4ZX8A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 9b
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 174
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx8A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx8A02
2LGRA 4W9YA 3SIHA 4X2TA 5CPAA 3PB6X 3NH5A 1YSJA 3EJGA 2OOTA 3FVLA 4NGMA 4F9VA 2BFQA 1XRYA 5K8NA 4R7MA 4NJQA 1CPXA 2PCUA 2ZEFA 4F8ZA 2HB6A 1Z5RA 2EWBA 3B2YA 2WZNA 4R76A 3GQOA 4A37A 3B3CA 5LYIA 1SPVA 5JGFA 5K8MA 1FT7A 4MHYA 5CMSA 1NJRA 4PXBA 2GU2A 4PXEA 3NH8A 1PCAA 2CTBA 4JCAA 3D7GA 3WC5A 2ZEMA 1GYTA 3IIDA 3WC6A 3D67A 1TY8A 1TKJA 1TKFA 2PJ6A 3VATA 3B3SA 2QJ8A 3GPOA 3PFOA 4ABKA 1CX8A 2CF4A 1JQGA 1XFOA 2DX6A 3EWQA 2ACFA 1LAPA 2AFWA 4P4FA 2CTCA 1M4LA 3IEHA 5FSZA 1OBRA 4B6ZA 2AFZA 2RB7A 2PVWA 1AYEA 2GREA 4UF4A 3FMCA 4P4DA 2F8HA 5F09A 4ZX9A 1ARMA 2EK9A 5AILA 3IIBA 2C6PA 4MHPA 1LANA 3HLPA 1YMEA 1CG2A 1ZG9A 1YW6A 3FJUA 1KWMA 2AFCA 1XBUA 2JBKA 3IJ3A 4UIBA 3B3WA 4WWVA 4MRIA 1YW4A 5K8OA 1VGYA 1LFWA 3GLJA 1BPMA 3GUXA 2V8GA 4FUUA 3TX8A 4K3NA 4KYBA 4NGRA 5HVFA 1TF8A 2IMOA 3FX6A 3D7DA 3PB9X 1F2PA 5FSYA 1RTQA 2XD7A 4FBEA 2ZEGA 4X8IA 3ISXA 4PXDA 4MCPA 3PB4X 2C1CA 3D66A 3GPGA 2PJ1A 3SJGA 3PBEA 3SI1A 4WJBA 3Q6ZA 2XEGA 4P4EA 3SI0A 3ISZA 3GQEA 5THWA 4GM5A 3ETIA 5CBMA 4YWYA 1H8LA 2AFUA 1ZG8A 3S9MA 4IK2A 1F2OA 4TU0A 2Q43A 3LMSA 2Q51A 2PJ2A 5LYDA 3Q71A 4IQYA 3HUVA 3T8WA 4A38A 2F7VA 2PJ3A 2ZEEA 4MMOA 3V45A 4NGSA 3EWOA 2FXKA 1TXRA 4LQGA 2FAVA 5D8NA 3S9NA 4ZYQA 4UIAA 4MHNA 1Z8LA 3JZTA 2PJ4A 4EFDA 1TKHA 4NGPA 4P10A 1AMPA 2PJCA 1XMBA 3SIGA 2FG1A 3IO1A 2POKA 2ANPA 4UEFA 3BXMA 1Q7LA 4KSIA 3D68A 2AFSA 3LWUA 4ABLA 4ZX8A 2C6CA 1Y0YA 3VH9A 2X47A 3IFEA 5DUSA 2ZEPA 3I1UA 5FSXA 5LYLA 1ARLA 1QQ9A 1VIXA 4DJLA 7CPAA 4MCSA 2V8VA 4NGNA 4IHMA 3B7IA 4OMEA 5LRJA 4PQAA 4A94A 2C6GA 3SJFA 4J5SA 3B35A 4DYOA 3JRUA 5IB9A 5LYFA 1Y7EA 4P4JA 4X3RA 3H8GA 4ETJA 4P44A 1BAVA 2ZEDA 3FEDA 3SJXA 3CDXA 1ZR3A 5I4MA 3KL9A 1TXZA 1HEEA 1PYTB 3H8EA 5JH9A 4D86A 3D7HA 4ZY1A 3KR4A 4OC0A 5LRKA 4PPZA 3K9TA 3VARA 5CB5A 1IY7A 2JEWA 4H2KA 2FVGA 3NFZA 1VHEA 2BFRA 1CP7A 4ZI6A 3BI1A 3KASA 3PEIA 4CPAA 2VRIA 3N5FA 5LRGA 5J1QA 4A39A 2PJ5A 2NSMA 4JYWA 1R3NA 2I3CA 4J4ZA 2PJBA 4JGKA 4MHZA 1HJZA 4DUKA 4JVVA 2PJ8A 4O23A 5D29A 5HOLA 3EKEA 5K8PA 2DEAA 3S9LA 2V8HA 4FAIA 4OC3A 3VFQA 1HDQA 4MCRA 4Z65A 4P6YA 2PJ9A 2Q4ZA 2EK8A 3CT9A 3WABA 2BCOA 4OIWA 2ZOGA 5HXDA 4MXUA 3PB7X 1IGBA 3RZAA 2ZENA 3NH4A 3KHXA 2EEEA 3D7FA 4P4BA 1ZLIA 2O4HA 3SJEA 5CB3A 3BI0A 2JBJA 2ZEHA 1BLLE 2PJAA 4OKOA 4OC5A 2QVPA 5HVHA 3MRUA 3MN8A 2PRQA 5E3BA 4K0CA 4OP4A 3PBBA 3TC8A 5HVGA 4FWUA 4EMEA 2WYRA 1ZG7A 4JZ0A 1ELLP 4GVWA 4ESSA 3FECA 2QYVA 3V7ZA 1QMUA 2BO9A 4GUAA 2XEJA 4P45A 4EWTA 2OR4A 4TNUA 1R43A 5JM6A 1LOKA 4AXVA 3IC1A 4MCQA 4OC2A 3H8FA 1VHUA 4P4IA 3GB0A 1HDUA 5FSUA 2BOAA 2PJ0A 1UWYA 2PIYA 3KHZA 4Q7AA 3PB8X 1FNOA 2HC9A 3DGVA 1LCPA 4NGQA 4ONWA 8CPAA 2ZELA 4OC4A 3CPXA 4OC1A 1NSAA 2G9DA 2ZEOA 3V2BA 4JLLA 3EJFA 3KZWA 4RUHA 3KR5A 4ZY2A 1CBXA 3KI9A 2O53A 3RBUA 3WT4A 3CPAA 5FSVA 1ZR5A 3WC7A 1DE4C 2IJZA 1YLOA 2ABZA 3FF3A 3L2NA 6CPAA 4PXCA 3SI2A 4NJRA 2GLJA 2RFHA 3RAMA 2XEIA 3PRTA 4GVVA 1EE3P 2NYQA 1ELMP 2ZOFA 3B3VA 1ZLHA 1BPNA 5HIHA 3KGQA 4F9UA 3SIIA 2IQ6A 4ETKA 4OIDA 4UMLA 1F57A 4ZY0A 1TF9A 4UEEA 2L8RA 3B3TA 1Z2LA 4R6TA 2XEFA 2J9AA 3EWPA 3GPQA 2CIJA 3D4UA 4J5RA 4G1PA 2V8DA 3PFEA 3KQXA 1Y0RA 2PIZA 4BD9A 2AFMA 4YU9A 2V77A 3IIFA 2PVVA 2AFXA 3K2KA 4IAVA 1DTDA 3QNVA 2AFOA 1CP6A 2PJ7A 3FH4A 3DLJA 3V38A 5ELYA 3EWRA 1XJOA 4J5QA 1VHOA 3EW5A 2GLFA 2VL1A 4UEZA 3KQZA 3NA6A 3SIJA 1CPSA 1YD9A 4NFRA 5DS0A 4NGTA 4TWEA 1LAMA 2PE3A 3BHXA 3IWWA 4R8FA 3FEEA
chains in the Genus database with same CATH superfamily
2LGRA 4W9YA 2REFA 3DR8A 3SIHA 4KOUA 4FD6A 4X2TA 3CXSA 5CPAA 3PB6X 2Z3MA 3NH5A 1YSJA 3EJGA 2OOTA 5C88A 3FVLA 1R57A 1K4JA 4NGMA 4F9VA 2BFQA 2YNCC 2PR8A 1XRYA 3FYNA 4FD4A 4KOSA 5AG6A 5K8NA 4R7MA 4NJQA 1CPXA 2PCUA 1MJBA 2ZEFA 4F8ZA 2HB6A 1Z5RA 2ZW7A 2EWBA 3B2YA 2PRBA 1J4JA 2WZNA 4R76A 3VWEA 3GQOA 4A37A 2R98A 3S6FA 5C82A 3TTHA 5I0CA 4B14A 4C2XA 3GY9A 2HV2A 2WUUA 3B3CA 4UFXA 5LYIA 1SPVA 1KUYA 2GE3A 4QBJA 5G22A 5JGFA 2EBJA 2Y0MA 5K8MA 1FT7A 4MHYA 1RO5A 3CXPA 3FIXA 5CMSA 1NJRA 3I3GA 4PXBA 2GU2A 4YRHA 2HQYA 1X12A 3FEEA 5F47A 4PXEA 3NH8A 2BEIA 1PCAA 1IYLA 1FY7A 4JCAA 2CTBA 1I21A 4JJXA 3D7GA 3WC5A 3VWDA 4AVCA 2ZEMA 1GYTA 3IIDA 5FVJA 3D67A 1TY8A 3WC6A 2KQVA 1TKJA 