4ZX8A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 9b
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
total genus 174
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx8A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx8A02
1BAVA 3PRTA 3LWUA 4NGTA 4ONWA 4NFRA 1Z2LA 4DYOA 4LQGA 3ETIA 3NH5A 2PRQA 4R7MA 5THWA 4IK2A 3IEHA 4MHPA 1FNOA 1SPVA 1YW4A 5FSUA 4OMEA 2PJ2A 2OR4A 5LRKA 2OOTA 4P4IA 2FG1A 3B3CA 1CPXA 4P44A 2QJ8A 3GUXA 1ARMA 4NGRA 3IIFA 2EK9A 2GLJA 4J5QA 2CTCA 4MHYA 1ZLHA 5AILA 1FT7A 4ZY2A 3IIBA 4X8IA 2F8HA 1GYTA 1YLOA 2V8VA 3GPGA 3D7DA 4P10A 5ELYA 1NJRA 3B35A 3BI0A 2L8RA 5LYLA 4JGKA 2AFMA 7CPAA 3SIHA 4G1PA 2BCOA 4UIBA 4CPAA 5HOLA 3FMCA 4UF4A 2BO9A 3CDXA 1LAPA 3EW5A 2C6CA 2PJ3A 3GQOA 4NJQA 4EFDA 4JCAA 2EK8A 3PB8X 4RUHA 4DJLA 3IFEA 1VHEA 3PFOA 4A94A 3KHXA 3SJXA 2PJ1A 3D4UA 1CX8A 4NGQA 4NGMA 1VGYA 3Q6ZA 3PB7X 3IIDA 5K8PA 2X47A 3KZWA 4K3NA 2ZEPA 4OIWA 4YWYA 3H8FA 4F9UA 1IY7A 3B3SA 1XFOA 1R43A 1YW6A 3TC8A 2ZEDA 2NSMA 1OBRA 5IB9A 3S9NA 4J4ZA 4PPZA 4ABLA 4TWEA 2BOAA 5CMSA 1LOKA 3V2BA 1PYTB 4NGPA 2PJ9A 2HB6A 4OC1A 1CP6A 4O23A 3EWOA 4P45A 4GVWA 4D86A 3PB9X 3B7IA 4NGSA 1TXZA 3H8EA 4IHMA 3SJEA 4ZI6A 2QYVA 1BPNA 3D67A 4MMOA 3VARA 4A38A 2FVGA 1VHUA 3EWRA 4P4JA 2ZEFA 5LYFA 5K8MA 3CT9A 4ZX8A 2AFWA 1LCPA 3K2KA 3ISZA 4ETJA 2DEAA 3D7GA 1CBXA 1KWMA 3KQZA 3D66A 5CB5A 4PXBA 2PVWA 2CTBA 4P4DA 2RFHA 3JRUA 1TY8A 3HLPA 2ANPA 4OIDA 5LYDA 2PJ4A 2XEFA 3RBUA 4OC2A 3K9TA 3SIGA 3WC7A 3FECA 3EJFA 3KHZA 4KSIA 2DX6A 2WYRA 5LYIA 1YD9A 3SJFA 3NFZA 4UMLA 1ARLA 3CPXA 2XD7A 2QVPA 2V77A 3GQEA 4B6ZA 3L2NA 4OP4A 2PJAA 2XEJA 5CBMA 3SI2A 3SI0A 3KASA 4PXEA 2BFRA 5F09A 1R3NA 3PB6X 4GVVA 4OC3A 4MXUA 3T8WA 1AYEA 4UIAA 3FF3A 3S9MA 1XJOA 4JYWA 1QQ9A 3D68A 3KGQA 3KR4A 4ZX9A 5LRGA 1NSAA 3KI9A 4H2KA 3EKEA 3PFEA 4K0CA 2ACFA 4OC0A 4ABKA 5D8NA 4IAVA 3B3VA 5CPAA 3TX8A 4J5SA 4MCSA 2EWBA 3GLJA 2PIYA 4P4BA 3PEIA 3V38A 3LMSA 1HEEA 4UEZA 2CIJA 4GUAA 2AFCA 4X2TA 4R6TA 3RAMA 2Q43A 1CP7A 4MCPA 4DUKA 1IGBA 5HVGA 5HIHA 2LGRA 5HVFA 1JQGA 2NYQA 2V8GA 2V8HA 3V45A 2XEIA 2ZELA 3B2YA 1Y0RA 2J9AA 5DS0A 4F8ZA 5JM6A 1TKHA 2Q51A 4ZY1A 2HC9A 1YMEA 3NA6A 3NH4A 4X3RA 1DTDA 3BI1A 5JH9A 3DGVA 3WC6A 5FSXA 4P6YA 2ZEHA 3D7FA 2V8DA 2RB7A 1LANA 1UWYA 4KYBA 4EWTA 5I4MA 4AXVA 2O4HA 2AFXA 5FSZA 2BFQA 4OC4A 3WABA 2EEEA 1Q7LA 3IC1A 1XRYA 3JZTA 3SJGA 3KQXA 2VRIA 5LRJA 2PJ6A 3QNVA 4ZY0A 2C1CA 4IQYA 3FH4A 2C6GA 4ESSA 2PJ5A 3PBBA 4FWUA 5JGFA 2POKA 2Q4ZA 3FX6A 3Q71A 1EE3P 1VIXA 4PQAA 2FXKA 4W9YA 5DUSA 4GM5A 4JZ0A 2PJCA 3SIIA 3V7ZA 5J1QA 5D29A 8CPAA 1HJZA 4NJRA 1XBUA 4MCRA 4ZYQA 4ETKA 1BLLE 2ABZA 1ZG7A 4A39A 1Y0YA 5HXDA 3MRUA 2ZEEA 2VL1A 3S9LA 4P4EA 2F7VA 3I1UA 1Z5RA 3VFQA 4FUUA 1ZLIA 1TF8A 4OC5A 3IJ3A 3WC5A 3VATA 4FBEA 4MHZA 5CB3A 4JVVA 1M4LA 2IMOA 4MCQA 3NH8A 2C6PA 4Q7AA 4P4FA 1LFWA 1TF9A 2AFZA 3WT4A 5K8NA 2PVVA 4PXDA 4R76A 2PE3A 2WZNA 2PCUA 4F9VA 2GU2A 2FAVA 3HUVA 4FAIA 4BD9A 4EMEA 1ZG9A 2IQ6A 1QMUA 2JBJA 4WWVA 4TU0A 2ZOFA 1ZR5A 1ELMP 3IWWA 4OKOA 1DE4C 3EJGA 3N5FA 2GLFA 2ZEGA 1TXRA 5FSYA 1LAMA 3DLJA 3RZAA 2ZOGA 1PCAA 3D7HA 4YU9A 2CF4A 1VHOA 2IJZA 2JEWA 3SI1A 1CPSA 3ISXA 3H8GA 3B3TA 5K8OA 3GPQA 3GB0A 1YSJA 3EWPA 2PIZA 1AMPA 4A37A 1RTQA 4UEFA 5FSVA 3BHXA 3KR5A 3IO1A 2GREA 3FJUA 5HVHA 4JLLA 2JBKA 4NGNA 2ZENA 3FVLA 4MRIA 1TKJA 1ZG8A 4PXCA 1Z8LA 2PJ8A 1BPMA 1ZR3A 1F2OA 4Z65A 1Y7EA 4J5RA 1XMBA 3VH9A 2PJ7A 3EWQA 3FEEA 3MN8A 3PBEA 3B3WA 1HDUA 1F2PA 3PB4X 4UEEA 2AFOA 2PJ0A 2O53A 2AFSA 4R8FA 1HDQA 2PJBA 1ELLP 3BXMA 2ZEOA 1TKFA 6CPAA 2ZEMA 3GPOA 2AFUA 3SIJA 3CPAA 4MHNA 2XEGA 3FEDA 5E3BA 4TNUA 1H8LA 2G9DA 4WJBA 1F57A 2I3CA 3KL9A 1CG2A
chains in the Genus database with same CATH superfamily
1BAVA 3PRTA 3WR7A 1M4GA 2YNCC 3LWUA 4NGTA 1P0HA 3TO7A 1IYKA 2KCWA 4ONWA 4NFRA 1KUYA 1Z2LA 4DYOA 4AVBA 5KTDA 4LQGA 3ETIA 3TCVA 3NH5A 2PRQA 3EO4A 4R7MA 2P0WA 5THWA 4IK2A 3IEHA 4XNHC 4MHPA 2HV2A 1FNOA 1SPVA 1QSNA 1YW4A 4YRHA 5FSUA 1Y9WA 4KOSA 4OMEA 4Y49C 5FVJA 2PJ2A 2OR4A 5LRKA 3GY9A 1WK4A 2ATRA 2CY2A 4JWPA 4KSFA 2OOTA 4P4IA 2FG1A 3B3CA 1CPXA 4P44A 2QJ8A 3GUXA 2D4OA 1ARMA 4NGRA 4CRZB 3D8PA 3IIFA 1J4JA 5HH1A 2EK9A 2GLJA 4MFQA 3SXOA 4CAEA 2JZEA 4J5QA 2CTCA 4MHYA 3VWDA 1ZLHA 5AILA 4ORFA 4B5PB 1M4DA 4MBUA 1FT7A 4HNYB 4ZY2A 3IIBA 3TT2A 1NE9A 2F8HA 3EC4A 4X8IA 4XPDC 3W6XA 2OH1A 1GYTA 2YGWA 2HQYA 2P6EA 1YLOA 2B4BA 4DNCA 4YFJA 4B12A 2B4DB 2V8VA 2OB0A 