  2OZG A;  3TX8 A;  3B8G A;  4F8Z A;  4XNH B;  2NSM A;  5IV0 A;  1U6M A;  3DDD A;  1LCP A;  2REE A;  2B4D B;  2K5T A;  2ZOG A;  3B3T A;  4K0C A;  4JLL A;  3SIH A;  5CB5 A;  2GLF A;  3GKR A;  3WT4 A;  1UWY A;  2PJ1 A;  3SXN A;  4JJX A;  1BAV A;  1EE3 P;  2IL4 A;  4C2Y A;  3FEC A;  1M4G A;  2PJ7 A;  3IU1 A;  4MY0 A;  4ORF A;  4TWE A;  3S6H A;  4KOR A;  4B11 A;  4CRZ B;  4A30 A;  3S6G A;  2ZED A;  4ZI6 A;  3G3S A;  4EFD A;  1PYT B;  3K9T A;  2Z3N A;  1KWM A;  4NXY A;  3I3G A;  2J8M A;  2P6G A;  3R1K A;  3PRT A;  3VH9 A;  3GY9 A;  3VWE A;  5KTC A;  1Z4E A;  2QYV A;  3CT9 A;  3IJ3 A;  1OZP A;  4HPS A;  4NGP A;  4PV6 A;  2GFQ A;  5HMN A;  1XF8 A;  1ZG8 A;  1IOI A;  1S7F A;  2B4D A;  3K2K A;  4IAV A;  3PGP A;  4ABL A;  4KSI A;  3D2M A;  4MHN A;  1SPV A;  1NMT A;  1B87 A;  2ZW6 A;  3DR8 A;  3IIF A;  4Q38 A;  4CAV A;  7CPA A;  5IX3 A;  3KR4 A;  1Q2D A;  3KZW A;  2V8H A;  4B5P B;  1Z4R A;  4PSW A;  3IID A;  2I3C A;  1KUV A;  2G3T A;  4UCP A;  4KSF A;  5CNP A;  3SI2 A;  4KOW A;  3IIB A;  4FD7 A;  1ZR3 A;  3SIJ A;  3D2P A;  2ZEF A;  5D29 A;  4MHD A;  5FVJ A;  3R95 A;  4GVV A;  3LD2 A;  4TNU A;  4MFQ A;  4R7M A;  4ZYQ A;  4ETJ A;  4YFJ A;  2WUU A;  4XPL A;  4FWU A;  1IYL A;  5GCN A;  4M6H A;  1M1D A;  2GLJ A;  1F57 A;  4GS4 A;  4MFL A;  2OZH A;  2DX6 A;  2AFS A;  2ANP A;  2PE3 A;  3GIU A;  4AVB A;  3FRM A;  1QMU A;  3DR6 A;  2WCT A;  4KOY A;  4GUA A;  4AXV A;  2RB7 A;  4KLV A;  1S7L A;  3D68 A;  2XEI A;  3IGR A;  4KOU A;  1QSM A;  2RFH A;  1ELM P;  3OWC A;  1PCA A;  4CGM A;  1YW4 A;  4A32 A;  2Z0Z A;  3H8G A;  4U5Y A;  5HVG A;  2CNM A;  2REF A;  1NJR A;  1S5K A;  2YND A;  2YNC A;  3QAH A;  4OAE A;  2BUE A;  5A28 A;  2GIV A;  1R43 A;  5H86 A;  1BO4 A;  5FSV A;  1CX8 A;  2C6P A;  1M4I A;  1Q7L A;  2LGR A;  2OB0 A;  5JM6 A;  3FBU A;  1TY8 A;  1TKJ A;  3LWU A;  4NGT A;  4JVV A;  1YLE A;  4MI4 A;  2Z3K A;  1OBR A;  1F2P A;  2Q44 A;  4CAE A;  4ETK A;  2HUZ A;  2VQY A;  5FSU A;  1Y7E A;  1FY7 A;  1PUA A;  3PFE A;  2QJ8 A;  1CG2 A;  3MN8 A;  4MHY A;  3B3C A;  1ARL A;  2G9D A;  2PIZ A;  2X47 A;  4X8I A;  2BOA A;  5JQ4 A;  4FD6 A;  4KUA A;  5G20 A;  2OZU A;  3GPO A;  1S60 A;  3H4Q A;  3MGD A;  3VAT A;  5G21 A;  4PK3 A;  3KHZ A;  3NH5 A;  