2RC4A 1TKFA 2PJ6A 3VATA 3B3SA 4CAVA 2QJ8A 3GPOA 2ARHA 3PFOA 4ABKA 1CX8A 2CF4A 4R3KA 1JQGA 4CGPA 1XFOA 2DX6A 5G1ZA 1SQHA 2JEVA 1YREA 2BSWA 2WPXA 1QSMA 3F5BA 1S3ZA 4IUSA 3JTKA 4RS2A 2CNMA 3ZJ0A 2Z0ZA 3EWQA 4KSFA 2ACFA 2HUZA 2Q44A 1YVOA 1LAPA 5H86A 4L8AA 4YGOA 1BO4A 3D3SA 3E0KA 3TO9A 2ZW6A 2AFWA 1XMTA 4P4FA 4UBRA 1VKCA 2CTCA 3IGRA 4E0AA 1M4LA 3IEHA 5FSZA 1OBRA 1P4NA 2OZUA 4B6ZA 2AFZA 2RB7A 2PVWA 1AYEA 2GREA 2K5TA 1AUGA 2D4PA 2F8HA 3FMCA 2FL4A 4P4DA 3T9YA 5F09A 2DPSA 4ZX9A 2QIRA 2B3UA 2QECA 4Y49C 1ARMA 2EK9A 2Z3NA 3R9EA 2JDDA 5AILA 3S6KA 4MHDA 3IU2A 4UA3A 2JZFA 3IIBA 2C6PA 3ZZIA 3GIUA 4F6AA 4MHPA 1LANA 3HLPA 1WWZA 1M44A 1CG2A 1S7FA 1YMEA 1ZG9A 1YW6A 3FJUA 3QAHA 1KWMA 2AFCA 4U9YA 1XBUA 2JBKA 5F49A 3IJ3A 4UIBA 2VZZA 2YNDA 4JXRA 4KLWA 3B3WA 4WWVA 4MRIA 1YW4A 4A31A 2Q7BA 4CGOA 5GCNA 5K8OA 1VGYA 1LFWA 3GLJA 4LUAA 4MFJA 1BPMA 3GUXA 1Q2YA 2J8MA 2V8GA 1L0CA 4FUUA 3TX8A 4K3NA 2Q0YA 3FRMA 4KYBA 1U6MA 3IU1A 4H6UA 4KVME 4NGRA 5HVFA 4CYNA 1TF8A 2IMOA 2ZPAA 3K9UA 4LQ6A 3FX6A 5CNPA 1Z9UA 3D7DA 3PB9X 1F2PA 4HNXB 5FSYA 1IIDA 1M4IA 1RTQA 2FIAA 4OKOA 4AB7A 2XD7A 1Q2CA 4X5KA 4FBEA 2ZEGA 4X8IA 3ISXA 4PXDA 4MCPA 3PB4X 2C1CA 3D66A 3GPGA 1TIQA 2PJ1A 1Z8WA 4MBUA 4R8FA 5DWNA 3SJGA 1P0HA 4M6GA 3EFAA 3PBEA 4CRYB 3SI1A 4B5PA 2YNCA 4WJBA 5A28A 3Q6ZA 2FCKA 3T90A 3BLNA 2XEGA 4P4EA 3SI0A 2R8VA 3ISZA 2GIVA 4CGMA 5AG7A 1Z4RA 3GQEA 3PP9A 2H5MA 4R57A 4ONUA 4KVOE 5THWA 1A2ZA 4GM5A 4BMHA 3RNZA 3ETIA 5CBMA 4YWYA 4F0YA 1H8LA 4QVTA 4A30A 4CGLA 4CYQA 3CZXA 3TOBA 3F8KA 2AFUA 2OH1A 3PGPA 4B12A 1YQEA 1ZG8A 3S9MA 2ZXVA 4IK2A 1F2OA 4TU0A 2Q43A 2GANA 2WPWA 3LMSA 1BOBA 3LACA 4LX9A 1NE9A 4XPKA 2FXFA 3KKWA 4B10A 4H89A 4DNCA 2Q51A 5F46A 2PJ2A 5LYDA 3Q71A 5F48A 3P2FA 2FE7A 4IQYA 3HUVA 3T8WA 4A38A 1XEBA 2F7VA 1M4DA 2PJ3A 2JDCA 2ZEEA 4MY3A 4B5PB 4MMOA 4BBHA 4C68A 1CM0A 5G20A 3V45A 4NGSA 4A2ZA 4L89A 1Z4EA 4C2YA 3EWOA 3SXNA 2FXKA 4F0XA 2DXQA 3EXNA 1TXRA 4JWPA 2FAVA 4LQGA 1Z8TA 3TO6A 5D8NA 4ZBGA 3P2HA 3R96A 3WR7A 1KUXA 3S9NA 4ZYQA 4UIAA 4MHNA 1Z8LA 3JZTA 2PJ4A 4M6HA 1ZO0A 1TKHA 2VQYA 4NGPA 4XNHC 4EFDA 4AG9A 4P10A 4PSWA 4OADA 4RI1A 1AMPA 2PJCA 1XMBA 3SIGA 2FG1A 2EUIA 2POKA 2ANPA 3G8WA 3IO1A 3NE8A 4ORFA 2AJ6A 4UEFA 3EY5A 5A27A 5J8CA 3F0AA 4KVXA 1KUVA 3BXMA 4UFVA 1Q7LA 2Z3KA 4KSIA 3D68A 4C7IA 3W6SA 1S7KA 1UFHA 2AFSA 2EO8A 3LWUA 4ABLA 1IOFA 4ZX8A 4B11A 2C6CA 1NSLA 1Y0YA 4H6ZA 3VH9A 2WCTA 2X47A 3IFEA 4NF1A 5DUSA 2ZEPA 3I1UA 3DSBA 5FSXA 5LYLA 4M6IA 1ARLA 4E8OA 2REEA 5KTAA 1CJWA 4CAWA 1QQ9A 1VIXA 2JLMA 3FBUA 2P0WA 3MGDA 4MY0A 4DJLA 7CPAA 4NXYA 4HNYB 4KZTA 4MCSA 2V8VA 4NGNA 4IHMA 1YR0A 2B4BA 3B7IA 3C26A 3TCVA 2WSAA 1IYKA 1V0CA 4OMEA 4MI4A 5LRJA 1B6BA 4PQAA 4A94A 2C6GA 1XE4A 3SJFA 4J5SA 3B35A 4PK3A 4FD7A 2Z3OA 3JRUA 4CRZB 4DYOA 4AVAA 5IB9A 4E2AA 5LYFA 1Y7EA 4P4JA 4X3RA 3LD2A 3H8GA 4ETJA 4KSAA 4CS0B 4P44A 4CAXA 2P6GA 1BAVA 2QMLA 2ZEDA 3FEDA 3CDXA 3SJXA 3R9FA 1ZR3A 2KCWA 3D2PA 3H5ZA 5I4MA 4B13A 3KL9A 5JPHA 1TXZA 1HEEA 1PYTB 3H8EA 4A33A 5JH9A 3DNSA 3R1KA 2VEZA 4D86A 4UFWA 3SXOA 3D7HA 1I1DA 4GXHA 2Z10A 2FT0A 4ZY1A 3KR4A 1JWQA 4OC0A 5LRKA 4Y49B 4KOVA 4PPZA 3K9TA 3VARA 5CB5A 3JUWA 5J8FA 1IY7A 1YX0A 1QSTA 4PV6A 2Z3PA 3EC4A 3S6GA 5IX3A 1Y7RA 2JEWA 2D4OA 2FVGA 4H2KA 4KORA 3NFZA 4OAEA 1VHEA 4CYOA 2BFRA 4M3SA 4CAFA 2VZYA 4RN7A 3R95A 1CP7A 2G0BA 4YFJA 4ZI6A 3BI1A 2OZGA 2Q04A 1QSNA 3KASA 3TFYA 1RXTA 3PEIA 2PC1A 4CPAA 2VRIA 2O28A 5EC4A 2IL4A 2FIWA 3B8GA 1PUAA 3N5FA 5LRGA 2P6EA 2FS5A 2BUEA 5J1QA 2JZEA 4UWIA 3V8IA 4A39A 2PJ5A 2CY2A 2DPTA 2NSMA 4JYWA 1R3NA 2B3VA 4KOWA 4MFLA 4MFPA 1OZPA 1IB1E 5JQ4A 1S5KA 2I3CA 2CNTA 4J4ZA 2CNSA 3H4QA 4HPSA 2PJBA 4JGKA 4MHZA 2Z3LA 4KOTA 1HJZA 3DDDA 4DUKA 4JVVA 3NE7A 2PJ8A 4O23A 4U5YA 5D29A 5HOLA 3EKEA 4JD6A 5K8PA 3I9SA 2BL1A 1IOIA 2ZW4A 2DEAA 4R3LA 3S9LA 4NSQA 1QSOA 2V8HA 4FAIA 4UF4A 3DR6A 1M1DA 4A32A 4OC3A 3VFQA 1HDQA 2B5GB 4MCRA 4Z65A 3GYAA 4P6YA 2B4DB 2OU2A 2PJ9A 2Q4ZA 5AG5A 2DF5A 2EK8A 4AG7A 3CT9A 3FB3A 3WABA 2I00A 4XPLA 3D8PA 2A4NA 3EO4A 4EVYA 2BCOA 5BWAB 3QB8A 4OIWA 2ZOGA 4QB9A 5HXDA 4MXUA 3PB7X 2Z11A 1IGBA 3RZAA 2ZENA 5AGEA 3NH4A 3KHXA 1N71A 2EEEA 3D7FA 1XF8A 4P4BA 1ON0A 4C2ZA 1ZLIA 2O4HA 2X7BA 2W2GA 5CB3A 3BI0A 2JBJA 2ZEHA 1BLLE 2PJAA 2VXKA 4JLYA 2QVPA 3BJ8A 5HVHA 3MRUA 3MN8A 2P6FA 2PRQA 5E3BA 4K0CA 1MJAA 2Q4VA 3PBBA 4OP4A 3SHPA 2JZDA 3TC8A 4ZGYB 2PDOA 5HVGA 1PU9A 1Y9WA 4FWUA 4EMEA 2PR1A 