3LACA 1B6BA 3GPGA 4M85A 1WWZA 1TIQA 4AVAA 3D7DA 2R98A 4P10A 5ELYA 1NJRA 3BJ7A 3B35A 3BI0A 4KZTA 2L8RA 5LYLA 4JGKA 3R9GA 2AFMA 2WPXA 4IF5A 7CPAA 5AG6A 3SIHA 4G1PA 2BCOA 1BO4A 4UIBA 4CPAA 5HOLA 3FMCA 4UF4A 2BO9A 2Z10A 5H84A 1SQHA 3CDXA 4UCPA 4KOVA 5EBVA 1LAPA 3EW5A 2C6CA 2PJ3A 4UCMA 4JJXA 5EC4A 3CXPA 3GQOA 4GXHA 4NJQA 4EFDA 2J8NA 4JCAA 2EK8A 3PB8X 2AJ6A 4XNHB 3IFEA 4DJLA 4RUHA 1VHEA 3PFOA 4A94A 3I9SA 3KHXA 2RNKA 4Y49B 3SJXA 2PJ1A 2G3TA 4AB7A 5IV0A 3FB3A 3D4UA 1CX8A 4NGQA 4NGMA 1VGYA 1IIDA 2I00A 3Q6ZA 2Q7BA 3PB7X 3MGDA 3EFAA 3IIDA 5K8PA 4C2ZA 4CAVA 2X47A 3KZWA 4K3NA 2ZEPA 4OIWA 1YGHA 4YWYA 3G8WA 2WUUA 3H8FA 3R95A 4F9UA 1IY7A 2Q4YA 3B3SA 1XFOA 5CNPA 1R43A 1YW6A 3TC8A 2FL4A 2ZEDA 1QSTA 1GHEA 2NSMA 4FD4A 1OBRA 4J3GA 5IB9A 4J4ZA 3S9NA 4PPZA 4ABLA 2R7HA 4TWEA 4XPDB 2BOAA 4B13A 2YNDA 4XPLA 5CMSA 1LOKA 5G21A 4CAXA 3ZJ0A 3V2BA 1PYTB 4NGPA 2PJ9A 4E2AA 2HUZA 2HB6A 2REEA 4KVOE 4OC1A 1CP6A 1AUGA 4O23A 3EWOA 3KKWA 4P45A 4GVWA 4D86A 3PB9X 3VWEA 1IYLA 3B7IA 4JLYA 3GYAA 2JZDA 4KUAA 4NGSA 1TXZA 4KOWA 1MJAA 3H8EA 2OZGA 2R8VA 3PP9A 2EUIA 4IHMA 4QB9A 3SJEA 3C26A 4ZI6A 2QYVA 1R57A 1BPNA 2B58A 2Q4VA 5DWMA 5F48A 3D67A 4MMOA 3TE4A 3VARA 1MK4A 4A31A 4KOUA 4BMHA 4F6AA 3E0KA 2FIAA 4EVYA 2WCTA 4FD7A 2VBQA 4KSAA 4KS9A 4ZBGA 2IL4A 2A4NA 4A38A 1L0CA 1PU9A 1VHUA 1A2ZA 3EWRA 2EO8A 2FVGA 3UY5A 4P4JA 2ZEFA 4CRYB 5LYFA 5K8MA 1VKCA 2Q0YA 3CT9A 4ZX8A 2AFWA 1LCPA 3B8GA 3K2KA 4PV6A 5BWAB 3ISZA 4ETJA 2DEAA 3D7GA 3PZJA 4HNXB 4AG9A 3H5ZA 1CBXA 1KWMA 3KQZA 4NEXA 2FCKA 3D66A 4KOTA 4KVME 5CB5A 4PXBA 4C7IA 4X5KA 2PVWA 2CTBA 2JDCA 4HNWB 4A2ZA 1KZFA 4P4DA 2RFHA 3JRUA 2VQYA 1TY8A 4PK3A 3HLPA 1IU8A 2ANPA 4B10A 4OIDA 4KOXA 4KORA 1YREA 5LYDA 4M6IA 2PJ4A 4RN7A 2XEFA 2GFQA 3V8IA 3CZXA 3RBUA 4OC2A 2Y0MA 5A27A 2BUEA 4CGLA 3K9TA 3SIGA 4KUBA 3WC7A 2Z3KA 3FECA 3EJFA 3KHZA 3NE8A 4KSIA 3S6GA 2DX6A 3DDDA 2WYRA 5LYIA 2PQ8A 4RI1A 1YD9A 2VXKA 3SJFA 3NFZA 5I0CA 4UMLA 1ARLA 3CPXA 2XD7A 2QVPA 4F0YA 2V77A 4CGPA 5C88A 3GQEA 4MI4A 4B6ZA 3L2NA 4OLLA 4OP4A 2PJAA 1CM0A 4UFXA 3TOAA 1P4NA 2XEJA 3GKRA 5CBMA 2J8MA 4UFVA 3TO9A 4C2XA 3SI2A 3SI0A 2CNSA 3IU1A 4KVXA 3KASA 4PXEA 2BFRA 5F09A 3DSBA 2RC4A 2BL1A 1R3NA 3PB6X 4GVVA 4OC3A 1M44A 3IWEA 1KUXA 1XF8A 2ZW5A 2C27A 2PSWA 1Q2DA 3T8WA 1AYEA 4MXUA 4UIAA 3FF3A 3RNZA 3S9MA 5AG4A 1XJOA 4JYWA 3DR8A 2W2GA 1QQ9A 3D68A 3KGQA 3KR4A 4ZX9A 1S7NA 1YR0A 1NSAA 3CXSA 5LRGA 4CGNA 1OZPA 1S5KA 3KI9A 4H2KA 1CJWA 3EKEA 3PFEA 4K0CA 3IGRA 2ACFA 2VZYA 4OC0A 4ABKA 5D8NA 5HMNA 4IAVA 3B3VA 5CPAA 3TX8A 4J5SA 4A30A 4MCSA 2EWBA 3GLJA 2GIVA 4H89A 2PIYA 4P4BA 4PK2A 4CYQA 3PEIA 4U5YA 3V38A 3LMSA 3N7ZA 4B14A 4CGOA 1HEEA 2ZW6A 3FNCA 4UEZA 1XE4A 3T9YA 2CXAA 2CIJA 4GUAA 2AFCA 4X2TA 2Z3PA 4R6TA 3FRMA 1K4JA 2FE7A 1MJ9A 3NE7A 5G1ZA 3R96A 3RAMA 4A33A 4I49A 2ZXVA 4M6HA 2Q43A 1CP7A 4PSXA 4MJ8A 2PC1A 4MCPA 4DUKA 1IGBA 1YX0A 2PDOA 5HVGA 5HIHA 4MFPA 5AGEA 4YGOA 2LGRA 3I3GA 4JXQA 5HVFA 3R9EA 1JQGA 2NYQA 2PR1A 2V8GA 2V8HA 3V45A 1Z8WA 2XEIA 4JXRA 1XMTA 2ZELA 3SHPA 5C82A 3B2YA 1Y0RA 2G3AA 1MJBA 2J9AA 5DS0A 4F8ZA 5JM6A 3LD2A 1TKHA 1RXTA 1UFHA 2JEVA 4AVCA 2Q51A 4ZY1A 2HC9A 1YMEA 2J8RA 2FSRA 2PR8A 3NA6A 1DTDA 3BI1A 2B5GA 3NH4A 1Q2CA 4X3RA 4A95A 5J8CA 1S7FA 2VI7A 1QSRA 5JH9A 2JDDA 3DGVA 3JTKA 3FXTA 3K9UA 3RO0A 3WC6A 4C2YA 5FSXA 4P6YA 1Z8TA 1YK3A 2FS5A 2ZEHA 3D7FA 2QECA 2V8DA 2VZZA 2RB7A 1LANA 1UWYA 4KYBA 4UA3A 4EWTA 2PRBA 3IWGA 5I4MA 4AXVA 2O4HA 1U6MA 2AFXA 2D4PA 3S6KA 3RYOA 3QB8A 4MHDA 4UBRA 5FSZA 2BFQA 4OC4A 1IB1E 3WABA 4MFZA 2EEEA 1Q7LA 2O28A 3IC1A 1XRYA 2R1IA 3D3SA 1ZO0A 3JZTA 3S6FA 4CAFA 4L89A 1Z8XA 3SJGA 4FD6A 3KQXA 4B11A 3CXQA 2VRIA 1M1DA 5LRJA 2PJ6A 1S60A 3QNVA 2BSWA 2DXQA 4ZY0A 2C1CA 4LX9A 4IQYA 3FH4A 2X7BA 2C6GA 4ESSA 2PJ5A 3PBBA 4FWUA 2F5IA 3EXNA 5JGFA 2ARHA 1QSMA 4H6UA 2POKA 4UWIA 5AG7A 1S7KA 2Q4ZA 3FX6A 4B5PA 4JD6A 4HPSA 3BJ8A 4K30A 3Q71A 1EE3P 1VIXA 4PQAA 2FXKA 2QIRA 3ZZIA 4W9YA 3IU2A 4CAWA 2Q04A 4QUSA 5DUSA 2ZW7A 4GM5A 2B4DA 1YQEA 2PJCA 3SIIA 4JZ0A 4R9MA 2FIWA 3V7ZA 5J1QA 1Z9UA 4MFLA 5EMIA 4CYPA 1X10A 4BBHA 5D29A 5IB0A 2KQVA 2EVNA 3EY5A 8CPAA 2Z3MA 2WSAA 3TTHA 4E8OA 4MY3A 2YNCA 1HJZA 4NJRA 1XBUA 4MCRA 4FD5A 2AE6A 4ZYQA 2QMLA 4ETKA 1NMTA 1BLLE 1XEBA 2ABZA 4LQ6A 3W6SA 1RO5A 1ZG7A 2Q7SA 4R3KA 4HKFA 4A39A 2OU2A 1Y0YA 5HXDA 3MRUA 2ZEEA 2ODFA 1VHSA 2VL1A 3F0AA 2DF5A 1YVOA 4U9YA 4CS0B 2H5MA 4P4EA 3S9LA 2F7VA 3I1UA 4AG7A 1M4IA 