2OOT A;  4ZBG A;  4MFK A;  4GVW A;  3T8W A;  3D3S A;  3ISZ A;  3RAM A;  2POK A;  3I9S A;  3WR7 A;  4GXH A;  3KHX A;  4C7H A;  2KCW A;  1YME A;  4UF4 A;  3R9G A;  5HXD A;  4NGQ A;  2JBK A;  4OC1 A;  5CPA A;  1M4L A;  5FSX A;  3VFQ A;  4CGN A;  1ZLI A;  4H2K A;  2PJ2 A;  1VHO A;  2FCK A;  4X5K A;  3TFY A;  1Y0R A;  5CB3 A;  2CY2 A;  4HNW B;  1GYT A;  1VIX A;  3B35 A;  4R6T A;  2FXF A;  2QEC A;  3DLJ A;  3PB4 X;  4XPD B;  5KTA A;  1ARM A;  4R57 A;  2BCO A;  4J5R A;  4F9V A;  1MJA A;  4J5S A;  5K8N A;  2B4B A;  4ABK A;  2PCU A;  1JWQ A;  3SII A;  2ZEH A;  3BJ7 A;  5F47 A;  3S6F A;  5EBV A;  2Q4V A;  2HQY A;  3D66 A;  4NGM A;  4AVA A;  1S7N A;  3CXQ A;  4TU0 A;  3WC5 A;  2CNT A;  4R76 A;  4MFP A;  2B3V A;  5LYF A;  3FVL A;  2WSA A;  1TKH A;  1YD9 A;  2F8H A;  3CXS A;  4A31 A;  4WJB A;  5H84 A;  4IQY A;  2CTB A;  4JXQ A;  1XE4 A;  1MK4 A;  5LRK A;  1VKC A;  2V8G A;  2YGW A;  4KS9 A;  2EVN A;  3GPG A;  1XBU A;  2HC9 A;  1UFH A;  2WYR A;  1SQH A;  4UCM A;  1NE9 A;  2FIW A;  3D4U A;  4UML A;  2ZW7 A;  3G8W A;  3RNZ A;  4MY3 A;  4RI1 A;  5A27 A;  5DUS A;  2QVP A;  2O53 A;  2W2G A;  4EWT A;  1Q2Y A;  2FG1 A;  1CM0 A;  1Z8L A;  1CP7 A;  2ZEP A;  2ODF A;  2XEG A;  4ZGY B;  1ZR5 A;  4FAI A;  2JDC A;  5IB9 A;  3JRU A;  3EWO A;  4GM5 A;  5C88 A;  3BXM A;  2GU2 A;  2PDO A;  3KKW A;  3NE7 A;  4I49 A;  4MXU A;  4UFW A;  5LYL A;  2ZPA A;  2PJ8 A;  4JCA A;  1IB1 E;  4PPZ A;  3SJX A;  4CS0 B;  2FSR A;  1YQE A;  4PQA A;  2A4N A;  1QQ9 A;  4ONU A;  2VXK A;  3D7H A;  1KZF A;  4ZY1 A;  4F0Y A;  2JLM A;  1VHS A;  3EY5 A;  1AMP A;  3KAS A;  1Y7R A;  1IU8 A;  4NCZ A;  2X7B A;  4U9Z A;  1Z5R A;  2I00 A;  1RTQ A; 
#chains in the Genus database with same CATH homology
 1BPN A;  4K3N A;  2ZEN A;  2AFU A;  2Q4Z A;  1R3N A;  2AFW A;  3RZA A;  3WC7 A;  3L2N A;  3KGQ A;  4FUU A;  3KL9 A;  1CPS A;  1TXR A;  4RUH A;  3CPX A;  3IEH A;  3PB8 X;  1ELL P;  2CIJ A;  5CBM A;  2IMO A;  5HIH A;  3NH8 A;  3I1U A;  4ZX8 A;  2GRE A;  3D7F A;  3EKE A;  3SI0 A;  5E3B A;  4YWY A;  3D7D A;  2EK9 A;  5K8O A;  3HLP A;  2ZEE A;  3D67 A;  3WAB A;  2FVG A;  3IC1 A;  4P10 A;  4JGK A;  3FMC A;  2C1C A;  1VHE A;  4KYB A;  4OC0 A;  2PJ4 A;  2AFZ A;  3B3V A;  4IHM A;  4P4B A;  1CP6 