4ZX8A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 9b
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
519
structure length
519
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 174
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx8A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx8A02
1ZR5A 4A94A 2XD7A 1SPVA 1QMUA 4ABLA 3IFEA 3FECA 3IC1A 2PJBA 3EWPA 4MHYA 2QVPA 5D8NA 4ZY2A 4JVVA 4UEFA 1CP7A 4MXUA 3V7ZA 3LMSA 3IEHA 4UMLA 4FAIA 4ONWA 3FX6A 1ARMA 3SI0A 1UWYA 3GB0A 1OBRA 2JBJA 3D4UA 3KASA 2GLFA 3FH4A 1BPMA 4P6YA 5HVHA 1XRYA 4P4DA 4J5QA 2C6PA 2ZEGA 5D29A 1Z5RA 3ISZA 3H8GA 1IGBA 1YW4A 2C6CA 3D68A 2NSMA 2AFSA 4IQYA 3FJUA 4A37A 5THWA 2ABZA 1XFOA 5IB9A 3WC6A 1AMPA 5LYFA 2HC9A 4EWTA 3PBBA 2BCOA 2AFXA 4LQGA 5LYDA 2ZEMA 4OC4A 1VIXA 2L8RA 2BOAA 3Q6ZA 4R76A 4IK2A 2FVGA 2Q51A 3Q71A 3NFZA 5FSUA 3EWRA 2ACFA 3L2NA 2PJ4A 2BFQA 3ETIA 2WZNA 2GREA 4RUHA 5DUSA 4GVWA 3CPXA 5FSXA 3TX8A 2ZEOA 2AFMA 1YMEA 1CP6A 4MHZA 3BI1A 5JH9A 3B7IA 3GQEA 3NH4A 2GLJA 1QQ9A 4ZY0A 4ETKA 4OP4A 4GM5A 1YSJA 3EWQA 4EFDA 4ABKA 3B3SA 4JLLA 4MCPA 2PJ9A 3RAMA 1FT7A 5DS0A 5CMSA 2O4HA 3IIDA 2XEJA 1LCPA 1DE4C 1DTDA 2QJ8A 3GQOA 5J1QA 3I1UA 4IHMA 4Q7AA 5ELYA 3D7DA 4GVVA 4BD9A 4ETJA 2V77A 1HJZA 4JCAA 3JZTA 4NJRA 2PVWA 2DEAA 4J4ZA 1PCAA 2AFWA 2PIYA 5JGFA 5LRGA 3KQZA 2CTBA 2EK9A 2PRQA 4MHPA 2F7VA 4ZY1A 2ZEEA 1YW6A 4OC0A 5F09A 3SJFA 2I3CA 1BLLE 3TC8A 3KQXA 4TWEA 5FSVA 2ZELA 4X3RA 1AYEA 3CPAA 1R3NA 2CTCA 2PJ6A 3QNVA 3SI2A 4ZX8A 4NGQA 2DX6A 4TU0A 4P44A 4OC1A 3PB9X 1IY7A 5HOLA 4ZX9A 2LGRA 3PB7X 1VHOA 3SJXA 4J5SA 1XBUA 2PCUA 1CPSA 2C6GA 4P45A 3D7GA 3EJFA 4UEEA 2FAVA 5CB5A 1LFWA 3EWOA 3EJGA 3PB6X 4EMEA 1LOKA 4P4BA 1XJOA 3H8FA 3KL9A 3KHXA 4TNUA 4OKOA 1VGYA 2JBKA 5CPAA 3SJEA 4A38A 2ZEPA 4MCRA 2O53A 1CBXA 1CG2A 4D86A 2G9DA 4OC5A 3KZWA 5I4MA 2AFCA 4K3NA 5K8NA 1TXRA 3MN8A 5HIHA 3N5FA 3FEEA 3KR5A 2OR4A 1EE3P 2V8VA 6CPAA 3WC5A 7CPAA 4DUKA 5FSZA 3KGQA 4PXEA 5LYLA 3GPQA 4P4FA 3DGVA 1CPXA 2V8HA 2PJ0A 1ELMP 1M4LA 2FG1A 4MCQA 2XEFA 4JZ0A 4FWUA 3B3TA 2IMOA 3PB8X 5K8OA 1GYTA 3SI1A 3B35A 4O23A 4F8ZA 1ELLP 3NH8A 4UIAA 3FMCA 5CBMA 2RB7A 4G1PA 2BFRA 3SIHA 1F57A 3NA6A 1ARLA 3B3VA 1Z2LA 5JM6A 1LANA 3VH9A 4NGMA 3B3WA 4WWVA 4J5RA 1TY8A 1JQGA 3SIGA 2WYRA 3JRUA 4ESSA 4NJQA 4YWYA 2PJCA 2PVVA 5LYIA 4NGTA 4DYOA 4PQAA 2FXKA 2JEWA 3FF3A 5FSYA 1Y0YA 4MHNA 4OIWA 5LRJA 2PIZA 1ZLHA 4W9YA 4YU9A 5K8PA 2POKA 4OC3A 3WABA 3ISXA 4A39A 4UEZA 3VATA 3EKEA 2J9AA 2CF4A 1Y7EA 1FNOA 1TKJA 1RTQA 2PE3A 3IWWA 4PXCA 3V38A 3D7FA 3CT9A 4K0CA 2VL1A 4PPZA 3BXMA 1KWMA 2AFUA 1Q7LA 5HXDA 2ZOFA 4P10A 4OMEA 2PJ2A 3FEDA 3SIJA 4MRIA 2PJ7A 1TXZA 3VFQA 4KSIA 3GLJA 3KI9A 2Q43A 5E3BA 3LWUA 4R8FA 2PJ5A 3HLPA 4R7MA 1ZG8A 2AFOA 3NH5A 2QYVA 2EK8A 2Q4ZA 4CPAA 2ZENA 2IQ6A 2PJAA 1TKFA 2V8DA 3VARA 4JGKA 1F2OA 2CIJA 1LAMA 1CX8A 3K9TA 1ZG9A 4R6TA 1HDUA 3WT4A 4JYWA 2EWBA 1R43A 3V2BA 2IJZA 2EEEA 3D66A 3CDXA 4Z65A 3K2KA 4KYBA 1TF8A 1TF9A 3BI0A 5CB3A 4PXBA 3GPGA 2BO9A 2PJ1A 1ZLIA 3BHXA 4OIDA 2F8HA 5K8MA 4NGSA 4B6ZA 4NGRA 4FBEA 3T8WA 1YD9A 1NJRA 1HEEA 1NSAA 3DLJA 4P4JA 8CPAA 2VRIA 2V8GA 3SIIA 3H8EA 1YLOA 3GPOA 3HUVA 1HDQA 3IO1A 3PEIA 4ZYQA 4PXDA 3PFEA 3FVLA 4P4EA 1Y0RA 2NYQA 4FUUA 3V45A 3RZAA 3KHZA 2ANPA 4H2KA 4NFRA 1PYTB 3EW5A 2C1CA 3IJ3A 5HVGA 3KR4A 4MCSA 5HVFA 2XEIA 3S9LA 2PJ8A 3GUXA 3D7HA 3B2YA 4WJBA 3PB4X 3SJGA 3WC7A 3IIFA 4X8IA 1F2PA 1XMBA 2ZEDA 3S9NA 2AFZA 4IAVA 2HB6A 4ZI6A 2GU2A 2XEGA 5LRKA 4OC2A 4F9UA 3PFOA 2OOTA 4GUAA 4NGPA 4F9VA 1H8LA 4MMOA 1LAPA 3PBEA 2PJ3A 5AILA 2ZEHA 2RFHA 1ZG7A 2ZOGA 4X2TA 4AXVA 4UIBA 1ZR3A 1VHUA 3D67A 1BAVA 3PRTA 3S9MA 3RBUA 2ZEFA 1VHEA 3IIBA 4DJLA 3MRUA 4UF4A 3B3CA 1BPNA 1TKHA 2X47A 1Z8LA 4P4IA 4NGNA
chains in the Genus database with same CATH superfamily
