4ZX8A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 9b
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 174
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx8A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx8A02
3H8FA 3PEIA 1ZG7A 2J9AA 4IAVA 3PB7X 1CPXA 2O4HA 4P4EA 4A38A 3D7DA 5FSYA 3VH9A 4GVWA 3SJEA 4G1PA 4PXCA 3KR5A 4JGKA 1F57A 3KHXA 4J4ZA 3VFQA 3NH4A 4OC0A 3FEEA 5E3BA 4KSIA 2ZEMA 3GUXA 2XD7A 4F8ZA 2LGRA 3D7HA 4NGQA 3QNVA 3B3TA 3N5FA 1XMBA 1Z2LA 2POKA 3BI0A 3SI1A 3K9TA 4A39A 1ELMP 5K8MA 4A94A 3PB4X 2ABZA 1TXZA 2ZENA 3EW5A 4K3NA 1HDUA 2ANPA 1AYEA 1TKFA 2ZEGA 3IWWA 1Y7EA 2F7VA 2WYRA 1ZG8A 4EWTA 3S9LA 1NJRA 3D7FA 3BHXA 1ZG9A 5JGFA 2PJ8A 3V2BA 3HLPA 1TF8A 3Q6ZA 3SIHA 2NYQA 3EKEA 3SIIA 4ESSA 1XJOA 3PFEA 3KR4A 1YLOA 4MHYA 2DX6A 1TY8A 5HVFA 1XRYA 1SPVA 2O53A 4NGMA 5JM6A 1HJZA 1OBRA 3NA6A 4UEZA 5FSVA 4P45A 2PJAA 4P10A 2BFRA 3EJGA 4WJBA 3D67A 1VHUA 3S9NA 2GU2A 3KGQA 3L2NA 4TWEA 2AFUA 2JBJA 1BAVA 4IHMA 2EK8A 4OMEA 4BD9A 2AFCA 1Z8LA 2V8GA 2XEJA 2VL1A 3B7IA 2XEFA 2PIZA 4RUHA 4OC1A 2EK9A 1BLLE 4MXUA 4X2TA 3HUVA 2X47A 2L8RA 1KWMA 4MCPA 3DGVA 1CBXA 4PXDA 3Q71A 2DEAA 3IJ3A 3IIDA 3KASA 1HDQA 4MHNA 2BOAA 3T8WA 2CTCA 1DE4C 2PE3A 4GM5A 2JBKA 4KYBA 4W9YA 4O23A 4P4JA 3GPQA 2PRQA 4DUKA 4ZY0A 2V77A 4NGPA 1M4LA 2PVWA 3K2KA 3WC7A 2IMOA 4PXEA 4NJRA 1F2OA 3WABA 4F9UA 4P4BA 4GVVA 2CIJA 2ZOFA 4NGTA 3H8EA 1ZR5A 3IC1A 4MCSA 5LRGA 5FSXA 2FVGA 2FG1A 1DTDA 4ONWA 3SIGA 2WZNA 1Z5RA 4H2KA 1LANA 2QVPA 5D8NA 1EE3P 4MCQA 4ETKA 5K8NA 3MRUA 4UF4A 4PPZA 1PYTB 2HB6A 4MMOA 2ZEPA 4J5RA 1TKHA 2RFHA 4AXVA 2QYVA 1FNOA 4J5SA 1VHEA 1LAPA 3FMCA 4IK2A 3RZAA 5LRKA 1ZR3A 2G9DA 5I4MA 1H8LA 4JCAA 2PJ2A 3FX6A 2NSMA 3FF3A 1LCPA 5CMSA 1YSJA 3FH4A 3IO1A 4B6ZA 3PBBA 2PCUA 4MHPA 1FT7A 2EEEA 2BO9A 3PFOA 4P4FA 2V8HA 4OC5A 3H8GA 4FUUA 3B3WA 1R3NA 3PB8X 4X3RA 1PCAA 3EWQA 4CPAA 3EWOA 4ZY2A 3VARA 1NSAA 2QJ8A 2XEGA 3LWUA 3NFZA 4NFRA 2V8VA 3EWPA 2PJ1A 3V7ZA 5DS0A 3NH5A 3BI1A 2F8HA 3FEDA 4P4DA 2RB7A 4YU9A 2C6GA 5CBMA 5LYFA 1YW4A 4PQAA 2OOTA 4R76A 3D4UA 3TX8A 3PRTA 1F2PA 1Y0YA 2JEWA 4ABKA 2HC9A 1VGYA 2AFWA 1CX8A 2GREA 3IEHA 2AFOA 3KQXA 2IQ6A 1RTQA 2AFSA 3TC8A 5HVGA 3ETIA 2AFMA 3VATA 3GPGA 1ARMA 3V45A 3CDXA 4OP4A 2C6CA 4P44A 7CPAA 1XFOA 3B3CA 2Q4ZA 4NGSA 3GQOA 3ISZA 4MHZA 5DUSA 5HIHA 3CT9A 2ZELA 2ZEDA 2PJ3A 3JZTA 5IB9A 3S9MA 5D29A 2XEIA 5AILA 5HOLA 2ACFA 4NGRA 3KZWA 3PB6X 3GLJA 2FAVA 3KHZA 5CPAA 4ABLA 1AMPA 3DLJA 4EMEA 4LQGA 2PJCA 2PJ6A 4ZY1A 2FXKA 3RAMA 5K8PA 3CPAA 3SIJA 2EWBA 2PJ0A 4TNUA 4FBEA 5LYLA 1BPMA 5CB3A 3B3SA 4A37A 8CPAA 4X8IA 4JLLA 3SJGA 3V38A 2C6PA 1CG2A 3WC6A 2BCOA 4JVVA 5JH9A 2ZEFA 3FJUA 3I1UA 4ETJA 1ZLHA 3BXMA 4DYOA 4GUAA 1YW6A 4YWYA 3FECA 5LRJA 1XBUA 3PBEA 3ISXA 1HEEA 2V8DA 3RBUA 2ZEHA 1QMUA 5J1QA 1CP6A 1R43A 1JQGA 4JYWA 1VIXA 4DJLA 2GLFA 3WC5A 2Q43A 2ZOGA 5FSUA 1CPSA 2I3CA 1YD9A 1GYTA 1LOKA 2PJ9A 4TU0A 4MCRA 4OC4A 3SJXA 3IIFA 4Q7AA 4F9VA 3SI0A 3MN8A 1TKJA 5THWA 3PB9X 3EWRA 1YMEA 4UMLA 4D86A 3JRUA 4OC2A 4OIWA 2ZEOA 1Q7LA 4R6TA 5HVHA 1BPNA 1VHOA 4ZI6A 3IFEA 4UEEA 3KQZA 5FSZA 2GLJA 2PJBA 3KL9A 1ARLA 1TF9A 5CB5A 3GPOA 4ZYQA 4UIBA 3NH8A 4IQYA 4K0CA 4NJQA 4ZX9A 1LFWA 2OR4A 4FAIA 1Y0RA 2C1CA 3SJFA 2PJ7A 4UIAA 3LMSA 2ZEEA 5F09A 2PIYA 3SI2A 1ELLP 2PJ4A 2VRIA 3GB0A 4R8FA 5ELYA 4NGNA 3B2YA 3IIBA 4OC3A 4OKOA 2PJ5A 2PVVA 4EFDA 3EJFA 3B35A 2CF4A 3B3VA 4UEFA 1QQ9A 4FWUA 4J5QA 1IY7A 2IJZA 5K8OA 2AFXA 4WWVA 5LYDA 3D68A 1ZLIA 3D7GA 5LYIA 1UWYA 4PXBA 3KI9A 4P6YA 5HXDA 3FVLA 4MRIA 6CPAA 2AFZA 2Q51A 1LAMA 2BFQA 4R7MA 1TXRA 4OIDA 1IGBA 2CTBA 3GQEA 1CP7A 4ZX8A 4JZ0A 3WT4A 3CPXA 4P4IA 3D66A 4Z65A
chains in the Genus database with same CATH superfamily