2FXFA 4Q38A 1Z5RA 4OAEA 3P2FA 3VFQA 3F8KA 4FUUA 4QVTA 1ZLIA 1TF8A 4OC5A 1X12A 3S6HA 3IJ3A 3WC5A 4CYNA 3VATA 4FBEA 1N71A 1Y7RA 4MHZA 4CGMA 5CB3A 2Z3OA 2Z3LA 3FIXA 4MFJA 3TO6A 4JVVA 1M4LA 4CYOA 2IMOA 4KOYA 5DWNA 4MCQA 1XIXA 4MY0A 3JVNA 5J8FA 1S7LA 3NH8A 5IX3A 2G0BA 2C6PA 4Q7AA 4P4FA 1LFWA 2GE3A 5KTAA 1TF9A 2AFZA 3WT4A 5K8NA 2PVVA 4PXDA 5JPHA 4R76A 2PE3A 2WZNA 4PSWA 1JWQA 3FBUA 2PCUA 3A9LA 1B87A 3JUWA 4F9VA 2GU2A 4KLVA 5A28A 2FAVA 3HUVA 4UCNA 2YNEA 4FAIA 4BD9A 4EMEA 3BLNA 1ON0A 1ZG9A 2IQ6A 1QMUA 2JBJA 4KLWA 4WWVA 4TU0A 2P6GA 2ZOFA 3H4QA 1ZR5A 1ELMP 2CNMA 3IWWA 4OADA 2OZUA 4OKOA 1Z4EA 1DE4C 2Q44A 3EJGA 3N5FA 4M3SA 2DPSA 4R3LA 5JQ4A 2B3UA 2GLFA 2ZEGA 1TXRA 2Z11A 5FSYA 1LAMA 3DLJA 3W91A 2K5TA 1Z4RA 2GANA 2WPWA 3RZAA 4B5OA 4E0AA 2ZOGA 5E96A 1PCAA 3D7HA 2DPTA 4Q36A 2P6FA 3QAHA 2CF4A 4YU9A 1VHOA 5G20A 2OZHA 3R1KA 2IJZA 2JEWA 1Y9KA 1CPSA 3ISXA 3DR6A 3SI1A 3H8GA 2B3VA 4QBJA 3B3TA 5K8OA 2Z3NA 1YVKA 5G22A 3GPQA 3GB0A 5GCNA 4NSQA 5F46A 4II9A 1YSJA 3EWPA 2ZW4A 4F0XA 4U9ZA 1S3ZA 3OWCA 4BINA 2PIZA 4NXYA 1AMPA 4A37A 1Q2YA 1RTQA 4UEFA 3QAYA 1I21A 3SXNA 5FSVA 4ONUA 3BHXA 3KR5A 5ISVA 1IOIA 3GIUA 5AG5A 3R9FA 4RS2A 2Z0ZA 3IO1A 2REFA 2GREA 3TFYA 3FJUA 5HVHA 4JLLA 2JBKA 2I79A 4NGNA 2ZENA 3FVLA 4MRIA 2JZFA 4C68A 1TKJA 2CNTA 3PGPA 5F47A 1ZG8A 4PXCA 1Z8LA 2PJ8A 1BPMA 1YLEA 5H86A 1ZR3A 5KTCA 5F49A 1F2OA 4LUAA 4Z65A 4M6GA 1Y7EA 4J5RA 1XMBA 1I1DA 2NMTA 3VH9A 4UFWA 4XPKA 3F5BA 2PJ7A 3EWQA 3FEEA 3MN8A 2ZPAA 3D2MA 3DNSA 1IOFA 1IICA 1KUVA 4R57A 3PBEA 4C7HA 3B3WA 1HDUA 4L8AA 1F2PA 3PB4X 4UEEA 1BOBA 2JLMA 2AFOA 3D2PA 4IUSA 2PJ0A 1XOVA 2O53A 3T90A 3FYNA 1PUAA 4NCZA 2AFSA 4GS4A 4R8FA 3LODA 1HDQA 3TOBA 2PJBA 4UWJA 1LRZA 2FT0A 1ELLP 3BXMA 2ZEOA 1TKFA 6CPAA 2ZEMA 1QSOA 3GPOA 4NF1A 2AFUA 1NSLA 3SIJA 3CPAA 2BEIA 4MHNA 3G3SA 2XEGA 4A32A 3FEDA 5E3BA 2VEZA 1FY7A 4ZGYB 3P2HA 1V0CA 2B5GB 4TNUA 1I12A 1H8LA 4MFKA 4R87A 2G9DA 4QC6A 4WJBA 1F57A 4H6ZA 2EBJA 2I3CA 3KL9A 1CG2A
chains in the Genus database with same CATH topology
1BAVA 3PRTA 3LWUA 4NGTA 4ONWA 4NFRA 1Z2LA 4DYOA 4LQGA 3ETIA 3NH5A 2PRQA 4R7MA 5THWA 4IK2A 3IEHA 4MHPA 1FNOA 1SPVA 1YW4A 5FSUA 4OMEA 2PJ2A 2OR4A 5LRKA 2OOTA 4P4IA 2FG1A 3B3CA 1CPXA 4P44A 2QJ8A 3GUXA 1ARMA 4NGRA 3IIFA 2EK9A 2GLJA 4J5QA 2CTCA 4MHYA 1ZLHA 5AILA 1FT7A 4ZY2A 3IIBA 4X8IA 2F8HA 1GYTA 1YLOA 2V8VA 3GPGA 3D7DA 4P10A 5ELYA 1NJRA 3B35A 3BI0A 2L8RA 5LYLA 4JGKA 2AFMA 7CPAA 3SIHA 4G1PA 2BCOA 4UIBA 4CPAA 5HOLA 3FMCA 4UF4A 2BO9A 3CDXA 1LAPA 3EW5A 2C6CA 2PJ3A 3GQOA 4NJQA 4EFDA 4JCAA 2EK8A 3PB8X 4RUHA 4DJLA 3IFEA 1VHEA 3PFOA 4A94A 3KHXA 3SJXA 2PJ1A 3D4UA 1CX8A 4NGQA 4NGMA 1VGYA 3Q6ZA 3PB7X 3IIDA 5K8PA 2X47A 3KZWA 4K3NA 2ZEPA 4OIWA 4YWYA 3H8FA 4F9UA 1IY7A 3B3SA 1XFOA 1R43A 1YW6A 3TC8A 2ZEDA 2NSMA 1OBRA 5IB9A 3S9NA 4J4ZA 4PPZA 4ABLA 4TWEA 2BOAA 5CMSA 1LOKA 3V2BA 1PYTB 4NGPA 2PJ9A 2HB6A 4OC1A 1CP6A 4O23A 3EWOA 4P45A 4GVWA 4D86A 3PB9X 3B7IA 4NGSA 1TXZA 3H8EA 4IHMA 3SJEA 4ZI6A 2QYVA 1BPNA 3D67A 4MMOA 3VARA 4A38A 2FVGA 1VHUA 3EWRA 4P4JA 2ZEFA 5LYFA 5K8MA 3CT9A 4ZX8A 2AFWA 1LCPA 3K2KA 3ISZA 4ETJA 2DEAA 3D7GA 1CBXA 1KWMA 3KQZA 3D66A 5CB5A 4PXBA 2PVWA 2CTBA 4P4DA 2RFHA 3JRUA 1TY8A 3HLPA 2ANPA 4OIDA 5LYDA 2PJ4A 2XEFA 3RBUA 4OC2A 3K9TA 3SIGA 3WC7A 3FECA 3EJFA 3KHZA 4KSIA 2DX6A 2WYRA 5LYIA 1YD9A 3SJFA 3NFZA 4UMLA 1ARLA 3CPXA 2XD7A 2QVPA 2V77A 3GQEA 4B6ZA 3L2NA 4OP4A 2PJAA 2XEJA 5CBMA 3SI2A 3SI0A 3KASA 4PXEA 2BFRA 5F09A 1R3NA 3PB6X 4GVVA 4OC3A 4MXUA 3T8WA 1AYEA 4UIAA 3FF3A 3S9MA 1XJOA 4JYWA 1QQ9A 3D68A 3KGQA 3KR4A 4ZX9A 5LRGA 1NSAA 3KI9A 4H2KA 3EKEA 3PFEA 4K0CA 2ACFA 4OC0A 4ABKA 5D8NA 4IAVA 3B3VA 5CPAA 3TX8A 4J5SA 4MCSA 2EWBA 3GLJA 2PIYA 4P4BA 3PEIA 3V38A 3LMSA 1HEEA 4UEZA 2CIJA 4GUAA 2AFCA 4X2TA 4R6TA 3RAMA 2Q43A 1CP7A 4MCPA 4DUKA 1IGBA 5HVGA 5HIHA 2LGRA 5HVFA 1JQGA 2NYQA 2V8GA 2V8HA 3V45A 2XEIA 2ZELA 3B2YA 1Y0RA 2J9AA 5DS0A 4F8ZA 5JM6A 1TKHA 2Q51A 4ZY1A 2HC9A 1YMEA 3NA6A 3NH4A 4X3RA 1DTDA 3BI1A 5JH9A 3DGVA 3WC6A 5FSXA 4P6YA 2ZEHA 3D7FA 2V8DA 2RB7A 1LANA 1UWYA 4KYBA 4EWTA 5I4MA 4AXVA 2O4HA 2AFXA 5FSZA 2BFQA 4OC4A 3WABA 2EEEA 1Q7LA 3IC1A 1XRYA 3JZTA 3SJGA 3KQXA 2VRIA 5LRJA 2PJ6A 3QNVA 4ZY0A 2C1CA 4IQYA 3FH4A 2C6GA 4ESSA 2PJ5A 3PBBA 4FWUA 5JGFA 2POKA 2Q4ZA 3FX6A 3Q71A 1EE3P 1VIXA 4PQAA 2FXKA 4W9YA 5DUSA 4GM5A 4JZ0A 2PJCA 3SIIA 3V7ZA 5J1QA 5D29A 8CPAA 1HJZA 4NJRA 1XBUA 4MCRA 4ZYQA 4ETKA 1BLLE 