4U9ZA 5EBVA 4A2ZA 4KOUA 1ZR5A 4A94A 2XD7A 1SPVA 1QMUA 2REEA 4NF1A 2G3TA 2R98A 4ABLA 2NMTA 1GHEA 3FECA 3IC1A 3IFEA 1LRZA 5G21A 3S6KA 2PJBA 3EWPA 4C2XA 4E8OA 1L0CA 4MHYA 5J8FA 2QVPA 5D8NA 4ZY2A 2WCTA 1NMTA 2IL4A 1UFHA 1IOFA 2R7HA 1XMTA 5GCNA 5A27A 2FE7A 4A30A 4JVVA 4UEFA 1CP7A 4UBRA 4KVXA 1P0HA 1KUYA 4MXUA 3V7ZA 3LMSA 4YRHA 3IEHA 4UMLA 4PSXA 4MBUA 4ONWA 3FX6A 2CXAA 1ARMA 3SI0A 5EMIA 1UWYA 3TOAA 4FAIA 2OZGA 3TTHA 3GB0A 1OBRA 2JBJA 3D4UA 3KASA 3TO9A 2GLFA 3VWDA 3FH4A 1BPMA 4C7HA 4P6YA 3VWEA 4A95A 5HVHA 1XRYA 1KUXA 4P4DA 1MJ9A 2ZXVA 3D3SA 4J5QA 1B87A 2C6PA 2PRBA 2VZZA 2ZEGA 2ARHA 4H6ZA 2B4DB 2Z11A 3W91A 3CXPA 4JLYA 1Z5RA 3ISZA 2KCWA 3H8GA 1IGBA 5D29A 5I0CA 3G3SA 1YW4A 1IIDA 2C6CA 3D68A 4A33A 5AG6A 2NSMA 2AFSA 4IQYA 3T9YA 4I49A 5E96A 3FJUA 3PP9A 4NXYA 2FS5A 1FY7A 4A37A 5THWA 2ABZA 1XFOA 4C68A 5IB9A 1XE4A 2GANA 3JTKA 3WC6A 1AMPA 1IYLA 3SXNA 5F46A 1WK4A 2G0BA 5JPHA 4Y49B 5LYFA 2HC9A 4EWTA 3PBBA 2BCOA 2AFXA 4LQGA 5LYDA 2ZEMA 1VKCA 1N71A 4OC4A 4JD6A 1VIXA 2L8RA 2BOAA 3I3GA 3Q6ZA 4R76A 2B3VA 2BSWA 4IK2A 4M85A 2FVGA 2Q51A 4JWPA 3Q71A 3NFZA 4E0AA 5H86A 2JDDA 5FSUA 3EWRA 4CGPA 4KS9A 2ACFA 3TOBA 3L2NA 1KZFA 2H5MA 2PJ4A 2BFQA 3ETIA 2WZNA 2GREA 4MFZA 5CNPA 4BBHA 4RUHA 5DUSA 4GVWA 3CPXA 5FSXA 3TX8A 2ZEOA 2AFMA 4RI1A 4QC6A 4BINA 1YMEA 1CP6A 4CYOA 4FD4A 4MHZA 4R57A 1XIXA 5EC4A 3BI1A 5JH9A 5KTCA 2Z3KA 3B7IA 3GQEA 3NH4A 2GLJA 1YQEA 5AGEA 1QQ9A 4ZY0A 3QAYA 4ETKA 4OP4A 4GM5A 1YSJA 3E0KA 3EWQA 2P6FA 4EFDA 4FD5A 4HPSA 3R9FA 4ABKA 4GXHA 1M4DA 3B3SA 3G8WA 4KLWA 4CYPA 4JLLA 4M6IA 2OH1A 2Q7BA 4M6HA 4MCPA 2G3AA 2PJ9A 3RAMA 1FT7A 4MFJA 5DS0A 5CMSA 1Q2CA 4CAEA 2O4HA 4PK3A 3IIDA 2XEJA 1LCPA 1S60A 1DE4C 2WSAA 2VBQA 1DTDA 2QJ8A 2YNEA 1XOVA 3GQOA 5J1QA 3I1UA 4IHMA 2I79A 2PQ8A 4Q7AA 4R3LA 4MFKA 2GIVA 5ELYA 3SHPA 4YFJA 2ODFA 3D7DA 2EVNA 4GVVA 2X7BA 4BD9A 3IGRA 2F5IA 3D2MA 3IWEA 2Y0MA 5IX3A 4ETJA 2V77A 1HJZA 4JCAA 2YGWA 3JZTA 4NJRA 4KLVA 2PVWA 2RC4A 4C2ZA 2DEAA 1S7NA 4ZBGA 3TO7A 4HNYB 4LUAA 4J4ZA 2JDCA 4UWJA 2BL1A 1PCAA 2AFWA 4UFXA 4A31A 1ZO0A 2PIYA 1Z4RA 3F8KA 3NE8A 3FXTA 5JGFA 5LRGA 4AB7A 4XNHB 1WWZA 3KQZA 2CTBA 4XNHC 3CZXA 4B13A 3CXQA 4J3GA 2EK9A 5AG4A 1X12A 4CAWA 4UCNA 1IOIA 2PRQA 4MHPA 3ZZIA 2F7VA 4ZY1A 2ZEEA 3C26A 1YW6A 3H4QA 4L8AA 1Z8TA 1YK3A 4OC0A 5F09A 4P4IA 5AG7A 4II9A 1RO5A 3GY9A 3SJFA 2I3CA 4B12A 3T90A 5ISVA 3P2FA 4HNXB 1BLLE 3TC8A 3EXNA 3KQXA 4TWEA 5FSVA 2ZELA 3FIXA 4UFWA 3DR6A 4AVCA 4CAXA 4X3RA 2Q4VA 4NEXA 1AYEA 2AJ6A 2Q0YA 3CPAA 1R3NA 2CTCA 2PJ6A 3D8PA 3IU2A 4B11A 2CY2A 4B5OA 2FXFA 3QNVA 3SI2A 4ZX8A 3B8GA 4NGQA 2DX6A 4TU0A 1Q2YA 4P44A 5G22A 1Y7RA 4OC1A 4H89A 3BJ8A 4IUSA 3PB9X 3LD2A 5F47A 5J8CA 1BO4A 1IY7A 5HOLA 4KSFA 4K30A 1TIQA 4ZX9A 3PGPA 5G20A 3S6GA 2LGRA 3PB7X 1VHOA 4B10A 4HKFA 2A4NA 3SJXA 4J5SA 4FD7A 1XBUA 4OAEA 2PCUA 5FVJA 2ZPAA 1CPSA 2C6GA 2Z0ZA 1RXTA 1QSTA 1BOBA 2BUEA 3EJFA 3D7GA 4P45A 2FAVA 4UEEA 4CYNA 5CB5A 4KOYA 4CGMA 1LFWA 4H6UA 3EWOA 3EJGA 2R1IA 1YGHA 2GE3A 1QSNA 4Y49C 3PB6X 1R57A 4EMEA 1K4JA 1J4JA 1LOKA 4P4BA 1XJOA 3RO0A 2VQYA 3IWGA 3H8FA 4CRYB 3KL9A 3KHXA 4MY3A 4TNUA 4OKOA 1VGYA 4QB9A 4OADA 2JBKA 5CPAA 3SJEA 4A38A 2OB0A 2YNDA 2ZEPA 4MCRA 4C2YA 2O53A 5KTAA 1CBXA 1CG2A 1Z4EA 4QVTA 2B3UA 1Z9UA 4D86A 1CM0A 2G9DA 4JXRA 4OC5A 3KZWA 2EBJA 5A28A 5I4MA 3NE7A 1YLEA 2AFCA 4K3NA 3EY5A 5K8NA 1TXRA 3MN8A 5HIHA 3RYOA 2R8VA 3N5FA 1Y9WA 2OZHA 3H5ZA 4B14A 3FEEA 4DNCA 3D2PA 2YNCA 1M44A 1ON0A 1YX0A 4C7IA 3KR5A 2OR4A 4XPKA 3A9LA 1EE3P 2V8VA 4MJ8A 3WC5A 5C82A 6CPAA 2Q7SA 7CPAA 4DUKA 5FSZA 3KGQA 4PXEA 5LYLA 3GPQA 4P4FA 3DGVA 2JEVA 4KUBA 1CPXA 2V8HA 2PJ0A 1ELMP 1M4LA 1SQHA 2FG1A 4MCQA 2XEFA 3EFAA 4JZ0A 4FWUA 4KOXA 3B3TA 1VHSA 2IMOA 4XPLA 3PB8X 2EO8A 5K8OA 4CAVA 1GYTA 2FIAA 3K9UA 3B35A 3FB3A 4O23A 2D4OA 3SI1A 4F8ZA 1ELLP 4RN7A 4UWIA 2CNSA 2O28A 3NH8A 2Z3MA 4UIAA 3FMCA 1S3ZA 5CBMA 2RB7A 2Z3OA 1YREA 4Q38A 4G1PA 2BFRA 3SIHA 1F57A 3GIUA 4KUAA 3NA6A 1ARLA 4M6GA 3B3VA 1Z2LA 5JM6A 1LANA 3KKWA 3VH9A 5BWAB 4NGMA 3B3WA 4MHDA 2PR8A 4WWVA 1M4GA 4J5RA 1A2ZA 3EO4A 1TY8A 2BEIA 2Z3PA 1JQGA 4NCZA 3SIGA 2WYRA 3JRUA 4F0YA 4ESSA 4NJQA 4YWYA 2PJCA 2PVVA 5LYIA 4NGTA 4DYOA 4JJXA 4PQAA 3BLNA 2FXKA 2JEWA 2JZDA 2DXQA 2P6EA 5FSYA 1V0CA 3FF3A 4KOTA 1Y0YA 4MHNA 4OIWA 4QUSA 5LRJA 2B4DA 2PIZA 1ZLHA 3S6HA 1KUVA 4KVOE 4W9YA 4YU9A 3WR7A 1Y9KA 4LQ6A 2CNMA 5K8PA 3UY5A 4B5PA 2POKA 4OC3A 3WABA 3IU1A 3FYNA 3RNZA 4R87A 1YR0A 2J8RA 3ISXA 2PC1A 4A39A 4CYQA 4UEZA 3VATA 5HMNA 3EKEA 2J9AA 2ATRA 1PU9A 2CF4A 1Y7EA 1FNOA 1S7FA 2DF5A 1TKJA 3PZJA 1RTQA 3CXSA 5H84A 2PR1A 2PE3A 2QMLA 3BJ7A 4L89A 4CAFA 3IWWA 4HNWB 2Z3NA 3D7FA 3CT9A 4PXCA 4YGOA 3V38A 4K0CA 2VL1A 4Q36A 1QSRA 1I21A 2QIRA 3QB8A 4PPZA 2PSWA 2VXKA 2HV2A 2J8NA 3BXMA 4AVAA 5DWNA 1KWMA 2AFUA 3TFYA 3LODA 1Q7LA 5HXDA 2ZOFA 4P10A 4OMEA 2PJ2A 3FEDA 3SIJA 4CS0B 2DPTA 4MRIA 2PJ7A 1TXZA 3VFQA 4KSIA 3GLJA 2B5GA 3KI9A 2Q43A 5E3BA 1MJBA 3LWUA 4GS4A 4PV6A 2P0WA 4R8FA 2PJ5A 4A32A 1QSOA 2ZW7A 3HLPA 4R7MA 4U5YA 1XF8A 1ZG8A 2DPSA 5IV0A 2AFOA 4MFPA 3NH5A 2QYVA 2EK8A 2ZW5A 2Q4ZA 