5DWMA 2Q7SA 3R9GA 2WYRA 1ZG7A 3CXQA 4HKFA 4JZ0A 1MJ9A 4KUBA 1ELLP 1XIXA 4GVWA 3FXTA 1I12A 2AE6A 3GKRA 3FNCA 3UY5A 2OZHA 5EMIA 4ESSA 3FECA 2QYVA 3V7ZA 1QMUA 2BO9A 4M85A 4PK2A 4GUAA 2XEJA 1QSRA 4P45A 2VI7A 4CGNA 4EWTA 1Q2DA 4IF5A 2OR4A 3PZJA 4TNUA 1NMTA 1R43A 2OB0A 3A9LA 2R7HA 4QC6A 4OC5A 4R87A 4UWJA 4XNHB 5JM6A 1X10A 1LOKA 4AXVA 1S7NA 4KS9A 1IU8A 1Y9KA 3IC1A 3JVNA 4MCQA 1LRZA 4OC2A 3H8FA 1VHUA 4P4IA 3W91A 3GB0A 4KUAA 1HDUA 5FSUA 5HH1A 2BOAA 2PJ0A 1UWYA 2GFQA 2PIYA 3KHZA 4Q7AA 4UCPA 3PB8X 1FNOA 2HC9A 3DGVA 2I79A 1LCPA 4NGQA 2RNKA 5KTCA 4ONWA 8CPAA 2ZELA 3IWGA 4UCMA 4OC4A 1YLEA 2EVNA 3CPXA 4OC1A 4I49A 1NSAA 2G9DA 2YGWA 2ZEOA 5ISVA 3V2BA 4JLLA 3EJFA 3KZWA 4Q36A 4RUHA 3KR5A 4ZY2A 1CBXA 1WK4A 2G3TA 3G3SA 3KI9A 5H84A 2O53A 5IV0A 3IWEA 3RBUA 3CPAA 3WT4A 5FSVA 1ZR5A 4MFZA 3TO7A 3WC7A 1DE4C 2IJZA 4KOYA 1YLOA 2ABZA 2J8RA 3FF3A 3TOAA 2ODFA 3L2NA 3QAYA 2R1IA 6CPAA 4AVBA 4PXCA 3SI2A 4NJRA 2GLJA 1M4GA 1YGHA 2RFHA 3D2MA 3RAMA 4B5OA 2XEIA 3PRTA 4GVVA 1EE3P 2NYQA 1ELMP 3OWCA 2ZOFA 3B3VA 1ZLHA 4HNWB 1BPNA 2FSRA 1YVKA 2NMTA 5HIHA 3BJ7A 5KTDA 3KGQA 4JXQA 4C7HA 4F9UA 2YNEA 4CYPA 4A95A 3SIIA 2IQ6A 4ETKA 4OIDA 4UMLA 2B5GA 2ATRA 1VHSA 4U9ZA 1F57A 2B4DA 4ZY0A 4UCNA 1TF9A 4UEEA 2L8RA 3B3TA 3LODA 1Z2LA 4R6TA 4II9A 2XEFA 2J9AA 3EWPA 3GPQA 2CIJA 5AG4A 2Q4YA 3D4UA 4PSXA 4J5RA 4KLVA 1S7LA 1B87A 4G1PA 5E96A 2J8NA 2V8DA 4J3GA 2VBQA 4XPDC 3PFEA 3KQXA 1XOVA 1Y0RA 2PIZA 4BD9A 2AFMA 4NEXA 2F5IA 4YU9A 1GHEA 2V77A 2C27A 3IIFA 2PVVA 2AFXA 3K2KA 4IAVA 4MFQA 3RYOA 1IICA 1MK4A 1DTDA 3QNVA 2AFOA 2CXAA 2PSWA 3TT2A 3W6XA 5HMNA 1CP6A 2PJ7A 5EBVA 4XPDB 3FH4A 2G3AA 3DLJA 3V38A 5ELYA 4GS4A 4OLLA 3EWRA 4R9MA 1Z8XA 1XJOA 4KOXA 4J5QA 4MJ8A 1VHOA 3RO0A 3EW5A 2GLFA 2VL1A 4UEZA 4Q38A 5IB0A 1YK3A 1KZFA 3N7ZA 3KQZA 3NA6A 4NCZA 4MFKA 4FD5A 4CAEA 2ZW5A 3SIJA 1CPSA 2PQ8A 4QUSA 3S6HA 1YD9A 4NFRA 5DS0A 4BINA 3TE4A 4NGTA 4TWEA 1LAMA 2PE3A 3BHXA 3IWWA 4K30A 2B58A 3SJEA 1S60A 5G21A
chains in the Genus database with same CATH topology
2LGRA 4W9YA 3SIHA 4X2TA 5CPAA 3PB6X 3NH5A 1YSJA 3EJGA 2OOTA 3FVLA 4NGMA 4F9VA 2BFQA 1XRYA 5K8NA 4R7MA 4NJQA 1CPXA 2PCUA 2ZEFA 4F8ZA 2HB6A 1Z5RA 2EWBA 3B2YA 2WZNA 4R76A 3GQOA 4A37A 3B3CA 5LYIA 1SPVA 5JGFA 5K8MA 1FT7A 4MHYA 5CMSA 1NJRA 4PXBA 2GU2A 4PXEA 3NH8A 1PCAA 2CTBA 4JCAA 3D7GA 3WC5A 2ZEMA 1GYTA 3IIDA 3WC6A 3D67A 1TY8A 1TKJA 1TKFA 2PJ6A 3VATA 3B3SA 2QJ8A 3GPOA 3PFOA 4ABKA 1CX8A 2CF4A 1JQGA 1XFOA 2DX6A 3EWQA 2ACFA 1LAPA 2AFWA 4P4FA 2CTCA 1M4LA 3IEHA 5FSZA 1OBRA 4B6ZA 2AFZA 2RB7A 2PVWA 1AYEA 2GREA 4UF4A 3FMCA 4P4DA 2F8HA 5F09A 4ZX9A 1ARMA 2EK9A 5AILA 3IIBA 2C6PA 4MHPA 1LANA 3HLPA 1YMEA 1CG2A 1ZG9A 1YW6A 3FJUA 1KWMA 2AFCA 1XBUA 2JBKA 3IJ3A 4UIBA 3B3WA 4WWVA 4MRIA 1YW4A 5K8OA 1VGYA 1LFWA 3GLJA 1BPMA 3GUXA 2V8GA 4FUUA 3TX8A 4K3NA 4KYBA 4NGRA 5HVFA 1TF8A 2IMOA 3FX6A 3D7DA 3PB9X 1F2PA 5FSYA 1RTQA 2XD7A 4FBEA 2ZEGA 4X8IA 3ISXA 4PXDA 4MCPA 3PB4X 2C1CA 3D66A 3GPGA 2PJ1A 3SJGA 3PBEA 3SI1A 4WJBA 3Q6ZA 2XEGA 4P4EA 3SI0A 3ISZA 3GQEA 5THWA 4GM5A 3ETIA 5CBMA 4YWYA 1H8LA 2AFUA 1ZG8A 3S9MA 4IK2A 1F2OA 4TU0A 2Q43A 3LMSA 2Q51A 2PJ2A 5LYDA 3Q71A 4IQYA 3HUVA 3T8WA 4A38A 2F7VA 2PJ3A 2ZEEA 4MMOA 3V45A 4NGSA 3EWOA 2FXKA 1TXRA 4LQGA 2FAVA 5D8NA 3S9NA 4ZYQA 4UIAA 4MHNA 1Z8LA 3JZTA 2PJ4A 4EFDA 1TKHA 4NGPA 4P10A 1AMPA 2PJCA 1XMBA 3SIGA 2FG1A 3IO1A 2POKA 2ANPA 4UEFA 3BXMA 1Q7LA 4KSIA 3D68A 2AFSA 3LWUA 4ABLA 4ZX8A 2C6CA 1Y0YA 3VH9A 2X47A 3IFEA 5DUSA 2ZEPA 3I1UA 5FSXA 5LYLA 1ARLA 1QQ9A 1VIXA 4DJLA 7CPAA 4MCSA 2V8VA 4NGNA 4IHMA 3B7IA 4OMEA 5LRJA 4PQAA 4A94A 2C6GA 3SJFA 4J5SA 3B35A 4DYOA 3JRUA 5IB9A 5LYFA 1Y7EA 4P4JA 4X3RA 3H8GA 4ETJA 4P44A 1BAVA 2ZEDA 3FEDA 3SJXA 3CDXA 1ZR3A 5I4MA 3KL9A 1TXZA 1HEEA 1PYTB 3H8EA 5JH9A 4D86A 3D7HA 4ZY1A 3KR4A 4OC0A 5LRKA 4PPZA 3K9TA 3VARA 5CB5A 1IY7A 2JEWA 4H2KA 2FVGA 3NFZA 1VHEA 2BFRA 1CP7A 4ZI6A 3BI1A 3KASA 3PEIA 4CPAA 2VRIA 3N5FA 5LRGA 5J1QA 4A39A 2PJ5A 2NSMA 4JYWA 1R3NA 2I3CA 4J4ZA 2PJBA 4JGKA 4MHZA 1HJZA 4DUKA 4JVVA 2PJ8A 4O23A 5D29A 5HOLA 3EKEA 5K8PA 2DEAA 3S9LA 2V8HA 4FAIA 4OC3A 3VFQA 1HDQA 4MCRA 4Z65A 4P6YA 2PJ9A 2Q4ZA 2EK8A 3CT9A 3WABA 2BCOA 4OIWA 2ZOGA 5HXDA 4MXUA 3PB7X 1IGBA 3RZAA 2ZENA 3NH4A 3KHXA 2EEEA 3D7FA 4P4BA 1ZLIA 2O4HA 3SJEA 5CB3A 3BI0A 2JBJA 2ZEHA 1BLLE 2PJAA 4OKOA 4OC5A 2QVPA 5HVHA 3MRUA 3MN8A 2PRQA 5E3BA 4K0CA 4OP4A 3PBBA 3TC8A 5HVGA 4FWUA 4EMEA 2WYRA 1ZG7A 