2ABZA 1ZG7A 4A39A 1Y0YA 5HXDA 3MRUA 2ZEEA 2VL1A 3S9LA 4P4EA 2F7VA 3I1UA 1Z5RA 3VFQA 4FUUA 1ZLIA 1TF8A 4OC5A 3IJ3A 3WC5A 3VATA 4FBEA 4MHZA 5CB3A 4JVVA 1M4LA 2IMOA 4MCQA 3NH8A 2C6PA 4Q7AA 4P4FA 1LFWA 1TF9A 2AFZA 3WT4A 5K8NA 2PVVA 4PXDA 4R76A 2PE3A 2WZNA 2PCUA 4F9VA 2GU2A 2FAVA 3HUVA 4FAIA 4BD9A 4EMEA 1ZG9A 2IQ6A 1QMUA 2JBJA 4WWVA 4TU0A 2ZOFA 1ZR5A 1ELMP 3IWWA 4OKOA 1DE4C 3EJGA 3N5FA 2GLFA 2ZEGA 1TXRA 5FSYA 1LAMA 3DLJA 3RZAA 2ZOGA 1PCAA 3D7HA 4YU9A 2CF4A 1VHOA 2IJZA 2JEWA 3SI1A 1CPSA 3ISXA 3H8GA 3B3TA 5K8OA 3GPQA 3GB0A 1YSJA 3EWPA 2PIZA 1AMPA 4A37A 1RTQA 4UEFA 5FSVA 3BHXA 3KR5A 3IO1A 2GREA 3FJUA 5HVHA 4JLLA 2JBKA 4NGNA 2ZENA 3FVLA 4MRIA 1TKJA 1ZG8A 4PXCA 1Z8LA 2PJ8A 1BPMA 1ZR3A 1F2OA 4Z65A 1Y7EA 4J5RA 1XMBA 3VH9A 2PJ7A 3EWQA 3FEEA 3MN8A 3PBEA 3B3WA 1HDUA 1F2PA 3PB4X 4UEEA 2AFOA 2PJ0A 2O53A 2AFSA 4R8FA 1HDQA 2PJBA 1ELLP 3BXMA 2ZEOA 1TKFA 6CPAA 2ZEMA 3GPOA 2AFUA 3SIJA 3CPAA 4MHNA 2XEGA 3FEDA 5E3BA 4TNUA 1H8LA 2G9DA 4WJBA 1F57A 2I3CA 3KL9A 1CG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAV A;  3PRT A;  3LWU A;  4NGT A;  4ONW A;  4NFR A;  1Z2L A;  4DYO A;  4LQG A;  3ETI A;  3NH5 A;  2PRQ A;  4R7M A;  5THW A;  4IK2 A;  3IEH A;  4MHP A;  1FNO A;  1SPV A;  1YW4 A;  5FSU A;  4OME A;  2PJ2 A;  2OR4 A;  5LRK A;  2OOT A;  4P4I A;  2FG1 A;  3B3C A;  1CPX A;  4P44 A;  2QJ8 A;  3GUX A;  1ARM A;  4NGR A;  3IIF A;  2EK9 A;  2GLJ A;  4J5Q A;  2CTC A;  4MHY A;  1ZLH A;  5AIL A;  1FT7 A;  4ZY2 A;  3IIB A;  4X8I A;  2F8H A;  1GYT A;  1YLO A;  2V8V A;  3GPG A;  3D7D A;  4P10 A;  5ELY A;  1NJR A;  3B35 A;  3BI0 A;  2L8R A;  5LYL A;  4JGK A;  2AFM A;  7CPA A;  3SIH A;  4G1P A;  2BCO A;  4UIB A;  4CPA A;  5HOL A;  3FMC A;  4UF4 A;  2BO9 A;  3CDX A;  1LAP A;  3EW5 A;  2C6C A;  2PJ3 A;  3GQO A;  4NJQ A;  4EFD A;  4JCA A;  2EK8 A;  3PB8 X;  4RUH A;  4DJL A;  3IFE A;  1VHE A;  3PFO A;  4A94 A;  3KHX A;  3SJX A;  2PJ1 A;  3D4U A;  1CX8 A;  4NGQ A;  4NGM A;  1VGY A;  3Q6Z A;  3PB7 X;  3IID A;  5K8P A;  2X47 A;  3KZW A;  4K3N A;  2ZEP A;  4OIW A;  4YWY A;  3H8F A;  4F9U A;  1IY7 A;  3B3S A;  1XFO A;  1R43 A;  1YW6 A;  3TC8 A;  2ZED A;  2NSM A;  1OBR A;  5IB9 A;  3S9N A;  4J4Z A;  4PPZ A;  4ABL A;  4TWE A;  2BOA A;  5CMS A;  1LOK A;  3V2B A;  1PYT B;  4NGP A;  2PJ9 A;  2HB6 A;  4OC1 A;  1CP6 A;  4O23 A;  3EWO A;  4P45 A;  4GVW A;  4D86 A;  3PB9 X;  3B7I A;  4NGS A;  1TXZ A;  3H8E A;  4IHM A;  3SJE A;  4ZI6 A;  2QYV A;  1BPN A;  3D67 A;  4MMO A;  3VAR A;  4A38 A;  2FVG A;  1VHU A;  3EWR A;  4P4J A;  2ZEF A;  5LYF A;  5K8M A;  3CT9 A;  4ZX8 A;  2AFW A;  1LCP A;  3K2K A;  3ISZ A;  4ETJ A;  2DEA A;  3D7G A;  1CBX A;  1KWM A;  3KQZ A;  3D66 A;  5CB5 A;  4PXB A;  2PVW A;  2CTB A;  4P4D A;  2RFH A;  3JRU A;  1TY8 A;  3HLP A;  2ANP A;  4OID A;  5LYD A;  2PJ4 A;  2XEF A;  3RBU A;  4OC2 A;  3K9T A;  3SIG A;  3WC7 A;  3FEC A;  3EJF A;  3KHZ A;  4KSI A;  2DX6 A;  2WYR A;  5LYI A;  1YD9 A;  3SJF A;  3NFZ A;  4UML A;  1ARL A;  3CPX A;  2XD7 A;  2QVP A;  2V77 A;  3GQE A;  4B6Z A;  3L2N A;  4OP4 A;  2PJA A;  2XEJ A;  5CBM A;  3SI2 A;  3SI0 A;  3KAS A;  4PXE A;  2BFR A;  5F09 A;  1R3N A;  3PB6 X;  4GVV A;  4OC3 A;  4MXU A;  3T8W A;  1AYE A;  4UIA A;  3FF3 A;  3S9M A;  1XJO A;  4JYW A;  1QQ9 A;  3D68 A;  3KGQ A;  3KR4 A;  4ZX9 A;  5LRG A;  1NSA A;  3KI9 A;  4H2K A;  3EKE A;  3PFE A;  4K0C A;  2ACF A;  4OC0 A;  4ABK A;  5D8N A;  4IAV A;  3B3V A;  5CPA A;  3TX8 A;  4J5S A;  4MCS A;  2EWB A;  3GLJ A;  2PIY A;  4P4B A;  3PEI A;  3V38 A;  3LMS A;  1HEE A;  4UEZ A;  2CIJ A;  4GUA A;  2AFC A;  4X2T A;  4R6T A;  3RAM A;  2Q43 A;  1CP7 A;  4MCP A;  4DUK A;  1IGB A;  5HVG A;  5HIH A;  2LGR A;  5HVF A;  1JQG A;  2NYQ A;  2V8G A;  2V8H A;  3V45 A;  2XEI A;  2ZEL A;  3B2Y A;  1Y0R A;  2J9A A;  5DS0 A;  4F8Z A;  5JM6 A;  1TKH A;  2Q51 A;  4ZY1 A;  2HC9 A;  1YME A;  3NA6 A;  3NH4 A;  4X3R A;  1DTD A;  3BI1 A;  5JH9 A;  3DGV A;  3WC6 A;  5FSX A;  4P6Y A;  2ZEH A;  3D7F A;  2V8D A;  2RB7 A;  1LAN A;  1UWY A;  4KYB A;  4EWT A;  5I4M A;  4AXV A;  2O4H A;  2AFX A;  5FSZ A;  2BFQ A;  4OC4 A;  3WAB A;  2EEE A;  1Q7L A;  3IC1 A;  1XRY A;  3JZT A;  3SJG A;  3KQX A;  2VRI A;  5LRJ A;  2PJ6 A;  3QNV A;  4ZY0 A;  2C1C A;  4IQY A;  3FH4 A;  2C6G A;  4ESS A;  2PJ5 A;  3PBB A;  4FWU A;  5JGF A;  2POK A;  2Q4Z A;  3FX6 