4CPAA 2ZENA 4JXQA 4PSWA 4PK2A 2IQ6A 2PJAA 1TKFA 2V8DA 2Z3LA 3VARA 4JGKA 1F2OA 2CIJA 1LAMA 1S7LA 1CX8A 3K9TA 2W2GA 1ZG9A 2FCKA 4R6TA 1HDUA 1OZPA 4KOSA 4KOWA 4JYWA 4UFVA 3WT4A 4CRZB 3DR8A 2EWBA 2WPXA 1R43A 4FD6A 4MFLA 1Q2DA 2I00A 3FNCA 3V2BA 2IJZA 2EEEA 1IYKA 1IB1E 2D4PA 3D66A 5KTDA 3LACA 5F49A 3CDXA 3SXOA 4AVBA 3TO6A 5DWMA 4Z65A 3FBUA 3K2KA 4KYBA 1TF8A 1TF9A 2WUUA 3BI0A 4F6AA 5CB3A 4PXBA 3GPGA 2BO9A 2PJ1A 3N7ZA 3F5BA 3QAHA 2VI7A 4BMHA 4B5PB 1IU8A 1JWQA 1I1DA 1ZLIA 2C27A 5HH1A 3BHXA 2JZFA 4OIDA 2F8HA 3F0AA 4R9MA 5K8MA 4NGSA 4UCMA 4B6ZA 4NGRA 3TCVA 1MK4A 3ZJ0A 2QECA 4FBEA 3T8WA 1YD9A 1NJRA 1HEEA 1NSAA 2PDOA 3DLJA 4P4JA 1Z8XA 2VRIA 2V8GA 8CPAA 2Q04A 2JZEA 3H8EA 3SIIA 3R96A 5IB0A 1YLOA 3GPOA 3HUVA 5JQ4A 1HDQA 3IO1A 3PEIA 4ZYQA 2HUZA 3GYAA 3PFEA 3DNSA 3FVLA 2AE6A 4PXDA 4P4EA 4CGOA 1Y0RA 2FSRA 2NYQA 3OWCA 3V45A 4FUUA 3RZAA 1YVOA 3R9GA 2B58A 4F0XA 3KHZA 2ANPA 4QBJA 4H2KA 2OU2A 1NE9A 4MFQA 1PYTB 4NFRA 2REFA 3EW5A 1P4NA 4NSQA 2CNTA 1MJAA 1XEBA 2FIWA 1B6BA 2C1CA 3R1KA 4MY0A 3IJ3A 5HVGA 2B5GB 3KR4A 4MCSA 1Z8WA 5HVFA 2HQYA 2XEIA 1S5KA 4KORA 3S9LA 2PJ8A 3GUXA 3D7HA 4KSAA 4MI4A 2KQVA 3B2YA 3W6SA 4WJBA 5F48A 2FL4A 2Q4YA 3PB4X 3SJGA 3WC7A 3IIFA 2Q44A 1F2PA 1PUAA 4X8IA 1M1DA 1XMBA 1X10A 4UCPA 3R95A 3W6XA 5C88A 2JLMA 2ZEDA 2RNKA 3S9NA 1AUGA 2AFZA 4KVME 4IAVA 2HB6A 3JVNA 4CGNA 4U9YA 4ZI6A 1YVKA 2GU2A 2XEGA 5LRKA 1QSMA 4RS2A 1CJWA 3EC4A 1M4IA 1S7KA 4ONUA 2VZYA 4OC2A 4F9UA 3PFOA 1I12A 2B4BA 2K5TA 3R9EA 2GFQA 4KZTA 2OOTA 3V8IA 2OZUA 3MGDA 2J8MA 4GUAA 4NGPA 4F9VA 1H8LA 2VEZA 4MMOA 1LAPA 3PBEA 3S6FA 2PJ3A 5AILA 4CGLA 2Z10A 4KOVA 4XPDB 4X5KA 4XPDC 4ZGYB 1NSLA 3DDDA 2ZEHA 2RFHA 2FT0A 1ZG7A 3P2HA 4EVYA 2ZOGA 3DSBA 3I9SA 4R3KA 4AG9A 4ORFA 4X2TA 2WPWA 4OLLA 4UIBA 4AXVA 1ZR3A 4M3SA 4IF5A 1VHUA 3D67A 1BAVA 3PRTA 3S9MA 5G1ZA 3RBUA 2ZEFA 1U6MA 1VHEA 4AG7A 2YNCC 3IIBA 3JUWA 4UA3A 4DJLA 3MRUA 2P6GA 2ZW6A 1IICA 3FRMA 3GKRA 4UF4A 3B3CA 3TE4A 3TT2A 2EUIA 2ZW4A 1BPNA 1TKHA 2X47A 1Z8LA 4LX9A 5AG5A 4NGNA 4E2AA
chains in the Genus database with same CATH topology
1ZR5A 4A94A 2XD7A 1SPVA 1QMUA 4ABLA 3IFEA 3FECA 3IC1A 2PJBA 3EWPA 4MHYA 2QVPA 5D8NA 4ZY2A 4JVVA 4UEFA 1CP7A 4MXUA 3V7ZA 3LMSA 3IEHA 4UMLA 4FAIA 4ONWA 3FX6A 1ARMA 3SI0A 1UWYA 3GB0A 1OBRA 2JBJA 3D4UA 3KASA 2GLFA 3FH4A 1BPMA 4P6YA 5HVHA 1XRYA 4P4DA 4J5QA 2C6PA 2ZEGA 5D29A 1Z5RA 3ISZA 3H8GA 1IGBA 1YW4A 2C6CA 3D68A 2NSMA 2AFSA 4IQYA 3FJUA 4A37A 5THWA 2ABZA 1XFOA 5IB9A 3WC6A 1AMPA 5LYFA 2HC9A 4EWTA 3PBBA 2BCOA 2AFXA 4LQGA 5LYDA 2ZEMA 4OC4A 1VIXA 2L8RA 2BOAA 3Q6ZA 4R76A 4IK2A 2FVGA 2Q51A 3Q71A 3NFZA 5FSUA 3EWRA 2ACFA 3L2NA 2PJ4A 2BFQA 3ETIA 2WZNA 2GREA 4RUHA 5DUSA 4GVWA 3CPXA 5FSXA 3TX8A 2ZEOA 2AFMA 1YMEA 1CP6A 4MHZA 3BI1A 5JH9A 3B7IA 3GQEA 3NH4A 2GLJA 1QQ9A 4ZY0A 4ETKA 4OP4A 4GM5A 1YSJA 3EWQA 4EFDA 4ABKA 3B3SA 4JLLA 4MCPA 2PJ9A 3RAMA 1FT7A 5DS0A 5CMSA 2O4HA 3IIDA 2XEJA 1LCPA 1DE4C 1DTDA 2QJ8A 3GQOA 5J1QA 3I1UA 4IHMA 4Q7AA 5ELYA 3D7DA 4GVVA 4BD9A 4ETJA 2V77A 1HJZA 4JCAA 3JZTA 4NJRA 2PVWA 2DEAA 4J4ZA 1PCAA 2AFWA 2PIYA 5JGFA 5LRGA 3KQZA 2CTBA 2EK9A 2PRQA 4MHPA 2F7VA 4ZY1A 2ZEEA 1YW6A 4OC0A 5F09A 3SJFA 2I3CA 1BLLE 3TC8A 3KQXA 4TWEA 5FSVA 2ZELA 4X3RA 1AYEA 3CPAA 1R3NA 2CTCA 2PJ6A 3QNVA 3SI2A 4ZX8A 4NGQA 2DX6A 4TU0A 4P44A 4OC1A 3PB9X 1IY7A 5HOLA 4ZX9A 2LGRA 3PB7X 1VHOA 3SJXA 4J5SA 1XBUA 2PCUA 1CPSA 2C6GA 4P45A 3D7GA 3EJFA 4UEEA 2FAVA 5CB5A 1LFWA 3EWOA 3EJGA 3PB6X 4EMEA 1LOKA 4P4BA 1XJOA 3H8FA 3KL9A 3KHXA 4TNUA 4OKOA 1VGYA 2JBKA 5CPAA 3SJEA 4A38A 2ZEPA 4MCRA 2O53A 1CBXA 1CG2A 4D86A 2G9DA 4OC5A 3KZWA 5I4MA 2AFCA 4K3NA 5K8NA 1TXRA 3MN8A 5HIHA 3N5FA 3FEEA 3KR5A 2OR4A 1EE3P 2V8VA 6CPAA 3WC5A 7CPAA 4DUKA 5FSZA 3KGQA 4PXEA 5LYLA 3GPQA 4P4FA 3DGVA 1CPXA 2V8HA 2PJ0A 1ELMP 1M4LA 2FG1A 4MCQA 2XEFA 4JZ0A 4FWUA 3B3TA 2IMOA 3PB8X 5K8OA 1GYTA 3SI1A 3B35A 4O23A 4F8ZA 1ELLP 3NH8A 4UIAA 3FMCA 5CBMA 2RB7A 4G1PA 2BFRA 3SIHA 1F57A 3NA6A 1ARLA 3B3VA 1Z2LA 5JM6A 1LANA 3VH9A 4NGMA 3B3WA 4WWVA 4J5RA 1TY8A 1JQGA 3SIGA 2WYRA 3JRUA 4ESSA 4NJQA 4YWYA 2PJCA 2PVVA 5LYIA 4NGTA 4DYOA 4PQAA 2FXKA 2JEWA 3FF3A 5FSYA 1Y0YA 4MHNA 4OIWA 5LRJA 2PIZA 1ZLHA 4W9YA 4YU9A 5K8PA 2POKA 4OC3A 3WABA 3ISXA 4A39A 4UEZA 3VATA 3EKEA 2J9AA 2CF4A 1Y7EA 1FNOA 1TKJA 1RTQA 2PE3A 3IWWA 4PXCA 3V38A 3D7FA 3CT9A 4K0CA 2VL1A 4PPZA 3BXMA 1KWMA 2AFUA 1Q7LA 5HXDA 2ZOFA 4P10A 4OMEA 2PJ2A 3FEDA 3SIJA 4MRIA 2PJ7A 