4JZ0A 1ELLP 4GVWA 4ESSA 3FECA 2QYVA 3V7ZA 1QMUA 2BO9A 4GUAA 2XEJA 4P45A 4EWTA 2OR4A 4TNUA 1R43A 5JM6A 1LOKA 4AXVA 3IC1A 4MCQA 4OC2A 3H8FA 1VHUA 4P4IA 3GB0A 1HDUA 5FSUA 2BOAA 2PJ0A 1UWYA 2PIYA 3KHZA 4Q7AA 3PB8X 1FNOA 2HC9A 3DGVA 1LCPA 4NGQA 4ONWA 8CPAA 2ZELA 4OC4A 3CPXA 4OC1A 1NSAA 2G9DA 2ZEOA 3V2BA 4JLLA 3EJFA 3KZWA 4RUHA 3KR5A 4ZY2A 1CBXA 3KI9A 2O53A 3RBUA 3WT4A 3CPAA 5FSVA 1ZR5A 3WC7A 1DE4C 2IJZA 1YLOA 2ABZA 3FF3A 3L2NA 6CPAA 4PXCA 3SI2A 4NJRA 2GLJA 2RFHA 3RAMA 2XEIA 3PRTA 4GVVA 1EE3P 2NYQA 1ELMP 2ZOFA 3B3VA 1ZLHA 1BPNA 5HIHA 3KGQA 4F9UA 3SIIA 2IQ6A 4ETKA 4OIDA 4UMLA 1F57A 4ZY0A 1TF9A 4UEEA 2L8RA 3B3TA 1Z2LA 4R6TA 2XEFA 2J9AA 3EWPA 3GPQA 2CIJA 3D4UA 4J5RA 4G1PA 2V8DA 3PFEA 3KQXA 1Y0RA 2PIZA 4BD9A 2AFMA 4YU9A 2V77A 3IIFA 2PVVA 2AFXA 3K2KA 4IAVA 1DTDA 3QNVA 2AFOA 1CP6A 2PJ7A 3FH4A 3DLJA 3V38A 5ELYA 3EWRA 1XJOA 4J5QA 1VHOA 3EW5A 2GLFA 2VL1A 4UEZA 3KQZA 3NA6A 3SIJA 1CPSA 1YD9A 4NFRA 5DS0A 4NGTA 4TWEA 1LAMA 2PE3A 3BHXA 3IWWA 4R8FA 3FEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGR A;  4W9Y A;  3SIH A;  4X2T A;  5CPA A;  3PB6 X;  3NH5 A;  1YSJ A;  3EJG A;  2OOT A;  3FVL A;  4NGM A;  4F9V A;  2BFQ A;  1XRY A;  5K8N A;  4R7M A;  4NJQ A;  1CPX A;  2PCU A;  2ZEF A;  4F8Z A;  2HB6 A;  1Z5R A;  2EWB A;  3B2Y A;  2WZN A;  4R76 A;  3GQO A;  4A37 A;  3B3C A;  5LYI A;  1SPV A;  5JGF A;  5K8M A;  1FT7 A;  4MHY A;  5CMS A;  1NJR A;  4PXB A;  2GU2 A;  4PXE A;  3NH8 A;  1PCA A;  2CTB A;  4JCA A;  3D7G A;  3WC5 A;  2ZEM A;  1GYT A;  3IID A;  3WC6 A;  3D67 A;  1TY8 A;  1TKJ A;  1TKF A;  2PJ6 A;  3VAT A;  3B3S A;  2QJ8 A;  3GPO A;  3PFO A;  4ABK A;  1CX8 A;  2CF4 A;  1JQG A;  1XFO A;  2DX6 A;  3EWQ A;  2ACF A;  1LAP A;  2AFW A;  4P4F A;  2CTC A;  1M4L A;  3IEH A;  5FSZ A;  1OBR A;  4B6Z A;  2AFZ A;  2RB7 A;  2PVW A;  1AYE A;  2GRE A;  4UF4 A;  3FMC A;  4P4D A;  2F8H A;  5F09 A;  4ZX9 A;  1ARM A;  2EK9 A;  5AIL A;  3IIB A;  2C6P A;  4MHP A;  1LAN A;  3HLP A;  1YME A;  1CG2 A;  1ZG9 A;  1YW6 A;  3FJU A;  1KWM A;  2AFC A;  1XBU A;  2JBK A;  3IJ3 A;  4UIB A;  3B3W A;  4WWV A;  4MRI A;  1YW4 A;  5K8O A;  1VGY A;  1LFW A;  3GLJ A;  1BPM A;  3GUX A;  2V8G A;  4FUU A;  3TX8 A;  4K3N A;  4KYB A;  4NGR A;  5HVF A;  1TF8 A;  2IMO A;  3FX6 A;  3D7D A;  3PB9 X;  1F2P A;  5FSY A;  1RTQ A;  2XD7 A;  4FBE A;  2ZEG A;  4X8I A;  3ISX A;  4PXD A;  4MCP A;  3PB4 X;  2C1C A;  3D66 A;  3GPG A;  2PJ1 A;  3SJG A;  3PBE A;  3SI1 A;  4WJB A;  3Q6Z A;  2XEG A;  4P4E A;  3SI0 A;  3ISZ A;  3GQE A;  5THW A;  4GM5 A;  3ETI A;  5CBM A;  4YWY A;  1H8L A;  2AFU A;  1ZG8 A;  3S9M A;  4IK2 A;  1F2O A;  4TU0 A;  2Q43 A;  3LMS A;  2Q51 A;  2PJ2 A;  5LYD A;  3Q71 A;  4IQY A;  3HUV A;  3T8W A;  4A38 A;  2F7V A;  2PJ3 A;  2ZEE A;  4MMO A;  3V45 A;  4NGS A;  3EWO A;  2FXK A;  1TXR A;  4LQG A;  2FAV A;  5D8N A;  3S9N A;  4ZYQ A;  4UIA A;  4MHN A;  1Z8L A;  3JZT A;  2PJ4 A;  4EFD A;  1TKH A;  4NGP A;  4P10 A;  1AMP A;  2PJC A;  1XMB A;  3SIG A;  2FG1 A;  3IO1 A;  2POK A;  2ANP A;  4UEF A;  3BXM A;  1Q7L A;  4KSI A;  3D68 A;  2AFS A;  3LWU A;  4ABL A;  4ZX8 A;  2C6C A;  1Y0Y A;  3VH9 A;  2X47 A;  3IFE A;  5DUS A;  2ZEP A;  3I1U A;  5FSX A;  5LYL A;  1ARL A;  1QQ9 A;  1VIX A;  4DJL A;  7CPA A;  4MCS A;  2V8V A;  4NGN A;  4IHM A;  3B7I A;  4OME A;  5LRJ A;  4PQA A;  4A94 A;  2C6G A;  3SJF A;  4J5S A;  3B35 A;  4DYO A;  3JRU A;  5IB9 A;  5LYF A;  1Y7E A;  4P4J A;  4X3R A;  3H8G A;  4ETJ A;  4P44 A;  1BAV A;  2ZED A;  3FED A;  3SJX A;  3CDX A;  1ZR3 A;  5I4M A;  3KL9 A;  1TXZ A;  1HEE A;  1PYT B;  3H8E A;  5JH9 A;  4D86 A;  3D7H A;  4ZY1 A;  3KR4 A;  4OC0 A;  5LRK A;  4PPZ A;  3K9T A;  3VAR A;  5CB5 A;  1IY7 A;  2JEW A;  4H2K A;  2FVG A;  3NFZ A;  1VHE A;  2BFR A;  1CP7 A;  4ZI6 A;  3BI1 A;  3KAS A;  3PEI A;  4CPA A;  2VRI A;  3N5F A;  5LRG A;  5J1Q A;  4A39 A;  2PJ5 A;  2NSM A;  4JYW A;  1R3N A;  2I3C A;  4J4Z A;  2PJB A;  4JGK A;  4MHZ A;  1HJZ A;  4DUK A;  4JVV A;  2PJ8 A;  4O23 A;  5D29 A;  5HOL A;  3EKE A;  5K8P A;  2DEA A;  3S9L A;  2V8H A;  4FAI A;  4OC3 A;  3VFQ A;  1HDQ A;  4MCR A;  4Z65 A;  4P6Y A;  2PJ9 A;  2Q4Z A;  2EK8 A;  3CT9 A;  3WAB A;  2BCO A;  4OIW A;  2ZOG A;  5HXD A;  4MXU A;  3PB7 X;  1IGB A;  3RZA A;  2ZEN A;  3NH4 A;  3KHX A;  2EEE A;  3D7F A;  4P4B A;  1ZLI A;  2O4H A;  3SJE A;  