A;  6CPA A;  4OIW A;  4CPA A;  1TF9 A;  4YU9 A;  1H8L A;  1VGY A;  5D8N A;  1LAM A;  5AIL A;  1DE4 C;  3B3W A;  3PB6 X;  4OME A;  4OC2 A;  1BLL E;  2ZEM A;  3EWP A;  4P44 A;  1YW6 A;  3SI1 A;  3TC8 A;  4A94 A;  4ZY2 A;  4O23 A;  4W9Y A;  3CDX A;  3GUX A;  1HDQ A;  3PBE A;  4PXE A;  3V7Z A;  3ETI A;  4P45 A;  2PVW A;  3GQE A;  2BO9 A;  4DUK A;  2C6G A;  2JBJ A;  4J4Z A;  1LAP A;  3PFO A;  4Q7A A;  3D7G A;  5ELY A;  3GB0 A;  4ESS A;  1ZLH A;  4P4I A;  4ZX9 A;  3KQX A;  3NFZ A;  4MCS A;  4MHP A;  4JZ0 A;  3Q71 A;  2ZEG A;  3PB7 X;  4OC3 A;  3SIG A;  1IGB A;  2Q51 A;  2ABZ A;  3FH4 A;  1CBX A;  1HDU A;  2AFO A;  4P4J A;  1HEE A;  1TF8 A;  4FBE A;  3S9L A;  4MCP A;  5HVF A;  2O4H A;  2CTC A;  2PJ9 A;  2PJB A;  2F7V A;  4JYW A;  4D86 A;  1TKF A;  4DJL A;  1FT7 A;  1DTD A;  3PBB A;  4A39 A;  3GLJ A;  4OP4 A;  4UIA A;  2WZN A;  3B7I A;  3FEE A;  3FED A;  5HVH A;  4F9U A;  3H8E A;  3KR5 A;  2L8R A;  2VL1 A;  5J1Q A;  2ZEO A;  3EJG A;  1VHU A;  1YSJ A;  4OC4 A;  3S9N A;  4PXC A;  2FXK A;  3B3S A;  2HB6 A;  5JGF A;  3FX6 A;  2BFR A;  2PJ5 A;  4Z65 A;  3ISX A;  4P4D A;  2VRI A;  3JZT A;  3SJG A;  1XJO A;  4MMO A;  2NYQ A;  2XEF A;  3MRU A;  3QNV A;  4UEZ A;  2PJ3 A;  4EME A;  1YLO A;  4A37 A;  3SJE A;  5THW A;  4NGS A;  3V38 A;  2PJA A;  3BHX A;  1Z2L A;  2FAV A;  3FF3 A;  4PXD A;  4R8F A;  4DYO A;  1LFW A;  3PEI A;  1CPX A;  3CPA A;  3BI0 A;  3IWW A;  2EK8 A;  5DS0 A;  2XD7 A;  2PJ0 A;  4NFR A;  3KI9 A;  2OR4 A;  3IO1 A;  1XRY A;  8CPA A;  1BPM A;  2ZEL A;  2DEA A;  2IQ6 A;  3NA6 A;  4NGN A;  3WC6 A;  4UIB A;  1NSA A;  3H8F A;  3HUV A;  4ZY0 A;  1ZG9 A;  4UEF A;  2V8V A;  3LMS A;  2EEE A;  5CMS A;  2ACF A;  2AFC A;  1F2O A;  4B6Z A;  3N5F A;  5LRJ A;  3B2Y A;  3BI1 A;  2V8D A;  1XMB A;  1AYE A;  4A38 A;  4MRI A;  2PVV A;  1XFO A;  3Q6Z A;  2EWB A;  4NJQ A;  3EJF A;  3DGV A;  3FJU A;  3IFE A;  4LQG A;  3V45 A;  3VAR A;  2ZOF A;  3V2B A;  2PIY A;  2AFM A;  3NH4 A;  5F09 A;  5K8M A;  4OID A;  2Q43 A;  4P4F A;  5K8P A;  2AFX A;  4OKO A;  4P4E A;  4J5Q A;  4ONW A;  4OC5 A;  5LYI A;  5JH9 A;  4IK2 A;  4P6Y A;  4X3R A;  3EWR A;  2PJC A;  4WWV A;  3KQZ A;  1IY7 A;  2CF4 A;  1LOK A;  4MHZ A;  4MCR A;  3EWQ A;  4BD9 A;  3S9M A;  2J9A A;  