A;  3Q71 A;  1EE3 P;  1VIX A;  4PQA A;  2FXK A;  4W9Y A;  5DUS A;  4GM5 A;  4JZ0 A;  2PJC A;  3SII A;  3V7Z A;  5J1Q A;  5D29 A;  8CPA A;  1HJZ A;  4NJR A;  1XBU A;  4MCR A;  4ZYQ A;  4ETK A;  1BLL E;  2ABZ A;  1ZG7 A;  4A39 A;  1Y0Y A;  5HXD A;  3MRU A;  2ZEE A;  2VL1 A;  3S9L A;  4P4E A;  2F7V A;  3I1U A;  1Z5R A;  3VFQ A;  4FUU A;  1ZLI A;  1TF8 A;  4OC5 A;  3IJ3 A;  3WC5 A;  3VAT A;  4FBE A;  4MHZ A;  5CB3 A;  4JVV A;  1M4L A;  2IMO A;  4MCQ A;  3NH8 A;  2C6P A;  4Q7A A;  4P4F A;  1LFW A;  1TF9 A;  2AFZ A;  3WT4 A;  5K8N A;  2PVV A;  4PXD A;  4R76 A;  2PE3 A;  2WZN A;  2PCU A;  4F9V A;  2GU2 A;  2FAV A;  3HUV A;  4FAI A;  4BD9 A;  4EME A;  1ZG9 A;  2IQ6 A;  1QMU A;  2JBJ A;  4WWV A;  4TU0 A;  2ZOF A;  1ZR5 A;  1ELM P;  3IWW A;  4OKO A;  1DE4 C;  3EJG A;  3N5F A;  2GLF A;  2ZEG A;  1TXR A;  5FSY A;  1LAM A;  3DLJ A;  3RZA A;  2ZOG A;  1PCA A;  3D7H A;  4YU9 A;  2CF4 A;  1VHO A;  2IJZ A;  2JEW A;  3SI1 A;  1CPS A;  3ISX A;  3H8G A;  3B3T A;  5K8O A;  3GPQ A;  3GB0 A;  1YSJ A;  3EWP A;  2PIZ A;  1AMP A;  4A37 A;  1RTQ A;  4UEF A;  5FSV A;  3BHX A;  3KR5 A;  3IO1 A;  2GRE A;  3FJU A;  5HVH A;  4JLL A;  2JBK A;  4NGN A;  2ZEN A;  3FVL A;  4MRI A;  1TKJ A;  1ZG8 A;  4PXC A;  1Z8L A;  2PJ8 A;  1BPM A;  1ZR3 A;  1F2O A;  4Z65 A;  1Y7E A;  4J5R A;  1XMB A;  3VH9 A;  2PJ7 A;  3EWQ A;  3FEE A;  3MN8 A;  3PBE A;  3B3W A;  1HDU A;  1F2P A;  3PB4 X;  4UEE A;  2AFO A;  2PJ0 A;  2O53 A;  2AFS A;  4R8F A;  1HDQ A;  2PJB A;  1ELL P;  3BXM A;  2ZEO A;  1TKF A;  6CPA A;  2ZEM A;  3GPO A;  2AFU A;  3SIJ A;  3CPA A;  4MHN A;  2XEG A;  3FED A;  5E3B A;  4TNU A;  1H8L A;  2G9D A;  4WJB A;  1F57 A;  2I3C A;  3KL9 A;  1CG2 A; 
#chains in the Genus database with same CATH topology
 1BAV A;  3PRT A;  3WR7 A;  1M4G A;  2YNC C;  3LWU A;  4NGT A;  1P0H A;  3TO7 A;  1IYK A;  2KCW A;  4ONW A;  4NFR A;  1KUY A;  1Z2L A;  4DYO A;  4AVB A;  5KTD A;  4LQG A;  3ETI A;  3TCV A;  3NH5 A;  2PRQ A;  3EO4 A;  4R7M A;  2P0W A;  5THW A;  4IK2 A;  3IEH A;  4XNH C;  4MHP A;  2HV2 A;  1FNO A;  1SPV A;  1QSN A;  1YW4 A;  4YRH A;  5FSU A;  1Y9W A;  4KOS A;  4OME A;  4Y49 C;  5FVJ A;  2PJ2 A;  2OR4 A;  5LRK A;  3GY9 A;  1WK4 A;  2ATR A;  2CY2 A;  4JWP A;  4KSF A;  2OOT A;  4P4I A;  2FG1 A;  3B3C A;  1CPX A;  4P44 A;  2QJ8 A;  3GUX A;  2D4O A;  1ARM A;  4NGR A;  4CRZ B;  3D8P A;  3IIF A;  1J4J A;  5HH1 A;  2EK9 A;  2GLJ A;  4MFQ A;  3SXO A;  4CAE A;  2JZE A;  4J5Q A;  2CTC A;  4MHY A;  3VWD A;  1ZLH A;  5AIL A;  4ORF A;  4B5P B;  1M4D A;  4MBU A;  1FT7 A;  4HNY B;  4ZY2 A;  3IIB A;  3TT2 A;  1NE9 A;  2F8H A;  3EC4 A;  4X8I A;  4XPD C;  3W6X A;  2OH1 A;  1GYT A;  2YGW A;  2HQY A;  2P6E A;  1YLO A;  2B4B A;  4DNC A;  4YFJ A;  4B12 A;  2B4D B;  2V8V A;  2OB0 A;  3LAC A;  1B6B A;  3GPG A;  4M85 A;  1WWZ A;  1TIQ A;  4AVA A;  3D7D A;  2R98 A;  4P10 A;  5ELY A;  1NJR A;  3BJ7 A;  3B35 A;  3BI0 A;  4KZT A;  2L8R A;  5LYL A;  4JGK A;  3R9G A;  2AFM A;  2WPX A;  4IF5 A;  7CPA A;  5AG6 A;  3SIH A;  4G1P A;  2BCO A;  1BO4 A;  4UIB A;  4CPA A;  5HOL A;  3FMC A;  4UF4 A;  2BO9 A;  2Z10 A;  5H84 A;  1SQH A;  3CDX A;  4UCP A;  4KOV A;  5EBV A;  1LAP A;  3EW5 A;  2C6C A;  2PJ3 A;  4UCM A;  4JJX A;  5EC4 A;  3CXP A;  3GQO A;  4GXH A;  4NJQ A;  4EFD A;  2J8N A;  4JCA A;  2EK8 A;  3PB8 X;  2AJ6 A;  4XNH B;  3IFE A;  4DJL A;  4RUH A;  1VHE A;  3PFO A;  4A94 A;  3I9S A;  3KHX A;  2RNK A;  4Y49 B;  3SJX A;  2PJ1 A;  2G3T A;  4AB7 A;  5IV0 A;  3FB3 A;  3D4U A;  1CX8 A;  4NGQ A;  4NGM A;  1VGY A;  1IID A;  2I00 A;  3Q6Z A;  2Q7B A;  3PB7 X;  3MGD A;  3EFA A;  3IID A;  5K8P A;  4C2Z A;  4CAV A;  2X47 A;  3KZW A;  4K3N A;  2ZEP A;  4OIW A;  1YGH A;  4YWY A;  3G8W A;  2WUU A;  3H8F A;  3R95 A;  4F9U A;  1IY7 A;  2Q4Y A;  3B3S A;  1XFO A;  5CNP A;  1R43 A;  1YW6 A;  3TC8 A;  2FL4 A;  2ZED A;  1QST A;  1GHE A;  2NSM A;  4FD4 A;  1OBR A;  4J3G A;  5IB9 A;  4J4Z A;  3S9N A;  4PPZ A;  4ABL A;  2R7H A;  4TWE A;  4XPD B;  2BOA A;  4B13 A;  2YND A;  4XPL A;  5CMS A;  1LOK A;  5G21 A;  4CAX A;  3ZJ0 A;  3V2B A;  1PYT B;  4NGP A;  2PJ9 A;  4E2A A;  2HUZ A;  2HB6 A;  2REE A;  4KVO E;  4OC1 A;  1CP6 A;  1AUG A;  4O23 A;  3EWO A;  3KKW A;  4P45 A;  4GVW A;  4D86 A;  3PB9 X;  3VWE A;  1IYL A;  3B7I A;  4JLY A;  3GYA A;  2JZD A;  