1TXZA 3VFQA 4KSIA 3GLJA 3KI9A 2Q43A 5E3BA 3LWUA 4R8FA 2PJ5A 3HLPA 4R7MA 1ZG8A 2AFOA 3NH5A 2QYVA 2EK8A 2Q4ZA 4CPAA 2ZENA 2IQ6A 2PJAA 1TKFA 2V8DA 3VARA 4JGKA 1F2OA 2CIJA 1LAMA 1CX8A 3K9TA 1ZG9A 4R6TA 1HDUA 3WT4A 4JYWA 2EWBA 1R43A 3V2BA 2IJZA 2EEEA 3D66A 3CDXA 4Z65A 3K2KA 4KYBA 1TF8A 1TF9A 3BI0A 5CB3A 4PXBA 3GPGA 2BO9A 2PJ1A 1ZLIA 3BHXA 4OIDA 2F8HA 5K8MA 4NGSA 4B6ZA 4NGRA 4FBEA 3T8WA 1YD9A 1NJRA 1HEEA 1NSAA 3DLJA 4P4JA 8CPAA 2VRIA 2V8GA 3SIIA 3H8EA 1YLOA 3GPOA 3HUVA 1HDQA 3IO1A 3PEIA 4ZYQA 4PXDA 3PFEA 3FVLA 4P4EA 1Y0RA 2NYQA 4FUUA 3V45A 3RZAA 3KHZA 2ANPA 4H2KA 4NFRA 1PYTB 3EW5A 2C1CA 3IJ3A 5HVGA 3KR4A 4MCSA 5HVFA 2XEIA 3S9LA 2PJ8A 3GUXA 3D7HA 3B2YA 4WJBA 3PB4X 3SJGA 3WC7A 3IIFA 4X8IA 1F2PA 1XMBA 2ZEDA 3S9NA 2AFZA 4IAVA 2HB6A 4ZI6A 2GU2A 2XEGA 5LRKA 4OC2A 4F9UA 3PFOA 2OOTA 4GUAA 4NGPA 4F9VA 1H8LA 4MMOA 1LAPA 3PBEA 2PJ3A 5AILA 2ZEHA 2RFHA 1ZG7A 2ZOGA 4X2TA 4AXVA 4UIBA 1ZR3A 1VHUA 3D67A 1BAVA 3PRTA 3S9MA 3RBUA 2ZEFA 1VHEA 3IIBA 4DJLA 3MRUA 4UF4A 3B3CA 1BPNA 1TKHA 2X47A 1Z8LA 4P4IA 4NGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR5 A;  4A94 A;  2XD7 A;  1SPV A;  1QMU A;  4ABL A;  3IFE A;  3FEC A;  3IC1 A;  2PJB A;  3EWP A;  4MHY A;  2QVP A;  5D8N A;  4ZY2 A;  4JVV A;  4UEF A;  1CP7 A;  4MXU A;  3V7Z A;  3LMS A;  3IEH A;  4UML A;  4FAI A;  4ONW A;  3FX6 A;  1ARM A;  3SI0 A;  1UWY A;  3GB0 A;  1OBR A;  2JBJ A;  3D4U A;  3KAS A;  2GLF A;  3FH4 A;  1BPM A;  4P6Y A;  5HVH A;  1XRY A;  4P4D A;  4J5Q A;  2C6P A;  2ZEG A;  5D29 A;  1Z5R A;  3ISZ A;  3H8G A;  1IGB A;  1YW4 A;  2C6C A;  3D68 A;  2NSM A;  2AFS A;  4IQY A;  3FJU A;  4A37 A;  5THW A;  2ABZ A;  1XFO A;  5IB9 A;  3WC6 A;  1AMP A;  5LYF A;  2HC9 A;  4EWT A;  3PBB A;  2BCO A;  2AFX A;  4LQG A;  5LYD A;  2ZEM A;  4OC4 A;  1VIX A;  2L8R A;  2BOA A;  3Q6Z A;  4R76 A;  4IK2 A;  2FVG A;  2Q51 A;  3Q71 A;  3NFZ A;  5FSU A;  3EWR A;  2ACF A;  3L2N A;  2PJ4 A;  2BFQ A;  3ETI A;  2WZN A;  2GRE A;  4RUH A;  5DUS A;  4GVW A;  3CPX A;  5FSX A;  3TX8 A;  2ZEO A;  2AFM A;  1YME A;  1CP6 A;  4MHZ A;  3BI1 A;  5JH9 A;  3B7I A;  3GQE A;  3NH4 A;  2GLJ A;  1QQ9 A;  4ZY0 A;  4ETK A;  4OP4 A;  4GM5 A;  1YSJ A;  3EWQ A;  4EFD A;  4ABK A;  3B3S A;  4JLL A;  4MCP A;  2PJ9 A;  3RAM A;  1FT7 A;  5DS0 A;  5CMS A;  2O4H A;  3IID A;  2XEJ A;  1LCP A;  1DE4 C;  1DTD A;  2QJ8 A;  3GQO A;  5J1Q A;  3I1U A;  4IHM A;  4Q7A A;  5ELY A;  3D7D A;  4GVV A;  4BD9 A;  4ETJ A;  2V77 A;  1HJZ A;  4JCA A;  3JZT A;  4NJR A;  2PVW A;  2DEA A;  4J4Z A;  1PCA A;  2AFW A;  2PIY A;  5JGF A;  5LRG A;  3KQZ A;  2CTB A;  2EK9 A;  2PRQ A;  4MHP A;  2F7V A;  4ZY1 A;  2ZEE A;  1YW6 A;  4OC0 A;  5F09 A;  3SJF A;  2I3C A;  1BLL E;  3TC8 A;  3KQX A;  4TWE A;  5FSV A;  2ZEL A;  4X3R A;  1AYE A;  3CPA A;  1R3N A;  2CTC A;  2PJ6 A;  3QNV A;  3SI2 A;  4ZX8 A;  4NGQ A;  2DX6 A;  4TU0 A;  4P44 A;  4OC1 A;  3PB9 X;  1IY7 A;  5HOL A;  4ZX9 A;  2LGR A;  3PB7 X;  1VHO A;  3SJX A;  4J5S A;  1XBU A;  2PCU A;  1CPS A;  2C6G A;  4P45 A;  3D7G A;  3EJF A;  4UEE A;  2FAV A;  5CB5 A;  1LFW A;  3EWO A;  3EJG A;  3PB6 X;  4EME A;  1LOK A;  4P4B A;  1XJO A;  3H8F A;  3KL9 A;  3KHX A;  4TNU A;  4OKO A;  1VGY A;  2JBK A;  5CPA A;  3SJE A;  4A38 A;  2ZEP A;  4MCR A;  2O53 A;  1CBX A;  1CG2 A;  4D86 A;  2G9D A;  4OC5 A;  3KZW A;  5I4M A;  2AFC A;  4K3N A;  5K8N A;  1TXR A;  3MN8 A;  5HIH A;  3N5F A;  3FEE A;  3KR5 A;  2OR4 A;  1EE3 P;  2V8V A;  6CPA A;  3WC5 A;  7CPA A;  4DUK A;  5FSZ A;  3KGQ A;  4PXE A;  5LYL A;  3GPQ A;  4P4F A;  3DGV A;  1CPX A;  2V8H A;  2PJ0 A;  1ELM P;  1M4L A;  2FG1 A;  4MCQ A;  2XEF A;  4JZ0 A;  4FWU A;  3B3T A;  2IMO A;  3PB8 X;  5K8O A;  1GYT A;  3SI1 A;  3B35 A;  4O23 A;  4F8Z A;  1ELL P;  3NH8 A;  4UIA A;  3FMC A;  5CBM A;  2RB7 A;  4G1P A;  2BFR A;  3SIH A;  1F57 A;  3NA6 A;  1ARL A;  3B3V A;  1Z2L A;  5JM6 A;  1LAN A;  3VH9 A;  4NGM A;  3B3W A;  4WWV A;  4J5R A;  1TY8 A;  1JQG A;  3SIG A;  2WYR A;  3JRU A;  4ESS A;  4NJQ A;  4YWY A;  2PJC A;  2PVV A;  5LYI A;  4NGT A;  4DYO A;  4PQA A;  2FXK A;  2JEW A;  3FF3 A;  5FSY A;  1Y0Y A;  4MHN A;  4OIW A;  5LRJ A;  2PIZ A;  1ZLH A;  4W9Y A;  4YU9 A;  5K8P A;  2POK A;  4OC3 A;  3WAB A;  3ISX A;  4A39 A;  4UEZ A;  3VAT A;  3EKE A;  2J9A A;  2CF4 A;  1Y7E A;  1FNO A;  1TKJ A;  1RTQ A;  2PE3 A;  3IWW A;  4PXC