3H8FA 3PEIA 1Z4EA 4KOVA 4CYOA 1ZG7A 1NE9A 2J9AA 2P6FA 4IAVA 5LYLA 3H4QA 3PB7X 1CPXA 2O4HA 4P4EA 4A38A 1QSMA 3D7DA 1Q2DA 2KCWA 5FSYA 3VH9A 4GVWA 4NSQA 3SJEA 4G1PA 4PXCA 3KR5A 4JGKA 1F57A 3KHXA 4KOWA 4CGPA 1IOIA 4J4ZA 3VFQA 4C2XA 3NH4A 4OC0A 5E3BA 2PR8A 3FEEA 4KSIA 2YGWA 2ZEMA 2XD7A 3CXPA 3FXTA 3GUXA 4NEXA 4ONUA 3SHPA 4F8ZA 4FBEA 2ODFA 1AUGA 4ZGYB 2LGRA 1S7NA 2DXQA 5E96A 1XOVA 3D7HA 4C68A 4NGQA 2R8VA 3QNVA 3B3TA 3N5FA 1XMBA 1Z2LA 3EO4A 4MFLA 2POKA 2B4BA 2BL1A 3BI0A 3SI1A 5KTAA 3K9TA 4A39A 1ELMP 5K8MA 4A94A 3PB4X 3TT2A 2ABZA 2OZUA 1TXZA 2OZGA 2FIAA 2ZENA 3EW5A 4K3NA 1HDUA 2ANPA 1AYEA 3IGRA 3QB8A 1TKFA 2CNSA 3F8KA 2BSWA 1P0HA 2ZEGA 4MBUA 4CYQA 3IWWA 2R1IA 2JZFA 1Y7EA 3RO0A 2F7VA 2D4OA 2WYRA 3F5BA 1ZG8A 4QUSA 4EWTA 1YLEA 3S9LA 4UBRA 1NJRA 2JEVA 4FD5A 3D7FA 2OZHA 2B3UA 2ATRA 4KSAA 3BHXA 5F46A 4KOYA 1ZG9A 5JGFA 2PJ8A 3V2BA 1FY7A 3HLPA 1TF8A 3R9FA 1Z4RA 3Q6ZA 2Q7SA 3SIHA 5AG6A 4BBHA 2NYQA 3D8PA 4MHDA 4C2ZA 2R7HA 3EKEA 3SIIA 4ESSA 1XJOA 3PFEA 4RI1A 5IX3A 3W91A 3KR4A 1YLOA 4MHYA 2DX6A 1TY8A 3G3SA 5HVFA 1XRYA 2ARHA 1SPVA 2O53A 3CZXA 4MFZA 4NGMA 2Z3OA 4QVTA 4B12A 1HJZA 1OBRA 3NA6A 4UEZA 4UFXA 4OLLA 2DF5A 5FSVA 1BO4A 4P45A 4AG7A 2PJAA 4P10A 2HQYA 2BFRA 3EJGA 1MJBA 1OZPA 2DPTA 2P6EA 4WJBA 3D67A 4UWIA 2Q4VA 1VHUA 2J8NA 3S9NA 4KLVA 3SXNA 1LRZA 1V0CA 2DPSA 2GU2A 4M85A 3KGQA 3L2NA 4U9YA 2AFUA 4TWEA 4A95A 2JBJA 2A4NA 2QIRA 4QBJA 3TE4A 3IU2A 1IOFA 1BAVA 2VBQA 1N71A 4IHMA 2EK8A 4OMEA 4A32A 4BD9A 2AFCA 5CNPA 1Z8LA 2V8GA 4F6AA 2WCTA 2XEJA 2QECA 3LACA 4II9A 2PQ8A 4CGOA 3LD2A 1J4JA 2VL1A 3B7IA 2XEFA 2PIZA 4RUHA 4OC1A 2EK9A 2YNCA 4E0AA 3DNSA 3TO6A 1BLLE 3SXOA 1IYLA 2ZXVA 4MXUA 2VZZA 4E8OA 4X2TA 3HUVA 4A2ZA 2X47A 1I12A 2L8RA 1IB1E 1Y7RA 1KWMA 3R1KA 4MCPA 3ZJ0A 3DGVA 1CBXA 5AGEA 4PXDA 1CM0A 4C2YA 2JZEA 3Q71A 2FXFA 2DEAA 4OADA 4MY0A 3IJ3A 3IIDA 2B5GA 4EVYA 4JXQA 3KASA 1HDQA 1S7KA 2YNDA 1IIDA 1Z9UA 3F0AA 4KLWA 4KVXA 4MHNA 5HH1A 3TOAA 2GANA 2BOAA 3EY5A 3T8WA 1TIQA 2CTCA 3TOBA 1DE4C 2PE3A 4GM5A 4K30A 4LX9A 2JDCA 2JBKA 4KYBA 4KS9A 4W9YA 5GCNA 4O23A 3TO9A 4P4JA 4B11A 3GPQA 2PRQA 4DUKA 4ZY0A 2V77A 4NGPA 5H84A 3K9UA 1M4LA 3E0KA 2HUZA 2ZW5A 3P2HA 3OWCA 4MFKA 2PRBA 1M4IA 2PVWA 3FYNA 3K2KA 4Q36A 4DNCA 1Q2YA 2B4DA 2FE7A 3WC7A 5EC4A 3A9LA 2Z3NA 2IMOA 4PXEA 1XIXA 2WPWA 4NXYA 5F48A 4NJRA 1F2OA 2Z3LA 3R9GA 3WABA 2Z11A 1KUXA 4F9UA 4P4BA 4GVVA 4NCZA 2CIJA 2ZOFA 4NGTA 3H8EA 1ZR5A 2Y0MA 4R87A 3IC1A 4MCSA 5LRGA 5FSXA 2FVGA 2PR1A 4MJ8A 2FG1A 1DTDA 4ONWA 3SIGA 4XPDB 2Z0ZA 4Z65A 2GFQA 2WZNA 2GE3A 3QAHA 1YREA 1Z5RA 1LANA 4H2KA 5ISVA 2I79A 5AG7A 5DWNA 2QVPA 5D8NA 1EE3P 2ZW6A 2WSAA 2X7BA 4MCQA 4ETKA 2PC1A 3MRUA 5K8NA 4UF4A 2F5IA 1QSOA 3N7ZA 1QSNA 1SQHA 2BEIA 4PPZA 5AG5A 3RYOA 1PYTB 4CRYB 2HB6A 2OB0A 3FNCA 4UFVA 4MMOA 2ZEPA 4J5RA 1TKHA 2RFHA 1QSRA 4AXVA 2QYVA 4CGMA 3R95A 4CAFA 4UA3A 1FNOA 4J5SA 2D4PA 1VHEA 1LAPA 3FMCA 3NE7A 4IK2A 4PK3A 5DWMA 3RZAA 3S6FA 4ORFA 5LRKA 1ZO0A 1ZR3A 1K4JA 2G9DA 1PU9A 2FSRA 2P6GA 4CYNA 5I0CA 5I4MA 3TFYA 1Q2CA 1H8LA 4JCAA 2CNTA 2PJ2A 2CNMA 3FX6A 3NE8A 3VWEA 2NSMA 3FF3A 1LCPA 5CMSA 4MFJA 5JPHA 1YSJA 3FH4A 3IO1A 4B6ZA 3PBBA 2B58A 2PCUA 4MHPA 2Z3PA 2ZW4A 4CAXA 1FT7A 2EEEA 4HKFA 3D3SA 2VQYA 1L0CA 2BO9A 3PFOA 4F0YA 4P4FA 4C7IA 2V8HA 4OC5A 3H5ZA 3H8GA 3JVNA 4FUUA 1WK4A 3B3WA 4KUBA 1R3NA 3PB8X 1BOBA 2Z3MA 1PCAA 4X3RA 4AVAA 3EWQA 4JWPA 2PSWA 2FCKA 3B8GA 5A28A 4CPAA 2RNKA 3EWOA 4ZY2A 3VARA 1NSAA 2QJ8A 2XEGA 3G8WA 3LWUA 3NFZA 2V8VA 4NFRA 1CJWA 3EWPA 3T9YA 2PJ1A 3MGDA 3V7ZA 2OU2A 3FRMA 4MI4A 4CAWA 5KTDA 4FD4A 5DS0A 4XNHC 3NH5A 1S5KA 3CXSA 3BI1A 2F8HA 3FEDA 4P4DA 4JXRA 2AJ6A 2RB7A 1IYKA 1IICA 4R3KA 3QAYA 4YU9A 2C6GA 2Q44A 5CBMA 4CGNA 1Y9WA 2VXKA 4PSXA 4M6HA 4KOSA 5LYFA 1M4DA 1YW4A 1KZFA 4AVBA 4PQAA 1XF8A 2OOTA 2NMTA 4R76A 2G0BA 3D4UA 1VKCA 4RN7A 3TX8A 4X5KA 5C82A 4JLYA 1M4GA 3LODA 1QSTA 3PGPA 4XPKA 3PRTA 1F2PA 1Y0YA 2JEWA 4ABKA 4CYPA 2HC9A 4B5PA 1VGYA 1NMTA 2AFWA 1IU8A 1CX8A 4L89A 4YGOA 2O28A 2YNEA 2GREA 3TO7A 3IEHA 2AFOA 2B3VA 3W6XA 4F0XA 3KQXA 1YR0A 2IQ6A 4KSFA 2RC4A 4AVCA 1RTQA 4A31A 2AFSA 4PV6A 3CXQA 2EVNA 3BLNA 3TC8A 2G3AA 5HVGA 4JD6A 1VHSA 4FD7A 3ETIA 2AFMA 1B87A 3VATA 3ZZIA 5F47A 3GPGA 1ARMA 4ZBGA 3PP9A 1U6MA 4GXHA 3V45A 1Z8TA 2WUUA 3C26A 3CDXA 3TTHA 4OP4A 2C6CA 4P44A 5EBVA 4IF5A 4CAEA 7CPAA 1XFOA 1S60A 2REFA 4PK2A 1RO5A 2JLMA 2REEA 3B3CA 2Q4ZA 4NGSA 3GQOA 3ISZA 4MHZA 2EUIA 4YRHA 4U9ZA 5DUSA 5HIHA 3CT9A 2ZELA 4L8AA 4BMHA 2ZEDA 2EBJA 1RXTA 1XMTA 2PJ3A 3JZTA 5IB9A 3S9MA 5D29A 2VI7A 2XEIA 5AG4A 4M6GA 5H86A 5C88A 5AILA 1KUVA 1M1DA 1ON0A 5HOLA 2ACFA 1S3ZA 4J3GA 4NGRA 3KZWA 4QC6A 1PUAA 3FBUA 3GLJA 3PB6X 3R9EA 2FAVA 3KHZA 2BUEA 2J8RA 4Y49B 5CPAA 4EMEA 2IL4A 2JZDA 3GYAA 4ABLA 2PDOA 1AMPA 1MK4A 3DLJA 3JTKA 4LQGA 2PJCA 2B4DB 2PJ6A 5EMIA 4CRZB 4ZY1A 2ZW7A 2FXKA 5F49A 2KQVA 3RAMA 5K8PA 3CPAA 3SIJA 3VWDA 5BWAB 2EWBA 1R57A 2PJ0A 