5CB3 A;  3BI0 A;  2JBJ A;  2ZEH A;  1BLL E;  2PJA A;  4OKO A;  4OC5 A;  2QVP A;  5HVH A;  3MRU A;  3MN8 A;  2PRQ A;  5E3B A;  4K0C A;  4OP4 A;  3PBB A;  3TC8 A;  5HVG A;  4FWU A;  4EME A;  2WYR A;  1ZG7 A;  4JZ0 A;  1ELL P;  4GVW A;  4ESS A;  3FEC A;  2QYV A;  3V7Z A;  1QMU A;  2BO9 A;  4GUA A;  2XEJ A;  4P45 A;  4EWT A;  2OR4 A;  4TNU A;  1R43 A;  5JM6 A;  1LOK A;  4AXV A;  3IC1 A;  4MCQ A;  4OC2 A;  3H8F A;  1VHU A;  4P4I A;  3GB0 A;  1HDU A;  5FSU A;  2BOA A;  2PJ0 A;  1UWY A;  2PIY A;  3KHZ A;  4Q7A A;  3PB8 X;  1FNO A;  2HC9 A;  3DGV A;  1LCP A;  4NGQ A;  4ONW A;  8CPA A;  2ZEL A;  4OC4 A;  3CPX A;  4OC1 A;  1NSA A;  2G9D A;  2ZEO A;  3V2B A;  4JLL A;  3EJF A;  3KZW A;  4RUH A;  3KR5 A;  4ZY2 A;  1CBX A;  3KI9 A;  2O53 A;  3RBU A;  3WT4 A;  3CPA A;  5FSV A;  1ZR5 A;  3WC7 A;  1DE4 C;  2IJZ A;  1YLO A;  2ABZ A;  3FF3 A;  3L2N A;  6CPA A;  4PXC A;  3SI2 A;  4NJR A;  2GLJ A;  2RFH A;  3RAM A;  2XEI A;  3PRT A;  4GVV A;  1EE3 P;  2NYQ A;  1ELM P;  2ZOF A;  3B3V A;  1ZLH A;  1BPN A;  5HIH A;  3KGQ A;  4F9U A;  3SII A;  2IQ6 A;  4ETK A;  4OID A;  4UML A;  1F57 A;  4ZY0 A;  1TF9 A;  4UEE A;  2L8R A;  3B3T A;  1Z2L A;  4R6T A;  2XEF A;  2J9A A;  3EWP A;  3GPQ A;  2CIJ A;  3D4U A;  4J5R A;  4G1P A;  2V8D A;  3PFE A;  3KQX A;  1Y0R A;  2PIZ A;  4BD9 A;  2AFM A;  4YU9 A;  2V77 A;  3IIF A;  2PVV A;  2AFX A;  3K2K A;  4IAV A;  1DTD A;  3QNV A;  2AFO A;  1CP6 A;  2PJ7 A;  3FH4 A;  3DLJ A;  3V38 A;  5ELY A;  3EWR A;  1XJO A;  4J5Q A;  1VHO A;  3EW5 A;  2GLF A;  2VL1 A;  4UEZ A;  3KQZ A;  3NA6 A;  3SIJ A;  1CPS A;  1YD9 A;  4NFR A;  5DS0 A;  4NGT A;  4TWE A;  1LAM A;  2PE3 A;  3BHX A;  3IWW A;  4R8F A;  3FEE A; 
#chains in the Genus database with same CATH topology
 2LGR A;  4W9Y A;  2REF A;  3DR8 A;  3SIH A;  4KOU A;  4FD6 A;  4X2T A;  3CXS A;  5CPA A;  3PB6 X;  2Z3M A;  3NH5 A;  1YSJ A;  3EJG A;  2OOT A;  5C88 A;  3FVL A;  1R57 A;  1K4J A;  4NGM A;  4F9V A;  2BFQ A;  2YNC C;  2PR8 A;  1XRY A;  3FYN A;  4FD4 A;  4KOS A;  5AG6 A;  5K8N A;  4R7M A;  4NJQ A;  1CPX A;  2PCU A;  1MJB A;  2ZEF A;  4F8Z A;  2HB6 A;  1Z5R A;  2ZW7 A;  2EWB A;  3B2Y A;  2PRB A;  1J4J A;  2WZN A;  4R76 A;  3VWE A;  3GQO A;  4A37 A;  2R98 A;  3S6F A;  5C82 A;  3TTH A;  5I0C A;  4B14 A;  4C2X A;  3GY9 A;  2HV2 A;  2WUU A;  3B3C A;  4UFX A;  5LYI A;  1SPV A;  1KUY A;  2GE3 A;  4QBJ A;  5G22 A;  5JGF A;  2EBJ A;  2Y0M A;  5K8M A;  1FT7 A;  4MHY A;  1RO5 A;  3CXP A;  3FIX A;  5CMS A;  1NJR A;  3I3G A;  4PXB A;  2GU2 A;  4YRH A;  2HQY A;  1X12 A;  3FEE A;  5F47 A;  4PXE A;  3NH8 A;  2BEI A;  1PCA A;  1IYL A;  1FY7 A;  4JCA A;  2CTB A;  1I21 A;  4JJX A;  3D7G A;  3WC5 A;  3VWD A;  4AVC A;  2ZEM A;  1GYT A;  3IID A;  5FVJ A;  3D67 A;  1TY8 A;  3WC6 A;  2KQV A;  1TKJ A;  2RC4 A;  1TKF A;  2PJ6 A;  3VAT A;  3B3S A;  4CAV A;  2QJ8 A;  3GPO A;  2ARH A;  3PFO A;  4ABK A;  1CX8 A;  2CF4 A;  4R3K A;  1JQG A;  4CGP A;  1XFO A;  2DX6 A;  5G1Z A;  1SQH A;  2JEV A;  1YRE A;  2BSW A;  2WPX A;  1QSM A;  3F5B A;  1S3Z A;  4IUS A;  3JTK A;  4RS2 A;  2CNM A;  3ZJ0 A;  2Z0Z A;  3EWQ A;  4KSF A;  2ACF A;  2HUZ A;  2Q44 A;  1YVO A;  1LAP A;  5H86 A;  4L8A A;  4YGO A;  1BO4 A;  3D3S A;  3E0K A;  3TO9 A;  2ZW6 A;  2AFW A;  1XMT A;  4P4F A;  4UBR A;  1VKC A;  2CTC A;  3IGR A;  4E0A A;  1M4L A;  3IEH A;  5FSZ A;  1OBR A;  1P4N A;  2OZU A;  4B6Z A;  2AFZ A;  2RB7 A;  2PVW A;  1AYE A;  2GRE A;  2K5T A;  1AUG A;  2D4P A;  2F8H A;  3FMC A;  2FL4 A;  4P4D A;  3T9Y A;  5F09 A;  2DPS A;  4ZX9 A;  2QIR A;  2B3U A;  2QEC A;  4Y49 C;  1ARM A;  2EK9 A;  2Z3N A;  3R9E A;  2JDD A;  5AIL A;  3S6K A;  4MHD A;  3IU2 A;  4UA3 A;  2JZF A;  3IIB A;  2C6P A;  3ZZI A;  3GIU A;  4F6A A;  4MHP A;  1LAN A;  3HLP A;  1WWZ A;  1M44 A;  1CG2 A;  1S7F A;  1YME A;  1ZG9 A;  1YW6 A;  3FJU A;  3QAH A;  1KWM A;  2AFC A;  4U9Y A;  1XBU A;  2JBK A;  5F49 A;  3IJ3 A;  4UIB A;  2VZZ A;  2YND A;  4JXR A;  4KLW A;  3B3W A;  4WWV A;  4MRI A;  1YW4 A;  4A31 A;  2Q7B A;  4CGO A;  5GCN A;  5K8O A;  1VGY A;  1LFW A;  3GLJ A;  4LUA A;  4MFJ A;  1BPM A;  3GUX A;  1Q2Y A;  2J8M A;  2V8G A;  1L0C A;  4FUU A;  3TX8 A;  4K3N A;  2Q0Y A;  3FRM A;  4KYB A;  1U6M A;  3IU1 A;  4H6U A;  4KVM E;  4NGR A;  5HVF A;  4CYN A;  1TF8 A;  2IMO A;  2ZPA A;  3K9U A;  4LQ6 