A;  3V38 A;  3D7F A;  3CT9 A;  4K0C A;  2VL1 A;  4PPZ A;  3BXM A;  1KWM A;  2AFU A;  1Q7L A;  5HXD A;  2ZOF A;  4P10 A;  4OME A;  2PJ2 A;  3FED A;  3SIJ A;  4MRI A;  2PJ7 A;  1TXZ A;  3VFQ A;  4KSI A;  3GLJ A;  3KI9 A;  2Q43 A;  5E3B A;  3LWU A;  4R8F A;  2PJ5 A;  3HLP A;  4R7M A;  1ZG8 A;  2AFO A;  3NH5 A;  2QYV A;  2EK8 A;  2Q4Z A;  4CPA A;  2ZEN A;  2IQ6 A;  2PJA A;  1TKF A;  2V8D A;  3VAR A;  4JGK A;  1F2O A;  2CIJ A;  1LAM A;  1CX8 A;  3K9T A;  1ZG9 A;  4R6T A;  1HDU A;  3WT4 A;  4JYW A;  2EWB A;  1R43 A;  3V2B A;  2IJZ A;  2EEE A;  3D66 A;  3CDX A;  4Z65 A;  3K2K A;  4KYB A;  1TF8 A;  1TF9 A;  3BI0 A;  5CB3 A;  4PXB A;  3GPG A;  2BO9 A;  2PJ1 A;  1ZLI A;  3BHX A;  4OID A;  2F8H A;  5K8M A;  4NGS A;  4B6Z A;  4NGR A;  4FBE A;  3T8W A;  1YD9 A;  1NJR A;  1HEE A;  1NSA A;  3DLJ A;  4P4J A;  8CPA A;  2VRI A;  2V8G A;  3SII A;  3H8E A;  1YLO A;  3GPO A;  3HUV A;  1HDQ A;  3IO1 A;  3PEI A;  4ZYQ A;  4PXD A;  3PFE A;  3FVL A;  4P4E A;  1Y0R A;  2NYQ A;  4FUU A;  3V45 A;  3RZA A;  3KHZ A;  2ANP A;  4H2K A;  4NFR A;  1PYT B;  3EW5 A;  2C1C A;  3IJ3 A;  5HVG A;  3KR4 A;  4MCS A;  5HVF A;  2XEI A;  3S9L A;  2PJ8 A;  3GUX A;  3D7H A;  3B2Y A;  4WJB A;  3PB4 X;  3SJG A;  3WC7 A;  3IIF A;  4X8I A;  1F2P A;  1XMB A;  2ZED A;  3S9N A;  2AFZ A;  4IAV A;  2HB6 A;  4ZI6 A;  2GU2 A;  2XEG A;  5LRK A;  4OC2 A;  4F9U A;  3PFO A;  2OOT A;  4GUA A;  4NGP A;  4F9V A;  1H8L A;  4MMO A;  1LAP A;  3PBE A;  2PJ3 A;  5AIL A;  2ZEH A;  2RFH A;  1ZG7 A;  2ZOG A;  4X2T A;  4AXV A;  4UIB A;  1ZR3 A;  1VHU A;  3D67 A;  1BAV A;  3PRT A;  3S9M A;  3RBU A;  2ZEF A;  1VHE A;  3IIB A;  4DJL A;  3MRU A;  4UF4 A;  3B3C A;  1BPN A;  1TKH A;  2X47 A;  1Z8L A;  4P4I A;  4NGN A; 
#chains in the Genus database with same CATH topology
 4U9Z A;  5EBV A;  4A2Z A;  4KOU A;  1ZR5 A;  4A94 A;  2XD7 A;  1SPV A;  1QMU A;  2REE A;  4NF1 A;  2G3T A;  2R98 A;  4ABL A;  2NMT A;  1GHE A;  3FEC A;  3IC1 A;  3IFE A;  1LRZ A;  5G21 A;  3S6K A;  2PJB A;  3EWP A;  4C2X A;  4E8O A;  1L0C A;  4MHY A;  5J8F A;  2QVP A;  5D8N A;  4ZY2 A;  2WCT A;  1NMT A;  2IL4 A;  1UFH A;  1IOF A;  2R7H A;  1XMT A;  5GCN A;  5A27 A;  2FE7 A;  4A30 A;  4JVV A;  4UEF A;  1CP7 A;  4UBR A;  4KVX A;  1P0H A;  1KUY A;  4MXU A;  3V7Z A;  3LMS A;  4YRH A;  3IEH A;  4UML A;  4PSX A;  4MBU A;  4ONW A;  3FX6 A;  2CXA A;  1ARM A;  3SI0 A;  5EMI A;  1UWY A;  3TOA A;  4FAI A;  2OZG A;  3TTH A;  3GB0 A;  1OBR A;  2JBJ A;  3D4U A;  3KAS A;  3TO9 A;  2GLF A;  3VWD A;  3FH4 A;  1BPM A;  4C7H A;  4P6Y A;  3VWE A;  4A95 A;  5HVH A;  1XRY A;  1KUX A;  4P4D A;  1MJ9 A;  2ZXV A;  3D3S A;  4J5Q A;  1B87 A;  2C6P A;  2PRB A;  2VZZ A;  2ZEG A;  2ARH A;  4H6Z A;  2B4D B;  2Z11 A;  3W91 A;  3CXP A;  4JLY A;  1Z5R A;  3ISZ A;  2KCW A;  3H8G A;  1IGB A;  5D29 A;  5I0C A;  3G3S A;  1YW4 A;  1IID A;  2C6C A;  3D68 A;  4A33 A;  5AG6 A;  2NSM A;  2AFS A;  4IQY A;  3T9Y A;  4I49 A;  5E96 A;  3FJU A;  3PP9 A;  4NXY A;  2FS5 A;  1FY7 A;  4A37 A;  5THW A;  2ABZ A;  1XFO A;  4C68 A;  5IB9 A;  1XE4 A;  2GAN A;  3JTK A;  3WC6 A;  1AMP A;  1IYL A;  3SXN A;  5F46 A;  1WK4 A;  2G0B A;  5JPH A;  4Y49 B;  5LYF A;  2HC9 A;  4EWT A;  3PBB A;  2BCO A;  2AFX A;  4LQG A;  5LYD A;  2ZEM A;  1VKC A;  1N71 A;  4OC4 A;  4JD6 A;  1VIX A;  2L8R A;  2BOA A;  3I3G A;  3Q6Z A;  4R76 A;  2B3V A;  2BSW A;  4IK2 A;  4M85 A;  2FVG A;  2Q51 A;  4JWP A;  3Q71 A;  3NFZ A;  4E0A A;  5H86 A;  2JDD A;  5FSU A;  3EWR A;  4CGP A;  4KS9 A;  2ACF A;  3TOB A;  3L2N A;  1KZF A;  2H5M A;  2PJ4 A;  2BFQ A;  3ETI A;  2WZN A;  2GRE A;  4MFZ A;  5CNP A;  4BBH A;  4RUH A;  5DUS A;  4GVW A;  3CPX A;  5FSX A;  3TX8 A;  2ZEO A;  2AFM A;  4RI1 A;  4QC6 A;  4BIN A;  1YME A;  1CP6 A;  4CYO A;  4FD4 A;  4MHZ A;  4R57 A;  1XIX A;  5EC4 A;  3BI1 A;  5JH9 A;  5KTC A;  2Z3K A;  3B7I A;  3GQE A;  3NH4 A;  2GLJ A;  1YQE A;  5AGE A;  1QQ9 A;  4ZY0 A;  3QAY A;  4ETK A;  4OP4 A;  4GM5 A;  1YSJ A;  3E0K A;  3EWQ A;  2P6F A;  4EFD A;  4FD5 A;  4HPS A;  3R9F A;  4ABK A;  4GXH A;  1M4D A;  3B3S A;  3G8W A;  4KLW A;  4CYP A;  4JLL A;  4M6I A;  2OH1 A;  2Q7B A;  4M6H A;  4MCP A;  2G3A A;  2PJ9 A;  3RAM A;  1FT7 A;  4MFJ A;  5DS0 A;  5CMS A;  1Q2C A;  4CAE A;  2O4H A;  4PK3 A;  3IID A;  2XEJ A;  1LCP A;  1S60 A;  1DE4 C;  2WSA A;  2VBQ A;  1DTD A;  2QJ8 A;  2YNE A;  1XOV A;  3GQO A;  5J1Q A;  3I1U A;  4IHM A;  2I79 A;  2PQ8 A;  4Q7A A;  4R3L A;  4MFK A;  2GIV A;  5ELY A;  3SHP A;  4YFJ A;  2ODF A;  3D7D A;  2EVN A;  4GVV A;  2X7B A;  4BD9 A;  3IGR A;  2F5I A;  3D2M A;  3IWE A;  2Y0M A;  5IX3 A;  4ETJ A;  2V77 A;  1HJZ A;  4JCA A;  2YGW A;  3JZT A;  4NJR A;  4KLV A;  2PVW A;  2RC4 A;  4C2Z A;  2DEA A;  1S7N A;  4ZBG A;  3TO7 A;  4HNY B;  4LUA A;  4J4Z A;  2JDC A;  4UWJ A;  2BL1 A;  1PCA A;  2AFW A;  4UFX A;  4A31 A;  1ZO0 A;  2PIY A;  1Z4R A;  3F8K A;  3NE8 A;  3FXT A;  5JGF A;  5LRG A;  4AB7 A;  4XNH B;  1WWZ A;  3KQZ A;  2CTB A;  4XNH C;  3CZX A;  4B13 A;  3CXQ A;  4J3G A;  2EK9 A;  5AG4 A;  1X12 A;  4CAW A;  4UCN A;  1IOI A;  2PRQ A;  4MHP A;  3ZZI A;  2F7V A;  4ZY1 A;  2ZEE A;  3C26 A;  1YW6 A;  3H4Q A;  4L8A A;  1Z8T A;  1YK3 A;  4OC0 A;  5F09 A;  4P4I A;  5AG7 A;  4II9 A;  1RO5 A;  3GY9 A;  3SJF A;  2I3C A;  4B12 A;  3T90 A;  5ISV A;  3P2F A;  4HNX B;  1BLL E;  3TC8 A;  3EXN A;  3KQX A;  4TWE A;  5FSV A;  2ZEL A;  3FIX A;  4UFW A;  3DR6 A;  4AVC A;  4CAX A;  4X3R A;  2Q4V A;  4NEX A;  1AYE A;  2AJ6 A;  2Q0Y A;  3CPA A;  1R3N A;  2CTC A;  2PJ6 A;  3D8P A;  3IU2 A;  4B11 A;  2CY2 A;  4B5O A;  2FXF A;  3QNV A;  3SI2 A;  4ZX8 A;  3B8G A;  4NGQ A;  2DX6 A;  4TU0 A;  1Q2Y A;  4P44 A;  5G22 A;  1Y7R A;  4OC1 A;  4H89 A;  3BJ8 A;  4IUS A;  3PB9 X;  3LD2 A;  5F47 A;  5J8C A;  1BO4 A;  1IY7 A;  5HOL A;  4KSF A;  4K30 A;  1TIQ A;  4ZX9 A;  3PGP A;  5G20 A;  3S6G A;  2LGR A;  3PB7 X;  1VHO A;  4B10 A;  4HKF A;  2A4N A;  3SJX A;  4J5S A;  4FD7 A;  1XBU A;  4OAE A;  2PCU A;  5FVJ A;  2ZPA A;  1CPS A;  2C6G A;  2Z0Z A;  1RXT A;  1QST A;  1BOB A;  2BUE A;  3EJF A;  3D7G A;  4P45 A;  2FAV A;  4UEE A;  4CYN A;  5CB5 A;  4KOY A;  4CGM A;  1LFW A;  4H6U A;  3EWO A;  3EJG A;  2R1I A;  1YGH A;  2GE3 A;  1QSN A;  4Y49 C;  3PB6 X;  1R57 A;  4EME A;  1K4J A;  1J4J A;  1LOK A;  4P4B A;  1XJO A;  3RO0 A;  2VQY A;  3IWG A;  3H8F A;  4CRY B;  3KL9 A;  3KHX A;  4MY3 A;  4TNU A;  4OKO A;  1VGY A;  4QB9 A;  4OAD A;  2JBK A;  5CPA A;  3SJE A;  4A38 A;  2OB0 A;  2YND A;  2ZEP A;  4MCR A;  4C2Y A;  2O53 A;  5KTA A;  1CBX A;  1CG2 A;  1Z4E A;  4QVT A;  2B3U A;  1Z9U A;  4D86 A;  1CM0 A;  2G9D A;  4JXR A;  4OC5 A;  3KZW A;  2EBJ A;  5A28 A;  5I4M A;  3NE7 A;  1YLE A;  2AFC A;  4K3N A;  3EY5 A;  5K8N A;  1TXR A;  3MN8 A;  5HIH A;  3RYO A;  2R8V A;  3N5F A;  1Y9W A;  2OZH A;  3H5Z A;  4B14 A;  3FEE A;  4DNC A;  3D2P A;  2YNC A;  1M44 A;  1ON0 A;  1YX0 A;  4C7I A;  3KR5 A;  2OR4 A;  4XPK A;  3A9L A;  1EE3 P;  2V8V A;  4MJ8 A;  3WC5 A;  5C82 A;  6CPA A;  2Q7S A;  7CPA A;  4DUK A;  5FSZ A;  3KGQ A;  4PXE A;  5LYL A;  3GPQ A;  4P4F A;  3DGV A;  2JEV A;  4KUB A;  1CPX A;  2V8H A;  2PJ0 A;  1ELM P;  1M4L A;  1SQH A;  2FG1 A;  4MCQ A;  2XEF A;  3EFA A;  4JZ0 A;  4FWU A;  4KOX A;  3B3T A;  1VHS A;  2IMO A;  4XPL A;  3PB8 X;  2EO8 A;  5K8O A;  4CAV A;  1GYT A;  2FIA A;  3K9U A;  3B35 A;  3FB3 A;  4O23 A;  2D4O A;  3SI1 A;  4F8Z A;  1ELL P;  4RN7 A;  4UWI A;  2CNS A;  2O28 A;  3NH8 A;  2Z3M A;  4UIA A;  3FMC A;  1S3Z A;  5CBM A;  2RB7 A;  2Z3O A;  1YRE A;  4Q38 A;  4G1P A;  2BFR A;  3SIH A;  1F57 A;  3GIU A;  4KUA A;  3NA6 A;  1ARL A;  4M6G A;  3B3V A;  1Z2L A;  5JM6 A;  1LAN A;  3KKW A;  3VH9 A;  5BWA B;  4NGM A;  3B3W A;  4MHD A;  2PR8 A;  4WWV A;  1M4G A;  4J5R A;  1A2Z A;  3EO4 A;  1TY8 A;  2BEI A;  2Z3P A;  1JQG A;  4NCZ A;  3SIG A;  2WYR A;  3JRU A;  4F0Y A;  4ESS A;  4NJQ A;  4YWY A;  2PJC A;  2PVV A;  5LYI A;  4NGT A;  4DYO A;  4JJX A;  4PQA A;  3BLN A;  2FXK A;  2JEW A;  2JZD A;  2DXQ A;  2P6E A;  5FSY A;  1V0C A;  3FF3 A;  4KOT A;  1Y0Y A;  4MHN A;  4OIW A;  4QUS A;  5LRJ A;  2B4D A;  2PIZ A;  1ZLH A;  3S6H A;  1KUV A;  4KVO E;  4W9Y A;  4YU9 A;  3WR7 A;  1Y9K A;  4LQ6 A;  2CNM A;  5K8P A;  3UY5 A;  4B5P A;  2POK A;  4OC3 A;  3WAB A;  3IU1 A;  3FYN A;  3RNZ A;  4R87 A;  1YR0 A;  2J8R A;  3ISX A;  2PC1 A;  4A39 A;  4CYQ A;  4UEZ A;  3VAT A;  5HMN A;  3EKE A;  2J9A A;  2ATR A;  1PU9 A;  2CF4 A;  1Y7E A;  1FNO A;  1S7F A;  2DF5 A;  1TKJ A;  3PZJ A;  1RTQ A;  3CXS A;  5H84 A;  2PR1 A;  2PE3 A;  2QML A;  3BJ7 A;  4L89 A;  4CAF A;  3IWW A;  4HNW B;  2Z3N A;  3D7F A;  3CT9 A;  4PXC A;  4YGO A;  3V38 A;  4K0C A;  2VL1 A;  