4KUA A;  4NGS A;  1TXZ A;  4KOW A;  1MJA A;  3H8E A;  2OZG A;  2R8V A;  3PP9 A;  2EUI A;  4IHM A;  4QB9 A;  3SJE A;  3C26 A;  4ZI6 A;  2QYV A;  1R57 A;  1BPN A;  2B58 A;  2Q4V A;  5DWM A;  5F48 A;  3D67 A;  4MMO A;  3TE4 A;  3VAR A;  1MK4 A;  4A31 A;  4KOU A;  4BMH A;  4F6A A;  3E0K A;  2FIA A;  4EVY A;  2WCT A;  4FD7 A;  2VBQ A;  4KSA A;  4KS9 A;  4ZBG A;  2IL4 A;  2A4N A;  4A38 A;  1L0C A;  1PU9 A;  1VHU A;  1A2Z A;  3EWR A;  2EO8 A;  2FVG A;  3UY5 A;  4P4J A;  2ZEF A;  4CRY B;  5LYF A;  5K8M A;  1VKC A;  2Q0Y A;  3CT9 A;  4ZX8 A;  2AFW A;  1LCP A;  3B8G A;  3K2K A;  4PV6 A;  5BWA B;  3ISZ A;  4ETJ A;  2DEA A;  3D7G A;  3PZJ A;  4HNX B;  4AG9 A;  3H5Z A;  1CBX A;  1KWM A;  3KQZ A;  4NEX A;  2FCK A;  3D66 A;  4KOT A;  4KVM E;  5CB5 A;  4PXB A;  4C7I A;  4X5K A;  2PVW A;  2CTB A;  2JDC A;  4HNW B;  4A2Z A;  1KZF A;  4P4D A;  2RFH A;  3JRU A;  2VQY A;  1TY8 A;  4PK3 A;  3HLP A;  1IU8 A;  2ANP A;  4B10 A;  4OID A;  4KOX A;  4KOR A;  1YRE A;  5LYD A;  4M6I A;  2PJ4 A;  4RN7 A;  2XEF A;  2GFQ A;  3V8I A;  3CZX A;  3RBU A;  4OC2 A;  2Y0M A;  5A27 A;  2BUE A;  4CGL A;  3K9T A;  3SIG A;  4KUB A;  3WC7 A;  2Z3K A;  3FEC A;  3EJF A;  3KHZ A;  3NE8 A;  4KSI A;  3S6G A;  2DX6 A;  3DDD A;  2WYR A;  5LYI A;  2PQ8 A;  4RI1 A;  1YD9 A;  2VXK A;  3SJF A;  3NFZ A;  5I0C A;  4UML A;  1ARL A;  3CPX A;  2XD7 A;  2QVP A;  4F0Y A;  2V77 A;  4CGP A;  5C88 A;  3GQE A;  4MI4 A;  4B6Z A;  3L2N A;  4OLL A;  4OP4 A;  2PJA A;  1CM0 A;  4UFX A;  3TOA A;  1P4N A;  2XEJ A;  3GKR A;  5CBM A;  2J8M A;  4UFV A;  3TO9 A;  4C2X A;  3SI2 A;  3SI0 A;  2CNS A;  3IU1 A;  4KVX A;  3KAS A;  4PXE A;  2BFR A;  5F09 A;  3DSB A;  2RC4 A;  2BL1 A;  1R3N A;  3PB6 X;  4GVV A;  4OC3 A;  1M44 A;  3IWE A;  1KUX A;  1XF8 A;  2ZW5 A;  2C27 A;  2PSW A;  1Q2D A;  3T8W A;  1AYE A;  4MXU A;  4UIA A;  3FF3 A;  3RNZ A;  3S9M A;  5AG4 A;  1XJO A;  4JYW A;  3DR8 A;  2W2G A;  1QQ9 A;  3D68 A;  3KGQ A;  3KR4 A;  4ZX9 A;  1S7N A;  1YR0 A;  1NSA A;  3CXS A;  5LRG A;  4CGN A;  1OZP A;  1S5K A;  3KI9 A;  4H2K A;  1CJW A;  3EKE A;  3PFE A;  4K0C A;  3IGR A;  2ACF A;  2VZY A;  4OC0 A;  4ABK A;  5D8N A;  5HMN A;  4IAV A;  3B3V A;  5CPA A;  3TX8 A;  4J5S A;  4A30 A;  4MCS A;  2EWB A;  3GLJ A;  2GIV A;  4H89 A;  2PIY A;  4P4B A;  4PK2 A;  4CYQ A;  3PEI A;  4U5Y A;  3V38 A;  3LMS A;  3N7Z A;  4B14 A;  4CGO A;  1HEE A;  2ZW6 A;  3FNC A;  4UEZ A;  1XE4 A;  3T9Y A;  2CXA A;  2CIJ A;  4GUA A;  2AFC A;  4X2T A;  2Z3P A;  4R6T A;  3FRM A;  1K4J A;  2FE7 A;  1MJ9 A;  3NE7 A;  5G1Z A;  3R96 A;  3RAM A;  4A33 A;  4I49 A;  2ZXV A;  4M6H A;  2Q43 A;  1CP7 A;  4PSX A;  4MJ8 A;  2PC1 A;  4MCP A;  4DUK A;  1IGB A;  1YX0 A;  2PDO A;  5HVG A;  5HIH A;  4MFP A;  5AGE A;  4YGO A;  2LGR A;  3I3G A;  4JXQ A;  5HVF A;  3R9E A;  1JQG A;  2NYQ A;  2PR1 A;  2V8G A;  2V8H A;  3V45 A;  1Z8W A;  2XEI A;  4JXR A;  1XMT A;  2ZEL A;  3SHP A;  5C82 A;  3B2Y A;  1Y0R A;  2G3A A;  1MJB A;  2J9A A;  5DS0 A;  4F8Z A;  5JM6 A;  3LD2 A;  1TKH A;  1RXT A;  1UFH A;  2JEV A;  4AVC A;  2Q51 A;  4ZY1 A;  2HC9 A;  1YME A;  2J8R A;  2FSR A;  2PR8 A;  3NA6 A;  1DTD A;  3BI1 A;  2B5G A;  3NH4 A;  1Q2C A;  4X3R A;  4A95 A;  5J8C A;  1S7F A;  2VI7 A;  1QSR A;  5JH9 A;  2JDD A;  3DGV A;  3JTK A;  3FXT A;  3K9U A;  3RO0 A;  3WC6 A;  4C2Y A;  5FSX A;  4P6Y A;  1Z8T A;  1YK3 A;  2FS5 A;  2ZEH A;  3D7F A;  2QEC A;  2V8D A;  2VZZ A;  2RB7 A;  1LAN A;  1UWY A;  4KYB A;  4UA3 A;  4EWT A;  2PRB A;  3IWG A;  5I4M A;  4AXV A;  2O4H A;  1U6M A;  2AFX A;  2D4P A;  3S6K A;  3RYO A;  3QB8 A;  4MHD A;  4UBR A;  5FSZ A;  2BFQ A;  4OC4 A;  1IB1 E;  3WAB A;  4MFZ A;  2EEE A;  1Q7L A;  2O28 A;  3IC1 A;  1XRY A;  2R1I A;  3D3S A;  1ZO0 A;  3JZT A;  3S6F A;  4CAF A;  4L89 A;  1Z8X A;  3SJG A;  4FD6 A;  3KQX A;  4B11 A;  3CXQ A;  2VRI A;  1M1D A;  5LRJ A;  2PJ6 A;  1S60 A;  3QNV A;  2BSW A;  2DXQ A;  4ZY0 A;  2C1C A;  4LX9 A;  4IQY A;  3FH4 A;  2X7B A;  2C6G A;  4ESS A;  2PJ5 A;  3PBB A;  4FWU A;  2F5I A;  3EXN A;  5JGF A;  2ARH A;  1QSM A;  4H6U A;  2POK A;  4UWI A;  5AG7 A;  1S7K A;  2Q4Z A;  3FX6 A;  4B5P A;  4JD6 A;  4HPS A;  3BJ8 A;  4K30 A;  3Q71 A;  1EE3 P;  1VIX A;  4PQA A;  2FXK A;  2QIR A;  3ZZI A;  4W9Y A;  3IU2 A;  4CAW A;  2Q04 A;  4QUS A;  5DUS A;  2ZW7 A;  4GM5 A;  2B4D A;  