A;  3FX6 A;  5CNP A;  1Z9U A;  3D7D A;  3PB9 X;  1F2P A;  4HNX B;  5FSY A;  1IID A;  1M4I A;  1RTQ A;  2FIA A;  4OKO A;  4AB7 A;  2XD7 A;  1Q2C A;  4X5K A;  4FBE A;  2ZEG A;  4X8I A;  3ISX A;  4PXD A;  4MCP A;  3PB4 X;  2C1C A;  3D66 A;  3GPG A;  1TIQ A;  2PJ1 A;  1Z8W A;  4MBU A;  4R8F A;  5DWN A;  3SJG A;  1P0H A;  4M6G A;  3EFA A;  3PBE A;  4CRY B;  3SI1 A;  4B5P A;  2YNC A;  4WJB A;  5A28 A;  3Q6Z A;  2FCK A;  3T90 A;  3BLN A;  2XEG A;  4P4E A;  3SI0 A;  2R8V A;  3ISZ A;  2GIV A;  4CGM A;  5AG7 A;  1Z4R A;  3GQE A;  3PP9 A;  2H5M A;  4R57 A;  4ONU A;  4KVO E;  5THW A;  1A2Z A;  4GM5 A;  4BMH A;  3RNZ A;  3ETI A;  5CBM A;  4YWY A;  4F0Y A;  1H8L A;  4QVT A;  4A30 A;  4CGL A;  4CYQ A;  3CZX A;  3TOB A;  3F8K A;  2AFU A;  2OH1 A;  3PGP A;  4B12 A;  1YQE A;  1ZG8 A;  3S9M A;  2ZXV A;  4IK2 A;  1F2O A;  4TU0 A;  2Q43 A;  2GAN A;  2WPW A;  3LMS A;  1BOB A;  3LAC A;  4LX9 A;  1NE9 A;  4XPK A;  2FXF A;  3KKW A;  4B10 A;  4H89 A;  4DNC A;  2Q51 A;  5F46 A;  2PJ2 A;  5LYD A;  3Q71 A;  5F48 A;  3P2F A;  2FE7 A;  4IQY A;  3HUV A;  3T8W A;  4A38 A;  1XEB A;  2F7V A;  1M4D A;  2PJ3 A;  2JDC A;  2ZEE A;  4MY3 A;  4B5P B;  4MMO A;  4BBH A;  4C68 A;  1CM0 A;  5G20 A;  3V45 A;  4NGS A;  4A2Z A;  4L89 A;  1Z4E A;  4C2Y A;  3EWO A;  3SXN A;  2FXK A;  4F0X A;  2DXQ A;  3EXN A;  1TXR A;  4JWP A;  2FAV A;  4LQG A;  1Z8T A;  3TO6 A;  5D8N A;  4ZBG A;  3P2H A;  3R96 A;  3WR7 A;  1KUX A;  3S9N A;  4ZYQ A;  4UIA A;  4MHN A;  1Z8L A;  3JZT A;  2PJ4 A;  4M6H A;  1ZO0 A;  1TKH A;  2VQY A;  4NGP A;  4XNH C;  4EFD A;  4AG9 A;  4P10 A;  4PSW A;  4OAD A;  4RI1 A;  1AMP A;  2PJC A;  1XMB A;  3SIG A;  2FG1 A;  2EUI A;  2POK A;  2ANP A;  3G8W A;  3IO1 A;  3NE8 A;  4ORF A;  2AJ6 A;  4UEF A;  3EY5 A;  5A27 A;  5J8C A;  3F0A A;  4KVX A;  1KUV A;  3BXM A;  4UFV A;  1Q7L A;  2Z3K A;  4KSI A;  3D68 A;  4C7I A;  3W6S A;  1S7K A;  1UFH A;  2AFS A;  2EO8 A;  3LWU A;  4ABL A;  1IOF A;  4ZX8 A;  4B11 A;  2C6C A;  1NSL A;  1Y0Y A;  4H6Z A;  3VH9 A;  2WCT A;  2X47 A;  3IFE A;  4NF1 A;  5DUS A;  2ZEP A;  3I1U A;  3DSB A;  5FSX A;  5LYL A;  4M6I A;  1ARL A;  4E8O A;  2REE A;  5KTA A;  1CJW A;  4CAW A;  1QQ9 A;  1VIX A;  2JLM A;  3FBU A;  2P0W A;  3MGD A;  4MY0 A;  4DJL A;  7CPA A;  4NXY A;  4HNY B;  4KZT A;  4MCS A;  2V8V A;  4NGN A;  4IHM A;  1YR0 A;  2B4B A;  3B7I A;  3C26 A;  3TCV A;  2WSA A;  1IYK A;  1V0C A;  4OME A;  4MI4 A;  5LRJ A;  1B6B A;  4PQA A;  4A94 A;  2C6G A;  1XE4 A;  3SJF A;  4J5S A;  3B35 A;  4PK3 A;  4FD7 A;  2Z3O A;  3JRU A;  4CRZ B;  4DYO A;  4AVA A;  5IB9 A;  4E2A A;  5LYF A;  1Y7E A;  4P4J A;  4X3R A;  3LD2 A;  3H8G A;  4ETJ A;  4KSA A;  4CS0 B;  4P44 A;  4CAX A;  2P6G A;  1BAV A;  2QML A;  2ZED A;  3FED A;  3CDX A;  3SJX A;  3R9F A;  1ZR3 A;  2KCW A;  3D2P A;  3H5Z A;  5I4M A;  4B13 A;  3KL9 A;  5JPH A;  1TXZ A;  1HEE A;  1PYT B;  3H8E A;  4A33 A;  5JH9 A;  3DNS A;  3R1K A;  2VEZ A;  4D86 A;  4UFW A;  3SXO A;  3D7H A;  1I1D A;  4GXH A;  2Z10 A;  2FT0 A;  4ZY1 A;  3KR4 A;  1JWQ A;  4OC0 A;  5LRK A;  4Y49 B;  4KOV A;  4PPZ A;  3K9T A;  3VAR A;  5CB5 A;  3JUW A;  5J8F A;  1IY7 A;  1YX0 A;  1QST A;  4PV6 A;  2Z3P A;  3EC4 A;  3S6G A;  5IX3 A;  1Y7R A;  2JEW A;  2D4O A;  2FVG A;  4H2K A;  4KOR A;  3NFZ A;  4OAE A;  1VHE A;  4CYO A;  2BFR A;  4M3S A;  4CAF A;  2VZY A;  4RN7 A;  3R95 A;  1CP7 A;  2G0B A;  4YFJ A;  4ZI6 A;  3BI1 A;  2OZG A;  2Q04 A;  1QSN A;  3KAS A;  3TFY A;  1RXT A;  3PEI A;  2PC1 A;  4CPA A;  2VRI A;  2O28 A;  5EC4 A;  2IL4 A;  2FIW A;  3B8G A;  1PUA A;  3N5F A;  5LRG A;  2P6E A;  2FS5 A;  2BUE A;  5J1Q A;  2JZE A;  4UWI A;  3V8I A;  4A39 A;  2PJ5 A;  2CY2 A;  2DPT A;  2NSM A;  4JYW A;  1R3N A;  2B3V A;  4KOW A;  4MFL A;  4MFP A;  1OZP A;  1IB1 E;  5JQ4 A;  1S5K A;  2I3C A;  2CNT A;  4J4Z A;  2CNS A;  3H4Q A;  4HPS A;  2PJB A;  4JGK A;  4MHZ A;  2Z3L A;  4KOT A;  1HJZ A;  3DDD A;  4DUK A;  4JVV A;  3NE7 A;  2PJ8 A;  4O23 A;  4U5Y A;  5D29 A;  5HOL A;  3EKE A;  4JD6 A;  5K8P A;  3I9S A;  2BL1 A;  1IOI A;  2ZW4 A;  2DEA A;  4R3L A;  3S9L A;  4NSQ A;  1QSO A;  2V8H A;  4FAI A;  4UF4 A;  3DR6 A;  1M1D A;  4A32 A;  4OC3 A;  3VFQ A;  1HDQ A;  2B5G B;  4MCR A;  4Z65 A;  3GYA A;  4P6Y A;  2B4D B;  2OU2 A;  2PJ9 A;  2Q4Z A;  5AG5 A;  2DF5 A;  2EK8 A;  4AG7 A;  3CT9 