3EC4A 4TNUA 1BPMA 5CB3A 3B3SA 3P2FA 1GHEA 4NF1A 4X8IA 4A37A 4JLLA 8CPAA 4PSWA 3SJGA 3V38A 4B5PB 2C6PA 1CG2A 3WC6A 4E2AA 2BCOA 4MFQA 4JVVA 4XNHB 5JH9A 2ZEFA 3FJUA 3I1UA 4R57A 3GY9A 4ETJA 1ZLHA 3BXMA 4I49A 4DYOA 4GUAA 1YW6A 4YWYA 2J8MA 1P4NA 1YK3A 2WPXA 1S7FA 1KUYA 3FECA 2OH1A 2Z3KA 4C7HA 4KVME 4KOTA 5LRJA 1XBUA 2G3TA 3PBEA 3ISXA 2Q0YA 1HEEA 2V8DA 3RBUA 5IB0A 2B5GB 4U5YA 4H89A 4M6IA 4XPLA 2ZEHA 1QMUA 1WWZA 5J1QA 4M3SA 4MFPA 1CP6A 4OAEA 5G1ZA 3S6GA 3W6SA 5KTCA 4KVOE 1R43A 1JQGA 4JYWA 1VIXA 3RNZA 4DJLA 4JJXA 2GLFA 3FB3A 3V8IA 1YX0A 4H6UA 1X10A 3WC5A 1I1DA 2Q43A 2ZOGA 5FSUA 1CPSA 1Z8WA 2I3CA 1YD9A 1GYTA 1LOKA 1Z8XA 3GIUA 2PJ9A 3UY5A 3S6HA 4TU0A 3JUWA 4MCRA 4OC4A 3IWGA 2QMLA 3IWEA 3SJXA 3TCVA 3IIFA 4HNWB 4Q7AA 2CY2A 4LUAA 3IU1A 4F9VA 4B13A 1S7LA 3SI0A 3MN8A 1TKJA 4KORA 5FVJA 3PB9X 5THWA 3EWRA 1YMEA 3I3GA 4UMLA 4HPSA 4KOUA 4UCMA 4D86A 5J8CA 4CGLA 4A30A 3D2PA 3JRUA 4OC2A 4RS2A 1I21A 5JM6A 3GKRA 4UCNA 4OIWA 1YGHA 2ZEOA 4B10A 1XE4A 1Q7LA 4R6TA 5HVHA 4A33A 2FL4A 1BPNA 2R98A 3FIXA 4R9MA 5HMNA 1VHOA 4ZI6A 3PZJA 3IFEA 4UWJA 2VEZA 4UEEA 2HV2A 3KQZA 5FSZA 2FIWA 2GLJA 2PJBA 3I9SA 3KL9A 4KOXA 1ARLA 2GIVA 4LQ6A 1UFHA 1TF9A 5CB5A 4HNXB 3WR7A 4QB9A 4KZTA 3GPOA 4ZYQA 4UIBA 3NH8A 2K5TA 4IQYA 4K0CA 1JWQA 2P0WA 4NJQA 4ZX9A 4XPDC 2FS5A 1XEBA 1LFWA 3BJ7A 2OR4A 3KKWA 4FAIA 1Y0RA 2C1CA 3SJFA 2PJ7A 4UIAA 4YFJA 3DR6A 3LMSA 4CS0B 5IV0A 3DR8A 1YQEA 2ZEEA 4AG9A 5F09A 2PIYA 3SI2A 2EO8A 1ELLP 2PJ4A 2CXAA 3D2MA 2C27A 2VRIA 2FT0A 3GB0A 2JDDA 4NGNA 3B2YA 4R8FA 5ELYA 3IIBA 4OC3A 2W2GA 4OKOA 2PJ5A 2PVVA 3EXNA 4HNYB 1MJ9A 2Z10A 5A27A 2Q7BA 4EFDA 1X12A 1B6BA 3EJFA 3B35A 2CF4A 2VZYA 1Y9KA 3B3VA 4UEFA 1A2ZA 3T90A 1NSLA 1QQ9A 4CAVA 1MJAA 4FWUA 4MY3A 4J5QA 1IY7A 3EFAA 2AE6A 2IJZA 5K8OA 2AFXA 4WWVA 3BJ8A 2I00A 5LYDA 5JQ4A 3D68A 1YVOA 1YVKA 1ZLIA 3D7GA 2YNCC 3DSBA 4FD6A 4KUAA 5G20A 3S6KA 5J8FA 5LYIA 1UWYA 2Q04A 4PXBA 2ZPAA 3KI9A 4P6YA 4GS4A 4Y49C 4R3LA 5HXDA 3DDDA 3FVLA 4MRIA 6CPAA 2AFZA 4UCPA 2Q51A 4B5OA 1LAMA 2BFQA 4R7MA 2H5MA 3R96A 4AB7A 1TXRA 4IUSA 1M44A 4B14A 5G21A 4OIDA 1IGBA 2CTBA 3GQEA 5G22A 1CP7A 4ZX8A 2Q4YA 4JZ0A 3WT4A 4UFWA 4BINA 4H6ZA 3CPXA 4P4IA 3D66A 4Q38A
chains in the Genus database with same CATH topology
3H8FA 3PEIA 1ZG7A 2J9AA 4IAVA 3PB7X 1CPXA 2O4HA 4P4EA 4A38A 3D7DA 5FSYA 3VH9A 4GVWA 3SJEA 4G1PA 4PXCA 3KR5A 4JGKA 1F57A 3KHXA 4J4ZA 3VFQA 3NH4A 4OC0A 3FEEA 5E3BA 4KSIA 2ZEMA 3GUXA 2XD7A 4F8ZA 2LGRA 3D7HA 4NGQA 3QNVA 3B3TA 3N5FA 1XMBA 1Z2LA 2POKA 3BI0A 3SI1A 3K9TA 4A39A 1ELMP 5K8MA 4A94A 3PB4X 2ABZA 1TXZA 2ZENA 3EW5A 4K3NA 1HDUA 2ANPA 1AYEA 1TKFA 2ZEGA 3IWWA 1Y7EA 2F7VA 2WYRA 1ZG8A 4EWTA 3S9LA 1NJRA 3D7FA 3BHXA 1ZG9A 5JGFA 2PJ8A 3V2BA 3HLPA 1TF8A 3Q6ZA 3SIHA 2NYQA 3EKEA 3SIIA 4ESSA 1XJOA 3PFEA 3KR4A 1YLOA 4MHYA 2DX6A 1TY8A 5HVFA 1XRYA 1SPVA 2O53A 4NGMA 5JM6A 1HJZA 1OBRA 3NA6A 4UEZA 5FSVA 4P45A 2PJAA 4P10A 2BFRA 3EJGA 4WJBA 3D67A 1VHUA 3S9NA 2GU2A 3KGQA 3L2NA 4TWEA 2AFUA 2JBJA 1BAVA 4IHMA 2EK8A 4OMEA 4BD9A 2AFCA 1Z8LA 2V8GA 2XEJA 2VL1A 3B7IA 2XEFA 2PIZA 4RUHA 4OC1A 2EK9A 1BLLE 4MXUA 4X2TA 3HUVA 2X47A 2L8RA 1KWMA 4MCPA 3DGVA 1CBXA 4PXDA 3Q71A 2DEAA 3IJ3A 3IIDA 3KASA 1HDQA 4MHNA 2BOAA 3T8WA 2CTCA 1DE4C 2PE3A 4GM5A 2JBKA 4KYBA 4W9YA 4O23A 4P4JA 3GPQA 2PRQA 4DUKA 4ZY0A 2V77A 4NGPA 1M4LA 2PVWA 3K2KA 3WC7A 2IMOA 4PXEA 4NJRA 1F2OA 3WABA 4F9UA 4P4BA 4GVVA 2CIJA 2ZOFA 4NGTA 3H8EA 1ZR5A 3IC1A 4MCSA 5LRGA 5FSXA 2FVGA 2FG1A 1DTDA 4ONWA 3SIGA 2WZNA 1Z5RA 4H2KA 1LANA 2QVPA 5D8NA 1EE3P 4MCQA 4ETKA 5K8NA 3MRUA 4UF4A 4PPZA 1PYTB 2HB6A 4MMOA 2ZEPA 4J5RA 1TKHA 2RFHA 4AXVA 2QYVA 1FNOA 4J5SA 1VHEA 1LAPA 3FMCA 4IK2A 3RZAA 5LRKA 1ZR3A 2G9DA 5I4MA 1H8LA 4JCAA 2PJ2A 3FX6A 2NSMA 3FF3A 1LCPA 5CMSA 1YSJA 3FH4A 3IO1A 4B6ZA 3PBBA 2PCUA 4MHPA 1FT7A 2EEEA 2BO9A 3PFOA 4P4FA 2V8HA 4OC5A 3H8GA 4FUUA 3B3WA 1R3NA 3PB8X 4X3RA 1PCAA 3EWQA 4CPAA 3EWOA 4ZY2A 3VARA 1NSAA 2QJ8A 2XEGA 3LWUA 3NFZA 4NFRA 2V8VA 3EWPA 2PJ1A 3V7ZA 5DS0A 3NH5A 3BI1A 2F8HA 3FEDA 4P4DA 2RB7A 4YU9A 2C6GA 5CBMA 5LYFA 1YW4A 4PQAA 2OOTA 4R76A 3D4UA 3TX8A 3PRTA 1F2PA 1Y0YA 2JEWA 4ABKA 2HC9A 1VGYA 2AFWA 1CX8A 2GREA 3IEHA 2AFOA 3KQXA 2IQ6A 1RTQA 2AFSA 3TC8A 5HVGA 3ETIA 2AFMA 3VATA 3GPGA 1ARMA 3V45A 3CDXA 4OP4A 2C6CA 4P44A 7CPAA 1XFOA 3B3CA 2Q4ZA 4NGSA 3GQOA 3ISZA 4MHZA 5DUSA 5HIHA 3CT9A 2ZELA 2ZEDA 2PJ3A 3JZTA 5IB9A 3S9MA 5D29A 2XEIA 5AILA 5HOLA 2ACFA 4NGRA 3KZWA 3PB6X 3GLJA 2FAVA 3KHZA 5CPAA 4ABLA 1AMPA 3DLJA 4EMEA 4LQGA 2PJCA 2PJ6A 4ZY1A 2FXKA 3RAMA 5K8PA 3CPAA 3SIJA 2EWBA 2PJ0A 4TNUA 4FBEA 5LYLA 1BPMA 5CB3A 3B3SA 4A37A 8CPAA 4X8IA 4JLLA 3SJGA 3V38A 2C6PA 1CG2A 3WC6A 2BCOA 4JVVA 5JH9A 2ZEFA 3FJUA 3I1UA 4ETJA 1ZLHA 3BXMA 4DYOA 4GUAA 1YW6A 4YWYA 3FECA 5LRJA 1XBUA 3PBEA 3ISXA 1HEEA 2V8DA 3RBUA 2ZEHA 1QMUA 5J1QA 1CP6A 1R43A 1JQGA 4JYWA 1VIXA 4DJLA 2GLFA 3WC5A 2Q43A 2ZOGA 5FSUA 1CPSA 2I3CA 1YD9A 1GYTA 1LOKA 2PJ9A 4TU0A 4MCRA 4OC4A 3SJXA 3IIFA 4Q7AA 4F9VA 3SI0A 3MN8A 1TKJA 5THWA 3PB9X 3EWRA 1YMEA 4UMLA 4D86A 3JRUA 4OC2A 4OIWA 2ZEOA 1Q7LA 4R6TA 5HVHA 1BPNA 1VHOA 4ZI6A 3IFEA 4UEEA 3KQZA 5FSZA 2GLJA 2PJBA 3KL9A 1ARLA 1TF9A 5CB5A 3GPOA 4ZYQA 4UIBA 3NH8A 4IQYA 4K0CA 4NJQA 4ZX9A 1LFWA 2OR4A 4FAIA 1Y0RA 2C1CA 3SJFA 2PJ7A 4UIAA 3LMSA 2ZEEA 5F09A 2PIYA 3SI2A 1ELLP 2PJ4A 2VRIA 3GB0A 4R8FA 5ELYA 4NGNA 3B2YA 3IIBA 4OC3A 4OKOA 2PJ5A 2PVVA 4EFDA 3EJFA 3B35A 2CF4A 3B3VA 4UEFA 1QQ9A 4FWUA 4J5QA 1IY7A 2IJZA 5K8OA 2AFXA 4WWVA 5LYDA 3D68A 1ZLIA 3D7GA 5LYIA 1UWYA 4PXBA 3KI9A 4P6YA 5HXDA 3FVLA 4MRIA 6CPAA 2AFZA 2Q51A 1LAMA 2BFQA 4R7MA 1TXRA 4OIDA 1IGBA 2CTBA 3GQEA 1CP7A 4ZX8A 4JZ0A 3WT4A 3CPXA 4P4IA 3D66A 4Z65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8F A;  3PEI A;  1ZG7 A;  2J9A A;  4IAV A;  3PB7 X;  1CPX A;  2O4H A;  4P4E A;  4A38 A;  3D7D A;  5FSY A;  3VH9 A;  4GVW A;  3SJE A;  4G1P A;  4PXC A;  3KR5 A;  4JGK A;  1F57 A;  3KHX A;  4J4Z A;  3VFQ A;  3NH4 A;  4OC0 A;  3FEE A;  5E3B A;  4KSI A;  2ZEM A;  3GUX A;  2XD7 A;  4F8Z A;  2LGR A;  3D7H A;  4NGQ A;  3QNV A;  3B3T A;  3N5F A;  1XMB A;  1Z2L A;  2POK A;  3BI0 A;  3SI1 A;  3K9T A;  4A39 A;  1ELM P;  5K8M A;  4A94 A;  3PB4 X;  2ABZ A;  1TXZ A;  2ZEN A;  3EW5 A;  4K3N A;  1HDU A;  2ANP A;  1AYE A;  1TKF A;  2ZEG A;  3IWW A;  1Y7E A;  2F7V A;  2WYR A;  1ZG8 A;  4EWT A;  3S9L A;  1NJR A;  3D7F A;  3BHX A;  1ZG9 A;  5JGF A;  2PJ8 A;  3V2B A;  3HLP A;  1TF8 A;  3Q6Z A;  3SIH A;  2NYQ A;  3EKE A;  3SII A;  4ESS A;  1XJO A;  3PFE A;  3KR4 A;  1YLO A;  4MHY A;  2DX6 A;  1TY8 A;  5HVF A;  1XRY A;  1SPV A;  2O53 A;  4NGM A;  5JM6 A;  1HJZ A;  1OBR A;  3NA6 A;  4UEZ A;  5FSV A;  4P45 A;  2PJA A;  4P10 A;  2BFR A;  3EJG A;  4WJB A;  3D67 A;  1VHU A;  3S9N A;  2GU2 A;  3KGQ A;  3L2N A;  4TWE A;  2AFU A;  2JBJ A;  1BAV A;  4IHM A;  2EK8 A;  4OME A;  4BD9 A;  2AFC A;  1Z8L A;  2V8G A;  2XEJ A;  2VL1 A;  3B7I A;  2XEF A;  2PIZ A;  4RUH A;  4OC1 A;  2EK9 A;  1BLL E;  4MXU A;  4X2T A;  3HUV A;  2X47 A;  2L8R A;  1KWM A;  4MCP A;  3DGV A;  1CBX A;  4PXD A;  3Q71 A;  2DEA A;  3IJ3 A;  3IID A;  3KAS A;  1HDQ A;  4MHN A;  2BOA A;  3T8W A;  2CTC A;  1DE4 C;  2PE3 A;  4GM5 A;  2JBK A;  4KYB A;  4W9Y A;  4O23 A;  4P4J A;  3GPQ A;  2PRQ A;  4DUK A;  4ZY0 A;  2V77 A;  4NGP A;  1M4L A;  2PVW A;  3K2K A;  3WC7 A;  2IMO A;  4PXE A;  4NJR A;  1F2O A;  3WAB A;  4F9U A;  4P4B A;  4GVV A;  2CIJ A;  2ZOF A;  4NGT A;  3H8E A;  1ZR5 A;  3IC1 A;  4MCS A;  5LRG A;  5FSX A;  2FVG A;  2FG1 A;  1DTD A;  4ONW A;  3SIG A;  2WZN A;  1Z5R A;  4H2K A;  1LAN A;  2QVP A;  5D8N A;  1EE3 P;  4MCQ A;  4ETK A;  5K8N A;  3MRU A;  4UF4 A;  4PPZ A;  1PYT B;  2HB6 A;  4MMO A;  2ZEP A;  4J5R A;  1TKH A;  2RFH A;  4AXV A;  2QYV A;  1FNO A;  4J5S A;  1VHE A;  1LAP A;  3FMC A;  4IK2 A;  3RZA A;  5LRK A;  1ZR3 A;  2G9D A;  5I4M A;  1H8L A;  4JCA A;  2PJ2 A;  3FX6 A;  2NSM A;  3FF3 A;  1LCP A;  5CMS A;  1YSJ A;  3FH4 A;  3IO1 A;  4B6Z A;  3PBB A;  2PCU A;  4MHP A;  1FT7 A;  2EEE A;  2BO9 A;  3PFO A;  4P4F A;  2V8H A;  4OC5 A;  3H8G A;  4FUU A;  3B3W A;  1R3N A;  3PB8 X;  4X3R A;  1PCA A;  3EWQ A;  4CPA A;  3EWO A;  4ZY2 A;  3VAR A;  1NSA A;  2QJ8 A;  2XEG A;  3LWU A;  3NFZ A;  4NFR A;  2V8V A;  3EWP A;  2PJ1 A;  3V7Z A;  5DS0 A;  3NH5 A;  3BI1 A;  2F8H A;  3FED A;  4P4D A;  2RB7 A;  4YU9 A;  2C6G A;  5CBM A;  5LYF A;  1YW4 A;  4PQA A;  2OOT A;  4R76 A;  3D4U A;  3TX8 A;  3PRT A;  1F2P A;  1Y0Y A;  2JEW A;  4ABK A;  2HC9 A;  1VGY A;  2AFW A;  1CX8 A;  2GRE A;  3IEH A;  2AFO A;  3KQX A;  2IQ6 A;  1RTQ A;  