1YQE A;  2PJC A;  3SII A;  4JZ0 A;  4R9M A;  2FIW A;  3V7Z A;  5J1Q A;  1Z9U A;  4MFL A;  5EMI A;  4CYP A;  1X10 A;  4BBH A;  5D29 A;  5IB0 A;  2KQV A;  2EVN A;  3EY5 A;  8CPA A;  2Z3M A;  2WSA A;  3TTH A;  4E8O A;  4MY3 A;  2YNC A;  1HJZ A;  4NJR A;  1XBU A;  4MCR A;  4FD5 A;  2AE6 A;  4ZYQ A;  2QML A;  4ETK A;  1NMT A;  1BLL E;  1XEB A;  2ABZ A;  4LQ6 A;  3W6S A;  1RO5 A;  1ZG7 A;  2Q7S A;  4R3K A;  4HKF A;  4A39 A;  2OU2 A;  1Y0Y A;  5HXD A;  3MRU A;  2ZEE A;  2ODF A;  1VHS A;  2VL1 A;  3F0A A;  2DF5 A;  1YVO A;  4U9Y A;  4CS0 B;  2H5M A;  4P4E A;  3S9L A;  2F7V A;  3I1U A;  4AG7 A;  1M4I A;  2FXF A;  4Q38 A;  1Z5R A;  4OAE A;  3P2F A;  3VFQ A;  3F8K A;  4FUU A;  4QVT A;  1ZLI A;  1TF8 A;  4OC5 A;  1X12 A;  3S6H A;  3IJ3 A;  3WC5 A;  4CYN A;  3VAT A;  4FBE A;  1N71 A;  1Y7R A;  4MHZ A;  4CGM A;  5CB3 A;  2Z3O A;  2Z3L A;  3FIX A;  4MFJ A;  3TO6 A;  4JVV A;  1M4L A;  4CYO A;  2IMO A;  4KOY A;  5DWN A;  4MCQ A;  1XIX A;  4MY0 A;  3JVN A;  5J8F A;  1S7L A;  3NH8 A;  5IX3 A;  2G0B A;  2C6P A;  4Q7A A;  4P4F A;  1LFW A;  2GE3 A;  5KTA A;  1TF9 A;  2AFZ A;  3WT4 A;  5K8N A;  2PVV A;  4PXD A;  5JPH A;  4R76 A;  2PE3 A;  2WZN A;  4PSW A;  1JWQ A;  3FBU A;  2PCU A;  3A9L A;  1B87 A;  3JUW A;  4F9V A;  2GU2 A;  4KLV A;  5A28 A;  2FAV A;  3HUV A;  4UCN A;  2YNE A;  4FAI A;  4BD9 A;  4EME A;  3BLN A;  1ON0 A;  1ZG9 A;  2IQ6 A;  1QMU A;  2JBJ A;  4KLW A;  4WWV A;  4TU0 A;  2P6G A;  2ZOF A;  3H4Q A;  1ZR5 A;  1ELM P;  2CNM A;  3IWW A;  4OAD A;  2OZU A;  4OKO A;  1Z4E A;  1DE4 C;  2Q44 A;  3EJG A;  3N5F A;  4M3S A;  2DPS A;  4R3L A;  5JQ4 A;  2B3U A;  2GLF A;  2ZEG A;  1TXR A;  2Z11 A;  5FSY A;  1LAM A;  3DLJ A;  3W91 A;  2K5T A;  1Z4R A;  2GAN A;  2WPW A;  3RZA A;  4B5O A;  4E0A A;  2ZOG A;  5E96 A;  1PCA A;  3D7H A;  2DPT A;  4Q36 A;  2P6F A;  3QAH A;  2CF4 A;  4YU9 A;  1VHO A;  5G20 A;  2OZH A;  3R1K A;  2IJZ A;  2JEW A;  1Y9K A;  1CPS A;  3ISX A;  3DR6 A;  3SI1 A;  3H8G A;  2B3V A;  4QBJ A;  3B3T A;  5K8O A;  2Z3N A;  1YVK A;  5G22 A;  3GPQ A;  3GB0 A;  5GCN A;  4NSQ A;  5F46 A;  4II9 A;  1YSJ A;  3EWP A;  2ZW4 A;  4F0X A;  4U9Z A;  1S3Z A;  3OWC A;  4BIN A;  2PIZ A;  4NXY A;  1AMP A;  4A37 A;  1Q2Y A;  1RTQ A;  4UEF A;  3QAY A;  1I21 A;  3SXN A;  5FSV A;  4ONU A;  3BHX A;  3KR5 A;  5ISV A;  1IOI A;  3GIU A;  5AG5 A;  3R9F A;  4RS2 A;  2Z0Z A;  3IO1 A;  2REF A;  2GRE A;  3TFY A;  3FJU A;  5HVH A;  4JLL A;  2JBK A;  2I79 A;  4NGN A;  2ZEN A;  3FVL A;  4MRI A;  2JZF A;  4C68 A;  1TKJ A;  2CNT A;  3PGP A;  5F47 A;  1ZG8 A;  4PXC A;  1Z8L A;  2PJ8 A;  1BPM A;  1YLE A;  5H86 A;  1ZR3 A;  5KTC A;  5F49 A;  1F2O A;  4LUA A;  4Z65 A;  4M6G A;  1Y7E A;  4J5R A;  1XMB A;  1I1D A;  2NMT A;  3VH9 A;  4UFW A;  4XPK A;  3F5B A;  2PJ7 A;  3EWQ A;  3FEE A;  3MN8 A;  2ZPA A;  3D2M A;  3DNS A;  1IOF A;  1IIC A;  1KUV A;  4R57 A;  3PBE A;  4C7H A;  3B3W A;  1HDU A;  4L8A A;  1F2P A;  3PB4 X;  4UEE A;  1BOB A;  2JLM A;  2AFO A;  3D2P A;  4IUS A;  2PJ0 A;  1XOV A;  2O53 A;  3T90 A;  3FYN A;  1PUA A;  4NCZ A;  2AFS A;  4GS4 A;  4R8F A;  3LOD A;  1HDQ A;  3TOB A;  2PJB A;  4UWJ A;  1LRZ A;  2FT0 A;  1ELL P;  3BXM A;  2ZEO A;  1TKF A;  6CPA A;  2ZEM A;  1QSO A;  3GPO A;  4NF1 A;  2AFU A;  1NSL A;  3SIJ A;  3CPA A;  2BEI A;  4MHN A;  3G3S A;  2XEG A;  4A32 A;  3FED A;  5E3B A;  2VEZ A;  1FY7 A;  4ZGY B;  3P2H A;  1V0C A;  2B5G B;  4TNU A;  1I12 A;  1H8L A;  4MFK A;  4R87 A;  2G9D A;  4QC6 A;  4WJB A;  1F57 A;  4H6Z A;  2EBJ A;  2I3C A;  3KL9 A;  1CG2 A; 
#chains in the Genus database with same CATH homology
 1BAV A;  3PRT A;  3LWU A;  4NGT A;  4ONW A;  4NFR A;  1Z2L A;  4DYO A;  4LQG A;  3ETI A;  3NH5 A;  2PRQ A;  4R7M A;  5THW A;  4IK2 A;  3IEH A;  4MHP A;  1FNO A;  1SPV A;  1YW4 A;  5FSU A;  4OME A;  2PJ2 A;  2OR4 A;  5LRK A;  2OOT A;  4P4I A;  2FG1 A;  3B3C A;  1CPX A;  4P44 A;  2QJ8 A;  3GUX A;  1ARM A;  4NGR A;  3IIF A;  2EK9 A;  2GLJ A;  4J5Q A;  2CTC A;  4MHY A;  1ZLH A;  5AIL A;  1FT7 A;  4ZY2 A;  3IIB A;  4X8I A;  2F8H A;  1GYT A;  1YLO A;  2V8V A;  3GPG A;  3D7D A;  4P10 A;  5ELY A;  1NJR A;  3B35 A;  3BI0 A;  2L8R A;  5LYL A;  4JGK A;  2AFM A;  7CPA A;  3SIH A;  4G1P A;  2BCO A;  4UIB A;  4CPA A;  5HOL A;  3FMC A;  4UF4 A;  2BO9 A;  3CDX A;  1LAP A;  3EW5 A;  2C6C