A;  3FB3 A;  3WAB A;  2I00 A;  4XPL A;  3D8P A;  2A4N A;  3EO4 A;  4EVY A;  2BCO A;  5BWA B;  3QB8 A;  4OIW A;  2ZOG A;  4QB9 A;  5HXD A;  4MXU A;  3PB7 X;  2Z11 A;  1IGB A;  3RZA A;  2ZEN A;  5AGE A;  3NH4 A;  3KHX A;  1N71 A;  2EEE A;  3D7F A;  1XF8 A;  4P4B A;  1ON0 A;  4C2Z A;  1ZLI A;  2O4H A;  2X7B A;  2W2G A;  5CB3 A;  3BI0 A;  2JBJ A;  2ZEH A;  1BLL E;  2PJA A;  2VXK A;  4JLY A;  2QVP A;  3BJ8 A;  5HVH A;  3MRU A;  3MN8 A;  2P6F A;  2PRQ A;  5E3B A;  4K0C A;  1MJA A;  2Q4V A;  3PBB A;  4OP4 A;  3SHP A;  2JZD A;  3TC8 A;  4ZGY B;  2PDO A;  5HVG A;  1PU9 A;  1Y9W A;  4FWU A;  4EME A;  2PR1 A;  5DWM A;  2Q7S A;  3R9G A;  2WYR A;  1ZG7 A;  3CXQ A;  4HKF A;  4JZ0 A;  1MJ9 A;  4KUB A;  1ELL P;  1XIX A;  4GVW A;  3FXT A;  1I12 A;  2AE6 A;  3GKR A;  3FNC A;  3UY5 A;  2OZH A;  5EMI A;  4ESS A;  3FEC A;  2QYV A;  3V7Z A;  1QMU A;  2BO9 A;  4M85 A;  4PK2 A;  4GUA A;  2XEJ A;  1QSR A;  4P45 A;  2VI7 A;  4CGN A;  4EWT A;  1Q2D A;  4IF5 A;  2OR4 A;  3PZJ A;  4TNU A;  1NMT A;  1R43 A;  2OB0 A;  3A9L A;  2R7H A;  4QC6 A;  4OC5 A;  4R87 A;  4UWJ A;  4XNH B;  5JM6 A;  1X10 A;  1LOK A;  4AXV A;  1S7N A;  4KS9 A;  1IU8 A;  1Y9K A;  3IC1 A;  3JVN A;  4MCQ A;  1LRZ A;  4OC2 A;  3H8F A;  1VHU A;  4P4I A;  3W91 A;  3GB0 A;  4KUA A;  1HDU A;  5FSU A;  5HH1 A;  2BOA A;  2PJ0 A;  1UWY A;  2GFQ A;  2PIY A;  3KHZ A;  4Q7A A;  4UCP A;  3PB8 X;  1FNO A;  2HC9 A;  3DGV A;  2I79 A;  1LCP A;  4NGQ A;  2RNK A;  5KTC A;  4ONW A;  8CPA A;  2ZEL A;  3IWG A;  4UCM A;  4OC4 A;  1YLE A;  2EVN A;  3CPX A;  4OC1 A;  4I49 A;  1NSA A;  2G9D A;  2YGW A;  2ZEO A;  5ISV A;  3V2B A;  4JLL A;  3EJF A;  3KZW A;  4Q36 A;  4RUH A;  3KR5 A;  4ZY2 A;  1CBX A;  1WK4 A;  2G3T A;  3G3S A;  3KI9 A;  5H84 A;  2O53 A;  5IV0 A;  3IWE A;  3RBU A;  3CPA A;  3WT4 A;  5FSV A;  1ZR5 A;  4MFZ A;  3TO7 A;  3WC7 A;  1DE4 C;  2IJZ A;  4KOY A;  1YLO A;  2ABZ A;  2J8R A;  3FF3 A;  3TOA A;  2ODF A;  3L2N A;  3QAY A;  2R1I A;  6CPA A;  4AVB A;  4PXC A;  3SI2 A;  4NJR A;  2GLJ A;  1M4G A;  1YGH A;  2RFH A;  3D2M A;  3RAM A;  4B5O A;  2XEI A;  3PRT A;  4GVV A;  1EE3 P;  2NYQ A;  1ELM P;  3OWC A;  2ZOF A;  3B3V A;  1ZLH A;  4HNW B;  1BPN A;  2FSR A;  1YVK A;  2NMT A;  5HIH A;  3BJ7 A;  5KTD A;  3KGQ A;  4JXQ A;  4C7H A;  4F9U A;  2YNE A;  4CYP A;  4A95 A;  3SII A;  2IQ6 A;  4ETK A;  4OID A;  4UML A;  2B5G A;  2ATR A;  1VHS A;  4U9Z A;  1F57 A;  2B4D A;  4ZY0 A;  4UCN A;  1TF9 A;  4UEE A;  2L8R A;  3B3T A;  3LOD A;  1Z2L A;  4R6T A;  4II9 A;  2XEF A;  2J9A A;  3EWP A;  3GPQ A;  2CIJ A;  5AG4 A;  2Q4Y A;  3D4U A;  4PSX A;  4J5R A;  4KLV A;  1S7L A;  1B87 A;  4G1P A;  5E96 A;  2J8N A;  2V8D A;  4J3G A;  2VBQ A;  4XPD C;  3PFE A;  3KQX A;  1XOV A;  1Y0R A;  2PIZ A;  4BD9 A;  2AFM A;  4NEX A;  2F5I A;  4YU9 A;  1GHE A;  2V77 A;  2C27 A;  3IIF A;  2PVV A;  2AFX A;  3K2K A;  4IAV A;  4MFQ A;  3RYO A;  1IIC A;  1MK4 A;  1DTD A;  3QNV A;  2AFO A;  2CXA A;  2PSW A;  3TT2 A;  3W6X A;  5HMN A;  1CP6 A;  2PJ7 A;  5EBV A;  4XPD B;  3FH4 A;  2G3A A;  3DLJ A;  3V38 A;  5ELY A;  4GS4 A;  4OLL A;  3EWR A;  4R9M A;  1Z8X A;  1XJO A;  4KOX A;  4J5Q A;  4MJ8 A;  1VHO A;  3RO0 A;  3EW5 A;  2GLF A;  2VL1 A;  4UEZ A;  4Q38 A;  5IB0 A;  1YK3 A;  1KZF A;  3N7Z A;  3KQZ A;  3NA6 A;  4NCZ A;  4MFK A;  4FD5 A;  4CAE A;  2ZW5 A;  3SIJ A;  1CPS A;  2PQ8 A;  4QUS A;  3S6H A;  1YD9 A;  4NFR A;  5DS0 A;  4BIN A;  3TE4 A;  4NGT A;  4TWE A;  1LAM A;  2PE3 A;  3BHX A;  3IWW A;  4K30 A;  2B58 A;  3SJE A;  1S60 A;  5G21 A; 
#chains in the Genus database with same CATH homology
 2LGR A;  4W9Y A;  3SIH A;  4X2T A;  5CPA A;  3PB6 X;  3NH5 A;  1YSJ A;  3EJG A;  2OOT A;  3FVL A;  4NGM A;  4F9V A;  2BFQ A;  1XRY A;  5K8N A;  4R7M A;  4NJQ A;  1CPX A;  2PCU A;  2ZEF A;  4F8Z A;  2HB6 A;  1Z5R A;  2EWB A;  3B2Y A;  2WZN A;  4R76 A;  3GQO A;  4A37 A;  3B3C A;  5LYI A;  1SPV A;  5JGF A;  5K8M A;  1FT7 A;  4MHY A;  5CMS A;  1NJR A;  4PXB A;  2GU2 A;  4PXE A;  3NH8 A;  1PCA A;  2CTB A;  4JCA A;  3D7G A;  3WC5 A;  2ZEM A;  1GYT A;  3IID A;  3WC6 A;  3D67 A;  1TY8 A;  1TKJ A;  1TKF A;  2PJ6 A;  3VAT A;  3B3S A;  2QJ8 A;  3GPO A;  3PFO A;  4ABK A;  1CX8 A;  2CF4 A;  1JQG A;  1XFO A;  2DX6 A;  3EWQ A;  2ACF A;  1LAP A;  2AFW A;  4P4F A;  2CTC A;  1M4L A;  3IEH A;  