2AFS A;  3TC8 A;  5HVG A;  3ETI A;  2AFM A;  3VAT A;  3GPG A;  1ARM A;  3V45 A;  3CDX A;  4OP4 A;  2C6C A;  4P44 A;  7CPA A;  1XFO A;  3B3C A;  2Q4Z A;  4NGS A;  3GQO A;  3ISZ A;  4MHZ A;  5DUS A;  5HIH A;  3CT9 A;  2ZEL A;  2ZED A;  2PJ3 A;  3JZT A;  5IB9 A;  3S9M A;  5D29 A;  2XEI A;  5AIL A;  5HOL A;  2ACF A;  4NGR A;  3KZW A;  3PB6 X;  3GLJ A;  2FAV A;  3KHZ A;  5CPA A;  4ABL A;  1AMP A;  3DLJ A;  4EME A;  4LQG A;  2PJC A;  2PJ6 A;  4ZY1 A;  2FXK A;  3RAM A;  5K8P A;  3CPA A;  3SIJ A;  2EWB A;  2PJ0 A;  4TNU A;  4FBE A;  5LYL A;  1BPM A;  5CB3 A;  3B3S A;  4A37 A;  8CPA A;  4X8I A;  4JLL A;  3SJG A;  3V38 A;  2C6P A;  1CG2 A;  3WC6 A;  2BCO A;  4JVV A;  5JH9 A;  2ZEF A;  3FJU A;  3I1U A;  4ETJ A;  1ZLH A;  3BXM A;  4DYO A;  4GUA A;  1YW6 A;  4YWY A;  3FEC A;  5LRJ A;  1XBU A;  3PBE A;  3ISX A;  1HEE A;  2V8D A;  3RBU A;  2ZEH A;  1QMU A;  5J1Q A;  1CP6 A;  1R43 A;  1JQG A;  4JYW A;  1VIX A;  4DJL A;  2GLF A;  3WC5 A;  2Q43 A;  2ZOG A;  5FSU A;  1CPS A;  2I3C A;  1YD9 A;  1GYT A;  1LOK A;  2PJ9 A;  4TU0 A;  4MCR A;  4OC4 A;  3SJX A;  3IIF A;  4Q7A A;  4F9V A;  3SI0 A;  3MN8 A;  1TKJ A;  5THW A;  3PB9 X;  3EWR A;  1YME A;  4UML A;  4D86 A;  3JRU A;  4OC2 A;  4OIW A;  2ZEO A;  1Q7L A;  4R6T A;  5HVH A;  1BPN A;  1VHO A;  4ZI6 A;  3IFE A;  4UEE A;  3KQZ A;  5FSZ A;  2GLJ A;  2PJB A;  3KL9 A;  1ARL A;  1TF9 A;  5CB5 A;  3GPO A;  4ZYQ A;  4UIB A;  3NH8 A;  4IQY A;  4K0C A;  4NJQ A;  4ZX9 A;  1LFW A;  2OR4 A;  4FAI A;  1Y0R A;  2C1C A;  3SJF A;  2PJ7 A;  4UIA A;  3LMS A;  2ZEE A;  5F09 A;  2PIY A;  3SI2 A;  1ELL P;  2PJ4 A;  2VRI A;  3GB0 A;  4R8F A;  5ELY A;  4NGN A;  3B2Y A;  3IIB A;  4OC3 A;  4OKO A;  2PJ5 A;  2PVV A;  4EFD A;  3EJF A;  3B35 A;  2CF4 A;  3B3V A;  4UEF A;  1QQ9 A;  4FWU A;  4J5Q A;  1IY7 A;  2IJZ A;  5K8O A;  2AFX A;  4WWV A;  5LYD A;  3D68 A;  1ZLI A;  3D7G A;  5LYI A;  1UWY A;  4PXB A;  3KI9 A;  4P6Y A;  5HXD A;  3FVL A;  4MRI A;  6CPA A;  2AFZ A;  2Q51 A;  1LAM A;  2BFQ A;  4R7M A;  1TXR A;  4OID A;  1IGB A;  2CTB A;  3GQE A;  1CP7 A;  4ZX8 A;  4JZ0 A;  3WT4 A;  3CPX A;  4P4I A;  3D66 A;  4Z65 A; 
#chains in the Genus database with same CATH topology
 3H8F A;  3PEI A;  1Z4E A;  4KOV A;  4CYO A;  1ZG7 A;  1NE9 A;  2J9A A;  2P6F A;  4IAV A;  5LYL A;  3H4Q A;  3PB7 X;  1CPX A;  2O4H A;  4P4E A;  4A38 A;  1QSM A;  3D7D A;  1Q2D A;  2KCW A;  5FSY A;  3VH9 A;  4GVW A;  4NSQ A;  3SJE A;  4G1P A;  4PXC A;  3KR5 A;  4JGK A;  1F57 A;  3KHX A;  4KOW A;  4CGP A;  1IOI A;  4J4Z A;  3VFQ A;  4C2X A;  3NH4 A;  4OC0 A;  5E3B A;  2PR8 A;  3FEE A;  4KSI A;  2YGW A;  2ZEM A;  2XD7 A;  3CXP A;  3FXT A;  3GUX A;  4NEX A;  4ONU A;  3SHP A;  4F8Z A;  4FBE A;  2ODF A;  1AUG A;  4ZGY B;  2LGR A;  1S7N A;  2DXQ A;  5E96 A;  1XOV A;  3D7H A;  4C68 A;  4NGQ A;  2R8V A;  3QNV A;  3B3T A;  3N5F A;  1XMB A;  1Z2L A;  3EO4 A;  4MFL A;  2POK A;  2B4B A;  2BL1 A;  3BI0 A;  3SI1 A;  5KTA A;  3K9T A;  4A39 A;  1ELM P;  5K8M A;  4A94 A;  3PB4 X;  3TT2 A;  2ABZ A;  2OZU A;  1TXZ A;  2OZG A;  2FIA A;  2ZEN A;  3EW5 A;  4K3N A;  1HDU A;  2ANP A;  1AYE A;  3IGR A;  3QB8 A;  1TKF A;  2CNS A;  3F8K A;  2BSW A;  1P0H A;  2ZEG A;  4MBU A;  4CYQ A;  3IWW A;  2R1I A;  2JZF A;  1Y7E A;  3RO0 A;  2F7V A;  2D4O A;  2WYR A;  3F5B A;  1ZG8 A;  4QUS A;  4EWT A;  1YLE A;  3S9L A;  4UBR A;  1NJR A;  2JEV A;  4FD5 A;  3D7F A;  2OZH A;  2B3U A;  2ATR A;  4KSA A;  3BHX A;  5F46 A;  4KOY A;  1ZG9 A;  5JGF A;  2PJ8 A;  3V2B A;  1FY7 A;  3HLP A;  1TF8 A;  3R9F A;  1Z4R A;  3Q6Z A;  2Q7S A;  3SIH A;  5AG6 A;  4BBH A;  2NYQ A;  3D8P A;  4MHD A;  4C2Z A;  2R7H A;  3EKE A;  3SII A;  4ESS A;  1XJO A;  3PFE A;  4RI1 A;  5IX3 A;  3W91 A;  3KR4 A;  1YLO A;  4MHY A;  2DX6 A;  1TY8 A;  3G3S A;  5HVF A;  1XRY A;  2ARH A;  1SPV A;  2O53 A;  3CZX A;  4MFZ A;  4NGM A;  2Z3O A;  4QVT A;  4B12 A;  1HJZ A;  1OBR A;  3NA6 A;  4UEZ A;  4UFX A;  4OLL A;  2DF5 A;  5FSV A;  1BO4 A;  4P45 A;  4AG7 A;  2PJA A;  4P10 A;  2HQY A;  2BFR A;  3EJG A;  1MJB A;  1OZP A;  2DPT A;  2P6E A;  4WJB A;  3D67 A;  4UWI A;  2Q4V A;  1VHU A;  2J8N A;  3S9N A;  4KLV A;  3SXN A;  1LRZ A;  1V0C A;  2DPS A;  2GU2 A;  4M85 A;  