4Q36 A;  1QSR A;  1I21 A;  2QIR A;  3QB8 A;  4PPZ A;  2PSW A;  2VXK A;  2HV2 A;  2J8N A;  3BXM A;  4AVA A;  5DWN A;  1KWM A;  2AFU A;  3TFY A;  3LOD A;  1Q7L A;  5HXD A;  2ZOF A;  4P10 A;  4OME A;  2PJ2 A;  3FED A;  3SIJ A;  4CS0 B;  2DPT A;  4MRI A;  2PJ7 A;  1TXZ A;  3VFQ A;  4KSI A;  3GLJ A;  2B5G A;  3KI9 A;  2Q43 A;  5E3B A;  1MJB A;  3LWU A;  4GS4 A;  4PV6 A;  2P0W A;  4R8F A;  2PJ5 A;  4A32 A;  1QSO A;  2ZW7 A;  3HLP A;  4R7M A;  4U5Y A;  1XF8 A;  1ZG8 A;  2DPS A;  5IV0 A;  2AFO A;  4MFP A;  3NH5 A;  2QYV A;  2EK8 A;  2ZW5 A;  2Q4Z A;  4CPA A;  2ZEN A;  4JXQ A;  4PSW A;  4PK2 A;  2IQ6 A;  2PJA A;  1TKF A;  2V8D A;  2Z3L A;  3VAR A;  4JGK A;  1F2O A;  2CIJ A;  1LAM A;  1S7L A;  1CX8 A;  3K9T A;  2W2G A;  1ZG9 A;  2FCK A;  4R6T A;  1HDU A;  1OZP A;  4KOS A;  4KOW A;  4JYW A;  4UFV A;  3WT4 A;  4CRZ B;  3DR8 A;  2EWB A;  2WPX A;  1R43 A;  4FD6 A;  4MFL A;  1Q2D A;  2I00 A;  3FNC A;  3V2B A;  2IJZ A;  2EEE A;  1IYK A;  1IB1 E;  2D4P A;  3D66 A;  5KTD A;  3LAC A;  5F49 A;  3CDX A;  3SXO A;  4AVB A;  3TO6 A;  5DWM A;  4Z65 A;  3FBU A;  3K2K A;  4KYB A;  1TF8 A;  1TF9 A;  2WUU A;  3BI0 A;  4F6A A;  5CB3 A;  4PXB A;  3GPG A;  2BO9 A;  2PJ1 A;  3N7Z A;  3F5B A;  3QAH A;  2VI7 A;  4BMH A;  4B5P B;  1IU8 A;  1JWQ A;  1I1D A;  1ZLI A;  2C27 A;  5HH1 A;  3BHX A;  2JZF A;  4OID A;  2F8H A;  3F0A A;  4R9M A;  5K8M A;  4NGS A;  4UCM A;  4B6Z A;  4NGR A;  3TCV A;  1MK4 A;  3ZJ0 A;  2QEC A;  4FBE A;  3T8W A;  1YD9 A;  1NJR A;  1HEE A;  1NSA A;  2PDO A;  3DLJ A;  4P4J A;  1Z8X A;  2VRI A;  2V8G A;  8CPA A;  2Q04 A;  2JZE A;  3H8E A;  3SII A;  3R96 A;  5IB0 A;  1YLO A;  3GPO A;  3HUV A;  5JQ4 A;  1HDQ A;  3IO1 A;  3PEI A;  4ZYQ A;  2HUZ A;  3GYA A;  3PFE A;  3DNS A;  3FVL A;  2AE6 A;  4PXD A;  4P4E A;  4CGO A;  1Y0R A;  2FSR A;  2NYQ A;  3OWC A;  3V45 A;  4FUU A;  3RZA A;  1YVO A;  3R9G A;  2B58 A;  4F0X A;  3KHZ A;  2ANP A;  4QBJ A;  4H2K A;  2OU2 A;  1NE9 A;  4MFQ A;  1PYT B;  4NFR A;  2REF A;  3EW5 A;  1P4N A;  4NSQ A;  2CNT A;  1MJA A;  1XEB A;  2FIW A;  1B6B A;  2C1C A;  3R1K A;  4MY0 A;  3IJ3 A;  5HVG A;  2B5G B;  3KR4 A;  4MCS A;  1Z8W A;  5HVF A;  2HQY A;  2XEI A;  1S5K A;  4KOR A;  3S9L A;  2PJ8 A;  3GUX A;  3D7H A;  4KSA A;  4MI4 A;  2KQV A;  3B2Y A;  3W6S A;  4WJB A;  5F48 A;  2FL4 A;  2Q4Y A;  3PB4 X;  3SJG A;  3WC7 A;  3IIF A;  2Q44 A;  1F2P A;  1PUA A;  4X8I A;  1M1D A;  1XMB A;  1X10 A;  4UCP A;  3R95 A;  3W6X A;  5C88 A;  2JLM A;  2ZED A;  2RNK A;  3S9N A;  1AUG A;  2AFZ A;  4KVM E;  4IAV A;  2HB6 A;  3JVN A;  4CGN A;  4U9Y A;  4ZI6 A;  1YVK A;  2GU2 A;  2XEG A;  5LRK A;  1QSM A;  4RS2 A;  1CJW A;  3EC4 A;  1M4I A;  1S7K A;  4ONU A;  2VZY A;  4OC2 A;  4F9U A;  3PFO A;  1I12 A;  2B4B A;  2K5T A;  3R9E A;  2GFQ A;  4KZT A;  2OOT A;  3V8I A;  2OZU A;  3MGD A;  2J8M A;  4GUA A;  4NGP A;  4F9V A;  1H8L A;  2VEZ A;  4MMO A;  1LAP A;  3PBE A;  3S6F A;  2PJ3 A;  5AIL A;  4CGL A;  2Z10 A;  4KOV A;  4XPD B;  4X5K A;  4XPD C;  4ZGY B;  1NSL A;  3DDD A;  2ZEH A;  2RFH A;  2FT0 A;  1ZG7 A;  3P2H A;  4EVY A;  2ZOG A;  3DSB A;  3I9S A;  4R3K A;  4AG9 A;  4ORF A;  4X2T A;  2WPW A;  4OLL A;  4UIB A;  4AXV A;  1ZR3 A;  4M3S A;  4IF5 A;  1VHU A;  3D67 A;  1BAV A;  3PRT A;  3S9M A;  5G1Z A;  3RBU A;  2ZEF A;  1U6M A;  1VHE A;  4AG7 A;  2YNC C;  3IIB A;  3JUW A;  4UA3 A;  4DJL A;  3MRU A;  2P6G A;  2ZW6 A;  1IIC A;  3FRM A;  3GKR A;  4UF4 A;  3B3C A;  3TE4 A;  3TT2 A;  2EUI A;  2ZW4 A;  1BPN A;  1TKH A;  2X47 A;  1Z8L A;  4LX9 A;  5AG5 A;  4NGN A;  4E2A A; 
#chains in the Genus database with same CATH homology
 1ZR5 A;  4A94 A;  2XD7 A;  1SPV A;  1QMU A;  4ABL A;  3IFE A;  3FEC A;  3IC1 A;  2PJB A;  3EWP A;  4MHY A;  2QVP A;  5D8N A;  4ZY2 A;  4JVV A;  4UEF A;  1CP7 A;  4MXU A;  3V7Z A;  3LMS A;  3IEH A;  4UML A;  4FAI A;  4ONW A;  3FX6 A;  1ARM A;  3SI0 A;  1UWY A;  3GB0 A;  1OBR A;  2JBJ A;  3D4U A;  3KAS A;  2GLF A;  3FH4 A;  1BPM A;  4P6Y A;  5HVH A;  1XRY A;  4P4D A;  4J5Q A;  2C6P A;  2ZEG A;  5D29 A;  1Z5R A;  3ISZ A;  3H8G A;  1IGB A;  1YW4 A;  2C6C A;  3D68 A;  2NSM A;  2AFS A;  4IQY A;  3FJU A;  4A37 A;  5THW A;  2ABZ A;  1XFO A;  5IB9 A;  3WC6 A;  1AMP A;  5LYF A;  2HC9 A;  4EWT A;  3PBB A;  2BCO A;  2AFX A;  4LQG A;  5LYD A;  2ZEM A;  4OC4 A;  1VIX A;  2L8R A;  