5FSZ A;  1OBR A;  4B6Z A;  2AFZ A;  2RB7 A;  2PVW A;  1AYE A;  2GRE A;  4UF4 A;  3FMC A;  4P4D A;  2F8H A;  5F09 A;  4ZX9 A;  1ARM A;  2EK9 A;  5AIL A;  3IIB A;  2C6P A;  4MHP A;  1LAN A;  3HLP A;  1YME A;  1CG2 A;  1ZG9 A;  1YW6 A;  3FJU A;  1KWM A;  2AFC A;  1XBU A;  2JBK A;  3IJ3 A;  4UIB A;  3B3W A;  4WWV A;  4MRI A;  1YW4 A;  5K8O A;  1VGY A;  1LFW A;  3GLJ A;  1BPM A;  3GUX A;  2V8G A;  4FUU A;  3TX8 A;  4K3N A;  4KYB A;  4NGR A;  5HVF A;  1TF8 A;  2IMO A;  3FX6 A;  3D7D A;  3PB9 X;  1F2P A;  5FSY A;  1RTQ A;  2XD7 A;  4FBE A;  2ZEG A;  4X8I A;  3ISX A;  4PXD A;  4MCP A;  3PB4 X;  2C1C A;  3D66 A;  3GPG A;  2PJ1 A;  3SJG A;  3PBE A;  3SI1 A;  4WJB A;  3Q6Z A;  2XEG A;  4P4E A;  3SI0 A;  3ISZ A;  3GQE A;  5THW A;  4GM5 A;  3ETI A;  5CBM A;  4YWY A;  1H8L A;  2AFU A;  1ZG8 A;  3S9M A;  4IK2 A;  1F2O A;  4TU0 A;  2Q43 A;  3LMS A;  2Q51 A;  2PJ2 A;  5LYD A;  3Q71 A;  4IQY A;  3HUV A;  3T8W A;  4A38 A;  2F7V A;  2PJ3 A;  2ZEE A;  4MMO A;  3V45 A;  4NGS A;  3EWO A;  2FXK A;  1TXR A;  4LQG A;  2FAV A;  5D8N A;  3S9N A;  4ZYQ A;  4UIA A;  4MHN A;  1Z8L A;  3JZT A;  2PJ4 A;  4EFD A;  1TKH A;  4NGP A;  4P10 A;  1AMP A;  2PJC A;  1XMB A;  3SIG A;  2FG1 A;  3IO1 A;  2POK A;  2ANP A;  4UEF A;  3BXM A;  1Q7L A;  4KSI A;  3D68 A;  2AFS A;  3LWU A;  4ABL A;  4ZX8 A;  2C6C A;  1Y0Y A;  3VH9 A;  2X47 A;  3IFE A;  5DUS A;  2ZEP A;  3I1U A;  5FSX A;  5LYL A;  1ARL A;  1QQ9 A;  1VIX A;  4DJL A;  7CPA A;  4MCS A;  2V8V A;  4NGN A;  4IHM A;  3B7I A;  4OME A;  5LRJ A;  4PQA A;  4A94 A;  2C6G A;  3SJF A;  4J5S A;  3B35 A;  4DYO A;  3JRU A;  5IB9 A;  5LYF A;  1Y7E A;  4P4J A;  4X3R A;  3H8G A;  4ETJ A;  4P44 A;  1BAV A;  2ZED A;  3FED A;  3SJX A;  3CDX A;  1ZR3 A;  5I4M A;  3KL9 A;  1TXZ A;  1HEE A;  1PYT B;  3H8E A;  5JH9 A;  4D86 A;  3D7H A;  4ZY1 A;  3KR4 A;  4OC0 A;  5LRK A;  4PPZ A;  3K9T A;  3VAR A;  5CB5 A;  1IY7 A;  2JEW A;  4H2K A;  2FVG A;  3NFZ A;  1VHE A;  2BFR A;  1CP7 A;  4ZI6 A;  3BI1 A;  3KAS A;  3PEI A;  4CPA A;  2VRI A;  3N5F A;  5LRG A;  5J1Q A;  4A39 A;  2PJ5 A;  2NSM A;  4JYW A;  1R3N A;  2I3C A;  4J4Z A;  2PJB A;  4JGK A;  4MHZ A;  1HJZ A;  4DUK A;  4JVV A;  2PJ8 A;  4O23 A;  5D29 A;  5HOL A;  3EKE A;  5K8P A;  2DEA A;  3S9L A;  2V8H A;  4FAI A;  4OC3 A;  3VFQ A;  1HDQ A;  4MCR A;  4Z65 A;  4P6Y A;  2PJ9 A;  2Q4Z A;  2EK8 A;  3CT9 A;  3WAB A;  2BCO A;  4OIW A;  2ZOG A;  5HXD A;  4MXU A;  3PB7 X;  1IGB A;  3RZA A;  2ZEN A;  3NH4 A;  3KHX A;  2EEE A;  3D7F A;  4P4B A;  1ZLI A;  2O4H A;  3SJE A;  5CB3 A;  3BI0 A;  2JBJ A;  2ZEH A;  1BLL E;  2PJA A;  4OKO A;  4OC5 A;  2QVP A;  5HVH A;  3MRU A;  3MN8 A;  2PRQ A;  5E3B A;  4K0C A;  4OP4 A;  3PBB A;  3TC8 A;  5HVG A;  4FWU A;  4EME A;  2WYR A;  1ZG7 A;  4JZ0 A;  1ELL P;  4GVW A;  4ESS A;  3FEC A;  2QYV A;  3V7Z A;  1QMU A;  2BO9 A;  4GUA A;  2XEJ A;  4P45 A;  4EWT A;  2OR4 A;  4TNU A;  1R43 A;  5JM6 A;  1LOK A;  4AXV A;  3IC1 A;  4MCQ A;  4OC2 A;  3H8F A;  1VHU A;  4P4I A;  3GB0 A;  1HDU A;  5FSU A;  2BOA A;  2PJ0 A;  1UWY A;  2PIY A;  3KHZ A;  4Q7A A;  3PB8 X;  1FNO A;  2HC9 A;  3DGV A;  1LCP A;  4NGQ A;  4ONW A;  8CPA A;  2ZEL A;  4OC4 A;  3CPX A;  4OC1 A;  1NSA A;  2G9D A;  2ZEO A;  3V2B A;  4JLL A;  3EJF A;  3KZW A;  4RUH A;  3KR5 A;  4ZY2 A;  1CBX A;  3KI9 A;  2O53 A;  3RBU A;  3WT4 A;  3CPA A;  5FSV A;  1ZR5 A;  3WC7 A;  1DE4 C;  2IJZ A;  1YLO A;  2ABZ A;  3FF3 A;  3L2N A;  6CPA A;  4PXC A;  3SI2 A;  4NJR A;  2GLJ A;  2RFH A;  3RAM A;  2XEI A;  3PRT A;  4GVV A;  1EE3 P;  2NYQ A;  1ELM P;  2ZOF A;  3B3V A;  1ZLH A;  1BPN A;  5HIH A;  3KGQ A;  4F9U A;  3SII A;  2IQ6 A;  4ETK A;  4OID A;  4UML A;  1F57 A;  4ZY0 A;  1TF9 A;  4UEE A;  2L8R A;  3B3T A;  1Z2L A;  4R6T A;  2XEF A;  2J9A A;  3EWP A;  3GPQ A;  2CIJ A;  3D4U A;  4J5R A;  4G1P A;  2V8D A;  3PFE A;  3KQX A;  1Y0R A;  2PIZ A;  4BD9 A;  2AFM A;  4YU9 A;  2V77 A;  3IIF A;  2PVV A;  2AFX A;  3K2K A;  4IAV A;  1DTD A;  3QNV A;  2AFO A;  1CP6 A;  2PJ7 A;  3FH4 A;  3DLJ A;  3V38 A;  5ELY A;  3EWR A;  1XJO A;  4J5Q A;  1VHO A;  3EW5 A;  2GLF A;  2VL1 A;  4UEZ A;  3KQZ A;  3NA6 A;  3SIJ A;  1CPS A;  1YD9 A;  4NFR A;  5DS0 A;  4NGT A;  4TWE A;  1LAM A;  2PE3 A;  3BHX A;  3IWW A;  4R8F A;  3FEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...