3KGQ A;  3L2N A;  4U9Y A;  2AFU A;  4TWE A;  4A95 A;  2JBJ A;  2A4N A;  2QIR A;  4QBJ A;  3TE4 A;  3IU2 A;  1IOF A;  1BAV A;  2VBQ A;  1N71 A;  4IHM A;  2EK8 A;  4OME A;  4A32 A;  4BD9 A;  2AFC A;  5CNP A;  1Z8L A;  2V8G A;  4F6A A;  2WCT A;  2XEJ A;  2QEC A;  3LAC A;  4II9 A;  2PQ8 A;  4CGO A;  3LD2 A;  1J4J A;  2VL1 A;  3B7I A;  2XEF A;  2PIZ A;  4RUH A;  4OC1 A;  2EK9 A;  2YNC A;  4E0A A;  3DNS A;  3TO6 A;  1BLL E;  3SXO A;  1IYL A;  2ZXV A;  4MXU A;  2VZZ A;  4E8O A;  4X2T A;  3HUV A;  4A2Z A;  2X47 A;  1I12 A;  2L8R A;  1IB1 E;  1Y7R A;  1KWM A;  3R1K A;  4MCP A;  3ZJ0 A;  3DGV A;  1CBX A;  5AGE A;  4PXD A;  1CM0 A;  4C2Y A;  2JZE A;  3Q71 A;  2FXF A;  2DEA A;  4OAD A;  4MY0 A;  3IJ3 A;  3IID A;  2B5G A;  4EVY A;  4JXQ A;  3KAS A;  1HDQ A;  1S7K A;  2YND A;  1IID A;  1Z9U A;  3F0A A;  4KLW A;  4KVX A;  4MHN A;  5HH1 A;  3TOA A;  2GAN A;  2BOA A;  3EY5 A;  3T8W A;  1TIQ A;  2CTC A;  3TOB A;  1DE4 C;  2PE3 A;  4GM5 A;  4K30 A;  4LX9 A;  2JDC A;  2JBK A;  4KYB A;  4KS9 A;  4W9Y A;  5GCN A;  4O23 A;  3TO9 A;  4P4J A;  4B11 A;  3GPQ A;  2PRQ A;  4DUK A;  4ZY0 A;  2V77 A;  4NGP A;  5H84 A;  3K9U A;  1M4L A;  3E0K A;  2HUZ A;  2ZW5 A;  3P2H A;  3OWC A;  4MFK A;  2PRB A;  1M4I A;  2PVW A;  3FYN A;  3K2K A;  4Q36 A;  4DNC A;  1Q2Y A;  2B4D A;  2FE7 A;  3WC7 A;  5EC4 A;  3A9L A;  2Z3N A;  2IMO A;  4PXE A;  1XIX A;  2WPW A;  4NXY A;  5F48 A;  4NJR A;  1F2O A;  2Z3L A;  3R9G A;  3WAB A;  2Z11 A;  1KUX A;  4F9U A;  4P4B A;  4GVV A;  4NCZ A;  2CIJ A;  2ZOF A;  4NGT A;  3H8E A;  1ZR5 A;  2Y0M A;  4R87 A;  3IC1 A;  4MCS A;  5LRG A;  5FSX A;  2FVG A;  2PR1 A;  4MJ8 A;  2FG1 A;  1DTD A;  4ONW A;  3SIG A;  4XPD B;  2Z0Z A;  4Z65 A;  2GFQ A;  2WZN A;  2GE3 A;  3QAH A;  1YRE A;  1Z5R A;  1LAN A;  4H2K A;  5ISV A;  2I79 A;  5AG7 A;  5DWN A;  2QVP A;  5D8N A;  1EE3 P;  2ZW6 A;  2WSA A;  2X7B A;  4MCQ A;  4ETK A;  2PC1 A;  3MRU A;  5K8N A;  4UF4 A;  2F5I A;  1QSO A;  3N7Z A;  1QSN A;  1SQH A;  2BEI A;  4PPZ A;  5AG5 A;  3RYO A;  1PYT B;  4CRY B;  2HB6 A;  2OB0 A;  3FNC A;  4UFV A;  4MMO A;  2ZEP A;  4J5R A;  1TKH A;  2RFH A;  1QSR A;  4AXV A;  2QYV A;  4CGM A;  3R95 A;  4CAF A;  4UA3 A;  1FNO A;  4J5S A;  2D4P A;  1VHE A;  1LAP A;  3FMC A;  3NE7 A;  4IK2 A;  4PK3 A;  5DWM A;  3RZA A;  3S6F A;  4ORF A;  5LRK A;  1ZO0 A;  1ZR3 A;  1K4J A;  2G9D A;  1PU9 A;  2FSR A;  2P6G A;  4CYN A;  5I0C A;  5I4M A;  3TFY A;  1Q2C A;  1H8L A;  4JCA A;  2CNT A;  2PJ2 A;  2CNM A;  3FX6 A;  3NE8 A;  3VWE A;  2NSM A;  3FF3 A;  1LCP A;  5CMS A;  4MFJ A;  5JPH A;  1YSJ A;  3FH4 A;  3IO1 A;  4B6Z A;  3PBB A;  2B58 A;  2PCU A;  4MHP A;  2Z3P A;  2ZW4 A;  4CAX A;  1FT7 A;  2EEE A;  4HKF A;  3D3S A;  2VQY A;  1L0C A;  2BO9 A;  3PFO A;  4F0Y A;  4P4F A;  4C7I A;  2V8H A;  4OC5 A;  3H5Z A;  3H8G A;  3JVN A;  4FUU A;  1WK4 A;  3B3W A;  4KUB A;  1R3N A;  3PB8 X;  1BOB A;  2Z3M A;  1PCA A;  4X3R A;  4AVA A;  3EWQ A;  4JWP A;  2PSW A;  2FCK A;  3B8G A;  5A28 A;  4CPA A;  2RNK A;  3EWO A;  4ZY2 A;  3VAR A;  1NSA A;  2QJ8 A;  2XEG A;  3G8W A;  3LWU A;  3NFZ A;  2V8V A;  4NFR A;  1CJW A;  3EWP A;  3T9Y A;  2PJ1 A;  3MGD A;  3V7Z A;  2OU2 A;  3FRM A;  4MI4 A;  4CAW A;  5KTD A;  4FD4 A;  5DS0 A;  4XNH C;  3NH5 A;  1S5K A;  3CXS A;  3BI1 A;  2F8H A;  3FED A;  4P4D A;  4JXR A;  2AJ6 A;  2RB7 A;  1IYK A;  1IIC A;  4R3K A;  3QAY A;  4YU9 A;  2C6G A;  2Q44 A;  5CBM A;  4CGN A;  1Y9W A;  2VXK A;  4PSX A;  4M6H A;  4KOS A;  5LYF A;  1M4D A;  1YW4 A;  1KZF A;  4AVB A;  4PQA A;  1XF8 A;  2OOT A;  2NMT A;  4R76 A;  2G0B A;  3D4U A;  1VKC A;  4RN7 A;  3TX8 A;  4X5K A;  5C82 A;  4JLY A;  1M4G A;  3LOD A;  1QST A;  3PGP A;  4XPK A;  3PRT A;  1F2P A;  1Y0Y A;  2JEW A;  4ABK A;  4CYP A;  2HC9 A;  4B5P A;  1VGY A;  1NMT A;  2AFW A;  1IU8 A;  1CX8 A;  4L89 A;  4YGO A;  2O28 A;  2YNE A;  2GRE A;  3TO7 A;  3IEH A;  2AFO A;  2B3V A;  3W6X A;  4F0X A;  3KQX A;  1YR0 A;  2IQ6 A;  4KSF A;  2RC4 A;  4AVC A;  1RTQ A;  4A31 A;  2AFS A;  4PV6 A;  3CXQ A;  2EVN A;  3BLN A;  3TC8 A;  2G3A A;  5HVG A;  4JD6 A;  1VHS A;  4FD7 A;  3ETI A;  2AFM A;  1B87 A;  3VAT A;  3ZZI A;  5F47 A;  3GPG A;  1ARM A;  4ZBG A;  3PP9 A;  1U6M A;  