2BOA A;  3Q6Z A;  4R76 A;  4IK2 A;  2FVG A;  2Q51 A;  3Q71 A;  3NFZ A;  5FSU A;  3EWR A;  2ACF A;  3L2N A;  2PJ4 A;  2BFQ A;  3ETI A;  2WZN A;  2GRE A;  4RUH A;  5DUS A;  4GVW A;  3CPX A;  5FSX A;  3TX8 A;  2ZEO A;  2AFM A;  1YME A;  1CP6 A;  4MHZ A;  3BI1 A;  5JH9 A;  3B7I A;  3GQE A;  3NH4 A;  2GLJ A;  1QQ9 A;  4ZY0 A;  4ETK A;  4OP4 A;  4GM5 A;  1YSJ A;  3EWQ A;  4EFD A;  4ABK A;  3B3S A;  4JLL A;  4MCP A;  2PJ9 A;  3RAM A;  1FT7 A;  5DS0 A;  5CMS A;  2O4H A;  3IID A;  2XEJ A;  1LCP A;  1DE4 C;  1DTD A;  2QJ8 A;  3GQO A;  5J1Q A;  3I1U A;  4IHM A;  4Q7A A;  5ELY A;  3D7D A;  4GVV A;  4BD9 A;  4ETJ A;  2V77 A;  1HJZ A;  4JCA A;  3JZT A;  4NJR A;  2PVW A;  2DEA A;  4J4Z A;  1PCA A;  2AFW A;  2PIY A;  5JGF A;  5LRG A;  3KQZ A;  2CTB A;  2EK9 A;  2PRQ A;  4MHP A;  2F7V A;  4ZY1 A;  2ZEE A;  1YW6 A;  4OC0 A;  5F09 A;  3SJF A;  2I3C A;  1BLL E;  3TC8 A;  3KQX A;  4TWE A;  5FSV A;  2ZEL A;  4X3R A;  1AYE A;  3CPA A;  1R3N A;  2CTC A;  2PJ6 A;  3QNV A;  3SI2 A;  4ZX8 A;  4NGQ A;  2DX6 A;  4TU0 A;  4P44 A;  4OC1 A;  3PB9 X;  1IY7 A;  5HOL A;  4ZX9 A;  2LGR A;  3PB7 X;  1VHO A;  3SJX A;  4J5S A;  1XBU A;  2PCU A;  1CPS A;  2C6G A;  4P45 A;  3D7G A;  3EJF A;  4UEE A;  2FAV A;  5CB5 A;  1LFW A;  3EWO A;  3EJG A;  3PB6 X;  4EME A;  1LOK A;  4P4B A;  1XJO A;  3H8F A;  3KL9 A;  3KHX A;  4TNU A;  4OKO A;  1VGY A;  2JBK A;  5CPA A;  3SJE A;  4A38 A;  2ZEP A;  4MCR A;  2O53 A;  1CBX A;  1CG2 A;  4D86 A;  2G9D A;  4OC5 A;  3KZW A;  5I4M A;  2AFC A;  4K3N A;  5K8N A;  1TXR A;  3MN8 A;  5HIH A;  3N5F A;  3FEE A;  3KR5 A;  2OR4 A;  1EE3 P;  2V8V A;  6CPA A;  3WC5 A;  7CPA A;  4DUK A;  5FSZ A;  3KGQ A;  4PXE A;  5LYL A;  3GPQ A;  4P4F A;  3DGV A;  1CPX A;  2V8H A;  2PJ0 A;  1ELM P;  1M4L A;  2FG1 A;  4MCQ A;  2XEF A;  4JZ0 A;  4FWU A;  3B3T A;  2IMO A;  3PB8 X;  5K8O A;  1GYT A;  3SI1 A;  3B35 A;  4O23 A;  4F8Z A;  1ELL P;  3NH8 A;  4UIA A;  3FMC A;  5CBM A;  2RB7 A;  4G1P A;  2BFR A;  3SIH A;  1F57 A;  3NA6 A;  1ARL A;  3B3V A;  1Z2L A;  5JM6 A;  1LAN A;  3VH9 A;  4NGM A;  3B3W A;  4WWV A;  4J5R A;  1TY8 A;  1JQG A;  3SIG A;  2WYR A;  3JRU A;  4ESS A;  4NJQ A;  4YWY A;  2PJC A;  2PVV A;  5LYI A;  4NGT A;  4DYO A;  4PQA A;  2FXK A;  2JEW A;  3FF3 A;  5FSY A;  1Y0Y A;  4MHN A;  4OIW A;  5LRJ A;  2PIZ A;  1ZLH A;  4W9Y A;  4YU9 A;  5K8P A;  2POK A;  4OC3 A;  3WAB A;  3ISX A;  4A39 A;  4UEZ A;  3VAT A;  3EKE A;  2J9A A;  2CF4 A;  1Y7E A;  1FNO A;  1TKJ A;  1RTQ A;  2PE3 A;  3IWW A;  4PXC A;  3V38 A;  3D7F A;  3CT9 A;  4K0C A;  2VL1 A;  4PPZ A;  3BXM A;  1KWM A;  2AFU A;  1Q7L A;  5HXD A;  2ZOF A;  4P10 A;  4OME A;  2PJ2 A;  3FED A;  3SIJ A;  4MRI A;  2PJ7 A;  1TXZ A;  3VFQ A;  4KSI A;  3GLJ A;  3KI9 A;  2Q43 A;  5E3B A;  3LWU A;  4R8F A;  2PJ5 A;  3HLP A;  4R7M A;  1ZG8 A;  2AFO A;  3NH5 A;  2QYV A;  2EK8 A;  2Q4Z A;  4CPA A;  2ZEN A;  2IQ6 A;  2PJA A;  1TKF A;  2V8D A;  3VAR A;  4JGK A;  1F2O A;  2CIJ A;  1LAM A;  1CX8 A;  3K9T A;  1ZG9 A;  4R6T A;  1HDU A;  3WT4 A;  4JYW A;  2EWB A;  1R43 A;  3V2B A;  2IJZ A;  2EEE A;  3D66 A;  3CDX A;  4Z65 A;  3K2K A;  4KYB A;  1TF8 A;  1TF9 A;  3BI0 A;  5CB3 A;  4PXB A;  3GPG A;  2BO9 A;  2PJ1 A;  1ZLI A;  3BHX A;  4OID A;  2F8H A;  5K8M A;  4NGS A;  4B6Z A;  4NGR A;  4FBE A;  3T8W A;  1YD9 A;  1NJR A;  1HEE A;  1NSA A;  3DLJ A;  4P4J A;  8CPA A;  2VRI A;  2V8G A;  3SII A;  3H8E A;  1YLO A;  3GPO A;  3HUV A;  1HDQ A;  3IO1 A;  3PEI A;  4ZYQ A;  4PXD A;  3PFE A;  3FVL A;  4P4E A;  1Y0R A;  2NYQ A;  4FUU A;  3V45 A;  3RZA A;  3KHZ A;  2ANP A;  4H2K A;  4NFR A;  1PYT B;  3EW5 A;  2C1C A;  3IJ3 A;  5HVG A;  3KR4 A;  4MCS A;  5HVF A;  2XEI A;  3S9L A;  2PJ8 A;  3GUX A;  3D7H A;  3B2Y A;  4WJB A;  3PB4 X;  3SJG A;  3WC7 A;  3IIF A;  4X8I A;  1F2P A;  1XMB A;  2ZED A;  3S9N A;  2AFZ A;  4IAV A;  2HB6 A;  4ZI6 A;  2GU2 A;  2XEG A;  5LRK A;  4OC2 A;  4F9U A;  3PFO A;  2OOT A;  4GUA A;  4NGP A;  4F9V A;  1H8L A;  4MMO A;  1LAP A;  3PBE A;  2PJ3 A;  5AIL A;  2ZEH A;  2RFH A;  1ZG7 A;  2ZOG A;  4X2T A;  4AXV A;  4UIB A;  1ZR3 A;  1VHU A;  3D67 A;  1BAV A;  3PRT A;  3S9M A;  3RBU A;  2ZEF A;  1VHE A;  3IIB A;  4DJL A;  3MRU A;  4UF4 A;  3B3C A;  1BPN A;  1TKH A;  2X47 A;  1Z8L A;  4P4I A;  4NGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...