A;  2PJ3 A;  3GQO A;  4NJQ A;  4EFD A;  4JCA A;  2EK8 A;  3PB8 X;  4RUH A;  4DJL A;  3IFE A;  1VHE A;  3PFO A;  4A94 A;  3KHX A;  3SJX A;  2PJ1 A;  3D4U A;  1CX8 A;  4NGQ A;  4NGM A;  1VGY A;  3Q6Z A;  3PB7 X;  3IID A;  5K8P A;  2X47 A;  3KZW A;  4K3N A;  2ZEP A;  4OIW A;  4YWY A;  3H8F A;  4F9U A;  1IY7 A;  3B3S A;  1XFO A;  1R43 A;  1YW6 A;  3TC8 A;  2ZED A;  2NSM A;  1OBR A;  5IB9 A;  3S9N A;  4J4Z A;  4PPZ A;  4ABL A;  4TWE A;  2BOA A;  5CMS A;  1LOK A;  3V2B A;  1PYT B;  4NGP A;  2PJ9 A;  2HB6 A;  4OC1 A;  1CP6 A;  4O23 A;  3EWO A;  4P45 A;  4GVW A;  4D86 A;  3PB9 X;  3B7I A;  4NGS A;  1TXZ A;  3H8E A;  4IHM A;  3SJE A;  4ZI6 A;  2QYV A;  1BPN A;  3D67 A;  4MMO A;  3VAR A;  4A38 A;  2FVG A;  1VHU A;  3EWR A;  4P4J A;  2ZEF A;  5LYF A;  5K8M A;  3CT9 A;  4ZX8 A;  2AFW A;  1LCP A;  3K2K A;  3ISZ A;  4ETJ A;  2DEA A;  3D7G A;  1CBX A;  1KWM A;  3KQZ A;  3D66 A;  5CB5 A;  4PXB A;  2PVW A;  2CTB A;  4P4D A;  2RFH A;  3JRU A;  1TY8 A;  3HLP A;  2ANP A;  4OID A;  5LYD A;  2PJ4 A;  2XEF A;  3RBU A;  4OC2 A;  3K9T A;  3SIG A;  3WC7 A;  3FEC A;  3EJF A;  3KHZ A;  4KSI A;  2DX6 A;  2WYR A;  5LYI A;  1YD9 A;  3SJF A;  3NFZ A;  4UML A;  1ARL A;  3CPX A;  2XD7 A;  2QVP A;  2V77 A;  3GQE A;  4B6Z A;  3L2N A;  4OP4 A;  2PJA A;  2XEJ A;  5CBM A;  3SI2 A;  3SI0 A;  3KAS A;  4PXE A;  2BFR A;  5F09 A;  1R3N A;  3PB6 X;  4GVV A;  4OC3 A;  4MXU A;  3T8W A;  1AYE A;  4UIA A;  3FF3 A;  3S9M A;  1XJO A;  4JYW A;  1QQ9 A;  3D68 A;  3KGQ A;  3KR4 A;  4ZX9 A;  5LRG A;  1NSA A;  3KI9 A;  4H2K A;  3EKE A;  3PFE A;  4K0C A;  2ACF A;  4OC0 A;  4ABK A;  5D8N A;  4IAV A;  3B3V A;  5CPA A;  3TX8 A;  4J5S A;  4MCS A;  2EWB A;  3GLJ A;  2PIY A;  4P4B A;  3PEI A;  3V38 A;  3LMS A;  1HEE A;  4UEZ A;  2CIJ A;  4GUA A;  2AFC A;  4X2T A;  4R6T A;  3RAM A;  2Q43 A;  1CP7 A;  4MCP A;  4DUK A;  1IGB A;  5HVG A;  5HIH A;  2LGR A;  5HVF A;  1JQG A;  2NYQ A;  2V8G A;  2V8H A;  3V45 A;  2XEI A;  2ZEL A;  3B2Y A;  1Y0R A;  2J9A A;  5DS0 A;  4F8Z A;  5JM6 A;  1TKH A;  2Q51 A;  4ZY1 A;  2HC9 A;  1YME A;  3NA6 A;  3NH4 A;  4X3R A;  1DTD A;  3BI1 A;  5JH9 A;  3DGV A;  3WC6 A;  5FSX A;  4P6Y A;  2ZEH A;  3D7F A;  2V8D A;  2RB7 A;  1LAN A;  1UWY A;  4KYB A;  4EWT A;  5I4M A;  4AXV A;  2O4H A;  2AFX A;  5FSZ A;  2BFQ A;  4OC4 A;  3WAB A;  2EEE A;  1Q7L A;  3IC1 A;  1XRY A;  3JZT A;  3SJG A;  3KQX A;  2VRI A;  5LRJ A;  2PJ6 A;  3QNV A;  4ZY0 A;  2C1C A;  4IQY A;  3FH4 A;  2C6G A;  4ESS A;  2PJ5 A;  3PBB A;  4FWU A;  5JGF A;  2POK A;  2Q4Z A;  3FX6 A;  3Q71 A;  1EE3 P;  1VIX A;  4PQA A;  2FXK A;  4W9Y A;  5DUS A;  4GM5 A;  4JZ0 A;  2PJC A;  3SII A;  3V7Z A;  5J1Q A;  5D29 A;  8CPA A;  1HJZ A;  4NJR A;  1XBU A;  4MCR A;  4ZYQ A;  4ETK A;  1BLL E;  2ABZ A;  1ZG7 A;  4A39 A;  1Y0Y A;  5HXD A;  3MRU A;  2ZEE A;  2VL1 A;  3S9L A;  4P4E A;  2F7V A;  3I1U A;  1Z5R A;  3VFQ A;  4FUU A;  1ZLI A;  1TF8 A;  4OC5 A;  3IJ3 A;  3WC5 A;  3VAT A;  4FBE A;  4MHZ A;  5CB3 A;  4JVV A;  1M4L A;  2IMO A;  4MCQ A;  3NH8 A;  2C6P A;  4Q7A A;  4P4F A;  1LFW A;  1TF9 A;  2AFZ A;  3WT4 A;  5K8N A;  2PVV A;  4PXD A;  4R76 A;  2PE3 A;  2WZN A;  2PCU A;  4F9V A;  2GU2 A;  2FAV A;  3HUV A;  4FAI A;  4BD9 A;  4EME A;  1ZG9 A;  2IQ6 A;  1QMU A;  2JBJ A;  4WWV A;  4TU0 A;  2ZOF A;  1ZR5 A;  1ELM P;  3IWW A;  4OKO A;  1DE4 C;  3EJG A;  3N5F A;  2GLF A;  2ZEG A;  1TXR A;  5FSY A;  1LAM A;  3DLJ A;  3RZA A;  2ZOG A;  1PCA A;  3D7H A;  4YU9 A;  2CF4 A;  1VHO A;  2IJZ A;  2JEW A;  3SI1 A;  1CPS A;  3ISX A;  3H8G A;  3B3T A;  5K8O A;  3GPQ A;  3GB0 A;  1YSJ A;  3EWP A;  2PIZ A;  1AMP A;  4A37 A;  1RTQ A;  4UEF A;  5FSV A;  3BHX A;  3KR5 A;  3IO1 A;  2GRE A;  3FJU A;  5HVH A;  4JLL A;  2JBK A;  4NGN A;  2ZEN A;  3FVL A;  4MRI A;  1TKJ A;  1ZG8 A;  4PXC A;  1Z8L A;  2PJ8 A;  1BPM A;  1ZR3 A;  1F2O A;  4Z65 A;  1Y7E A;  4J5R A;  1XMB A;  3VH9 A;  2PJ7 A;  3EWQ A;  3FEE A;  3MN8 A;  3PBE A;  3B3W A;  1HDU A;  1F2P A;  3PB4 X;  4UEE A;  2AFO A;  2PJ0 A;  2O53 A;  2AFS A;  4R8F A;  1HDQ A;  2PJB A;  1ELL P;  3BXM A;  2ZEO A;  1TKF A;  6CPA A;  2ZEM A;  3GPO A;  2AFU A;  3SIJ A;  3CPA A;  4MHN A;  2XEG A;  3FED A;  5E3B A;  4TNU A;  1H8L A;  2G9D A;  4WJB A;  1F57 A;  2I3C A;  3KL9 A;  1CG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...