4GXH A;  3V45 A;  1Z8T A;  2WUU A;  3C26 A;  3CDX A;  3TTH A;  4OP4 A;  2C6C A;  4P44 A;  5EBV A;  4IF5 A;  4CAE A;  7CPA A;  1XFO A;  1S60 A;  2REF A;  4PK2 A;  1RO5 A;  2JLM A;  2REE A;  3B3C A;  2Q4Z A;  4NGS A;  3GQO A;  3ISZ A;  4MHZ A;  2EUI A;  4YRH A;  4U9Z A;  5DUS A;  5HIH A;  3CT9 A;  2ZEL A;  4L8A A;  4BMH A;  2ZED A;  2EBJ A;  1RXT A;  1XMT A;  2PJ3 A;  3JZT A;  5IB9 A;  3S9M A;  5D29 A;  2VI7 A;  2XEI A;  5AG4 A;  4M6G A;  5H86 A;  5C88 A;  5AIL A;  1KUV A;  1M1D A;  1ON0 A;  5HOL A;  2ACF A;  1S3Z A;  4J3G A;  4NGR A;  3KZW A;  4QC6 A;  1PUA A;  3FBU A;  3GLJ A;  3PB6 X;  3R9E A;  2FAV A;  3KHZ A;  2BUE A;  2J8R A;  4Y49 B;  5CPA A;  4EME A;  2IL4 A;  2JZD A;  3GYA A;  4ABL A;  2PDO A;  1AMP A;  1MK4 A;  3DLJ A;  3JTK A;  4LQG A;  2PJC A;  2B4D B;  2PJ6 A;  5EMI A;  4CRZ B;  4ZY1 A;  2ZW7 A;  2FXK A;  5F49 A;  2KQV A;  3RAM A;  5K8P A;  3CPA A;  3SIJ A;  3VWD A;  5BWA B;  2EWB A;  1R57 A;  2PJ0 A;  3EC4 A;  4TNU A;  1BPM A;  5CB3 A;  3B3S A;  3P2F A;  1GHE A;  4NF1 A;  4X8I A;  4A37 A;  4JLL A;  8CPA A;  4PSW A;  3SJG A;  3V38 A;  4B5P B;  2C6P A;  1CG2 A;  3WC6 A;  4E2A A;  2BCO A;  4MFQ A;  4JVV A;  4XNH B;  5JH9 A;  2ZEF A;  3FJU A;  3I1U A;  4R57 A;  3GY9 A;  4ETJ A;  1ZLH A;  3BXM A;  4I49 A;  4DYO A;  4GUA A;  1YW6 A;  4YWY A;  2J8M A;  1P4N A;  1YK3 A;  2WPX A;  1S7F A;  1KUY A;  3FEC A;  2OH1 A;  2Z3K A;  4C7H A;  4KVM E;  4KOT A;  5LRJ A;  1XBU A;  2G3T A;  3PBE A;  3ISX A;  2Q0Y A;  1HEE A;  2V8D A;  3RBU A;  5IB0 A;  2B5G B;  4U5Y A;  4H89 A;  4M6I A;  4XPL A;  2ZEH A;  1QMU A;  1WWZ A;  5J1Q A;  4M3S A;  4MFP A;  1CP6 A;  4OAE A;  5G1Z A;  3S6G A;  3W6S A;  5KTC A;  4KVO E;  1R43 A;  1JQG A;  4JYW A;  1VIX A;  3RNZ A;  4DJL A;  4JJX A;  2GLF A;  3FB3 A;  3V8I A;  1YX0 A;  4H6U A;  1X10 A;  3WC5 A;  1I1D A;  2Q43 A;  2ZOG A;  5FSU A;  1CPS A;  1Z8W A;  2I3C A;  1YD9 A;  1GYT A;  1LOK A;  1Z8X A;  3GIU A;  2PJ9 A;  3UY5 A;  3S6H A;  4TU0 A;  3JUW A;  4MCR A;  4OC4 A;  3IWG A;  2QML A;  3IWE A;  3SJX A;  3TCV A;  3IIF A;  4HNW B;  4Q7A A;  2CY2 A;  4LUA A;  3IU1 A;  4F9V A;  4B13 A;  1S7L A;  3SI0 A;  3MN8 A;  1TKJ A;  4KOR A;  5FVJ A;  3PB9 X;  5THW A;  3EWR A;  1YME A;  3I3G A;  4UML A;  4HPS A;  4KOU A;  4UCM A;  4D86 A;  5J8C A;  4CGL A;  4A30 A;  3D2P A;  3JRU A;  4OC2 A;  4RS2 A;  1I21 A;  5JM6 A;  3GKR A;  4UCN A;  4OIW A;  1YGH A;  2ZEO A;  4B10 A;  1XE4 A;  1Q7L A;  4R6T A;  5HVH A;  4A33 A;  2FL4 A;  1BPN A;  2R98 A;  3FIX A;  4R9M A;  5HMN A;  1VHO A;  4ZI6 A;  3PZJ A;  3IFE A;  4UWJ A;  2VEZ A;  4UEE A;  2HV2 A;  3KQZ A;  5FSZ A;  2FIW A;  2GLJ A;  2PJB A;  3I9S A;  3KL9 A;  4KOX A;  1ARL A;  2GIV A;  4LQ6 A;  1UFH A;  1TF9 A;  5CB5 A;  4HNX B;  3WR7 A;  4QB9 A;  4KZT A;  3GPO A;  4ZYQ A;  4UIB A;  3NH8 A;  2K5T A;  4IQY A;  4K0C A;  1JWQ A;  2P0W A;  4NJQ A;  4ZX9 A;  4XPD C;  2FS5 A;  1XEB A;  1LFW A;  3BJ7 A;  2OR4 A;  3KKW A;  4FAI A;  1Y0R A;  2C1C A;  3SJF A;  2PJ7 A;  4UIA A;  4YFJ A;  3DR6 A;  3LMS A;  4CS0 B;  5IV0 A;  3DR8 A;  1YQE A;  2ZEE A;  4AG9 A;  5F09 A;  2PIY A;  3SI2 A;  2EO8 A;  1ELL P;  2PJ4 A;  2CXA A;  3D2M A;  2C27 A;  2VRI A;  2FT0 A;  3GB0 A;  2JDD A;  4NGN A;  3B2Y A;  4R8F A;  5ELY A;  3IIB A;  4OC3 A;  2W2G A;  4OKO A;  2PJ5 A;  2PVV A;  3EXN A;  4HNY B;  1MJ9 A;  2Z10 A;  5A27 A;  2Q7B A;  4EFD A;  1X12 A;  1B6B A;  3EJF A;  3B35 A;  2CF4 A;  2VZY A;  1Y9K A;  3B3V A;  4UEF A;  1A2Z A;  3T90 A;  1NSL A;  1QQ9 A;  4CAV A;  1MJA A;  4FWU A;  4MY3 A;  4J5Q A;  1IY7 A;  3EFA A;  2AE6 A;  2IJZ A;  5K8O A;  2AFX A;  4WWV A;  3BJ8 A;  2I00 A;  5LYD A;  5JQ4 A;  3D68 A;  1YVO A;  1YVK A;  1ZLI A;  3D7G A;  2YNC C;  3DSB A;  4FD6 A;  4KUA A;  5G20 A;  3S6K A;  5J8F A;  5LYI A;  1UWY A;  2Q04 A;  4PXB A;  2ZPA A;  3KI9 A;  4P6Y A;  4GS4 A;  4Y49 C;  4R3L A;  5HXD A;  3DDD A;  3FVL A;  4MRI A;  6CPA A;  2AFZ A;  4UCP A;  2Q51 A;  4B5O A;  1LAM A;  2BFQ A;  4R7M A;  2H5M A;  3R96 A;  4AB7 A;  1TXR A;  4IUS A;  1M44 A;  4B14 A;  5G21 A;  4OID A;  1IGB A;  2CTB A;  3GQE A;  5G22 A;  1CP7 A;  4ZX8 A;  2Q4Y A;  4JZ0 A;  3WT4 A;  4UFW A;  4BIN A;  4H6Z A;  3CPX A;  4P4I A;  3D66 A;  4Q38 A; 