4MCQ A;  5LRG A;  2XEJ A;  1TXZ A;  2JEW A;  1JQG A;  3PB9 X;  5HOL A;  1HJZ A;  3EW5 A;  3RBU A;  1Y0Y A;  5FSY A;  5LYD A;  2BFQ A;  4X2T A;  2C6C A;  4UEE A;  2PRQ A;  4NJR A;  1LAN A;  4NGR A;  3GQO A;  2IJZ A;  3GPQ A;  2V77 A;  4G1P A;  2PJ6 A;  5FSZ A;  5I4M A;  1FNO A;  4PXB A;  3SJF A;  3TX8 A;  1ZG7 A;  4F8Z A;  2NSM A;  1LCP A;  2ZOG A;  3B3T A;  4K0C A;  4JLL A;  3SIH A;  5CB5 A;  2GLF A;  3WT4 A;  1UWY A;  2PJ1 A;  1BAV A;  1EE3 P;  3FEC A;  4TWE A;  2PJ7 A;  2ZED A;  4ZI6 A;  4EFD A;  1PYT B;  3K9T A;  1KWM A;  3PRT A;  3VH9 A;  2QYV A;  3CT9 A;  3IJ3 A;  4NGP A;  1ZG8 A;  3K2K A;  4IAV A;  4ABL A;  4KSI A;  4MHN A;  1SPV A;  3IIF A;  7CPA A;  3KR4 A;  3KZW A;  2V8H A;  3IID A;  2I3C A;  3SI2 A;  3IIB A;  1ZR3 A;  3SIJ A;  2ZEF A;  5D29 A;  4GVV A;  4TNU A;  4R7M A;  4ZYQ A;  4ETJ A;  4FWU A;  2GLJ A;  1F57 A;  2DX6 A;  2AFS A;  2ANP A;  2PE3 A;  1QMU A;  4GUA A;  4AXV A;  2RB7 A;  3D68 A;  2XEI A;  2RFH A;  1ELM P;  1PCA A;  1YW4 A;  3H8G A;  5HVG A;  1NJR A;  1R43 A;  2C6P A;  5FSV A;  1CX8 A;  5JM6 A;  1Q7L A;  2LGR A;  3LWU A;  1TY8 A;  1TKJ A;  4NGT A;  4JVV A;  1OBR A;  1F2P A;  4ETK A;  5FSU A;  1Y7E A;  3PFE A;  2QJ8 A;  1CG2 A;  3MN8 A;  4MHY A;  3B3C A;  1ARL A;  2G9D A;  2PIZ A;  2X47 A;  4X8I A;  2BOA A;  3GPO A;  3VAT A;  3KHZ A;  3NH5 A;  2OOT A;  4GVW A;  3T8W A;  3ISZ A;  3RAM A;  2POK A;  3KHX A;  4UF4 A;  1YME A;  5HXD A;  4NGQ A;  2JBK A;  4OC1 A;  5CPA A;  1M4L A;  5FSX A;  3VFQ A;  1ZLI A;  4H2K A;  2PJ2 A;  1VHO A;  1Y0R A;  5CB3 A;  1GYT A;  1VIX A;  3B35 A;  4R6T A;  3DLJ A;  3PB4 X;  1ARM A;  2BCO A;  4J5R A;  4F9V A;  5K8N A;  4J5S A;  4ABK A;  2PCU A;  3SII A;  2ZEH A;  4NGM A;  3D66 A;  4TU0 A;  3WC5 A;  4R76 A;  5LYF A;  3FVL A;  1TKH A;  1YD9 A;  2F8H A;  4WJB A;  4IQY A;  2CTB A;  5LRK A;  2V8G A;  3GPG A;  1XBU A;  2HC9 A;  2WYR A;  3D4U A;  4UML A;  5DUS A;  2QVP A;  2O53 A;  4EWT A;  2FG1 A;  1Z8L A;  2ZEP A;  1CP7 A;  2XEG A;  5IB9 A;  1ZR5 A;  4FAI A;  3JRU A;  3EWO A;  4GM5 A;  3BXM A;  2GU2 A;  5LYL A;  4MXU A;  2PJ8 A;  4JCA A;  4PPZ A;  3SJX A;  4PQA A;  1QQ9 A;  3D7H A;  4ZY1 A;  1AMP A;  3KAS A;  1Z5R A;  1RTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...