#chains in the Genus database with same CATH homology
 3H8F A;  3PEI A;  1ZG7 A;  2J9A A;  4IAV A;  3PB7 X;  1CPX A;  2O4H A;  4P4E A;  4A38 A;  3D7D A;  5FSY A;  3VH9 A;  4GVW A;  3SJE A;  4G1P A;  4PXC A;  3KR5 A;  4JGK A;  1F57 A;  3KHX A;  4J4Z A;  3VFQ A;  3NH4 A;  4OC0 A;  3FEE A;  5E3B A;  4KSI A;  2ZEM A;  3GUX A;  2XD7 A;  4F8Z A;  2LGR A;  3D7H A;  4NGQ A;  3QNV A;  3B3T A;  3N5F A;  1XMB A;  1Z2L A;  2POK A;  3BI0 A;  3SI1 A;  3K9T A;  4A39 A;  1ELM P;  5K8M A;  4A94 A;  3PB4 X;  2ABZ A;  1TXZ A;  2ZEN A;  3EW5 A;  4K3N A;  1HDU A;  2ANP A;  1AYE A;  1TKF A;  2ZEG A;  3IWW A;  1Y7E A;  2F7V A;  2WYR A;  1ZG8 A;  4EWT A;  3S9L A;  1NJR A;  3D7F A;  3BHX A;  1ZG9 A;  5JGF A;  2PJ8 A;  3V2B A;  3HLP A;  1TF8 A;  3Q6Z A;  3SIH A;  2NYQ A;  3EKE A;  3SII A;  4ESS A;  1XJO A;  3PFE A;  3KR4 A;  1YLO A;  4MHY A;  2DX6 A;  1TY8 A;  5HVF A;  1XRY A;  1SPV A;  2O53 A;  4NGM A;  5JM6 A;  1HJZ A;  1OBR A;  3NA6 A;  4UEZ A;  5FSV A;  4P45 A;  2PJA A;  4P10 A;  2BFR A;  3EJG A;  4WJB A;  3D67 A;  1VHU A;  3S9N A;  2GU2 A;  3KGQ A;  3L2N A;  4TWE A;  2AFU A;  2JBJ A;  1BAV A;  4IHM A;  2EK8 A;  4OME A;  4BD9 A;  2AFC A;  1Z8L A;  2V8G A;  2XEJ A;  2VL1 A;  3B7I A;  2XEF A;  2PIZ A;  4RUH A;  4OC1 A;  2EK9 A;  1BLL E;  4MXU A;  4X2T A;  3HUV A;  2X47 A;  2L8R A;  1KWM A;  4MCP A;  3DGV A;  1CBX A;  4PXD A;  3Q71 A;  2DEA A;  3IJ3 A;  3IID A;  3KAS A;  1HDQ A;  4MHN A;  2BOA A;  3T8W A;  2CTC A;  1DE4 C;  2PE3 A;  4GM5 A;  2JBK A;  4KYB A;  4W9Y A;  4O23 A;  4P4J A;  3GPQ A;  2PRQ A;  4DUK A;  4ZY0 A;  2V77 A;  4NGP A;  1M4L A;  2PVW A;  3K2K A;  3WC7 A;  2IMO A;  4PXE A;  4NJR A;  1F2O A;  3WAB A;  4F9U A;  4P4B A;  4GVV A;  2CIJ A;  2ZOF A;  4NGT A;  3H8E A;  1ZR5 A;  3IC1 A;  4MCS A;  5LRG A;  5FSX A;  2FVG A;  2FG1 A;  1DTD A;  4ONW A;  3SIG A;  2WZN A;  1Z5R A;  4H2K A;  1LAN A;  2QVP A;  5D8N A;  1EE3 P;  4MCQ A;  4ETK A;  5K8N A;  3MRU A;  4UF4 A;  4PPZ A;  1PYT B;  2HB6 A;  4MMO A;  2ZEP A;  4J5R A;  1TKH A;  2RFH A;  4AXV A;  2QYV A;  1FNO A;  4J5S A;  1VHE A;  1LAP A;  3FMC A;  4IK2 A;  3RZA A;  5LRK A;  1ZR3 A;  2G9D A;  5I4M A;  1H8L A;  4JCA A;  2PJ2 A;  3FX6 A;  2NSM A;  3FF3 A;  1LCP A;  5CMS A;  1YSJ A;  3FH4 A;  3IO1 A;  4B6Z A;  3PBB A;  2PCU A;  4MHP A;  1FT7 A;  2EEE A;  2BO9 A;  3PFO A;  4P4F A;  2V8H A;  4OC5 A;  3H8G A;  4FUU A;  3B3W A;  1R3N A;  3PB8 X;  4X3R A;  1PCA A;  3EWQ A;  4CPA A;  3EWO A;  4ZY2 A;  3VAR A;  1NSA A;  2QJ8 A;  2XEG A;  3LWU A;  3NFZ A;  4NFR A;  2V8V A;  3EWP A;  2PJ1 A;  3V7Z A;  5DS0 A;  3NH5 A;  3BI1 A;  2F8H A;  3FED A;  4P4D A;  2RB7 A;  4YU9 A;  2C6G A;  5CBM A;  5LYF A;  1YW4 A;  4PQA A;  2OOT A;  4R76 A;  3D4U A;  3TX8 A;  3PRT A;  1F2P A;  1Y0Y A;  2JEW A;  4ABK A;  2HC9 A;  1VGY A;  2AFW A;  1CX8 A;  2GRE A;  3IEH A;  2AFO A;  3KQX A;  2IQ6 A;  1RTQ A;  2AFS A;  3TC8 A;  5HVG A;  3ETI A;  2AFM A;  3VAT A;  3GPG A;  1ARM A;  3V45 A;  3CDX A;  4OP4 A;  2C6C A;  4P44 A;  7CPA A;  1XFO A;  3B3C A;  2Q4Z A;  4NGS A;  3GQO A;  3ISZ A;  4MHZ A;  5DUS A;  5HIH A;  3CT9 A;  2ZEL A;  2ZED A;  2PJ3 A;  3JZT A;  5IB9 A;  3S9M A;  5D29 A;  2XEI A;  5AIL A;  5HOL A;  2ACF A;  4NGR A;  3KZW A;  3PB6 X;  3GLJ A;  2FAV A;  3KHZ A;  5CPA A;  4ABL A;  1AMP A;  3DLJ A;  4EME A;  4LQG A;  2PJC A;  2PJ6 A;  4ZY1 A;  2FXK A;  3RAM A;  5K8P A;  3CPA A;  3SIJ A;  2EWB A;  2PJ0 A;  4TNU A;  4FBE A;  5LYL A;  1BPM A;  5CB3 A;  3B3S A;  4A37 A;  8CPA A;  4X8I A;  4JLL A;  3SJG A;  3V38 A;  2C6P A;  1CG2 A;  3WC6 A;  2BCO A;  4JVV A;  5JH9 A;  2ZEF A;  3FJU A;  3I1U A;  4ETJ A;  1ZLH A;  3BXM A;  4DYO A;  4GUA A;  1YW6 A;  4YWY A;  3FEC A;  5LRJ A;  1XBU A;  3PBE A;  3ISX A;  1HEE A;  2V8D A;  3RBU A;  2ZEH A;  1QMU A;  5J1Q A;  1CP6 A;  1R43 A;  1JQG A;  4JYW A;  1VIX A;  4DJL A;  2GLF A;  3WC5 A;  2Q43 A;  2ZOG A;  5FSU A;  1CPS A;  2I3C A;  1YD9 A;  1GYT A;  1LOK A;  2PJ9 A;  4TU0 A;  4MCR A;  4OC4 A;  3SJX A;  3IIF A;  4Q7A A;  4F9V A;  3SI0 A;  3MN8 A;  1TKJ A;  5THW A;  3PB9 X;  3EWR A;  1YME A;  4UML A;  4D86 A;  3JRU A;  4OC2 A;  4OIW A;  2ZEO A;  1Q7L A;  4R6T A;  5HVH A;  1BPN A;  1VHO A;  4ZI6 A;  3IFE A;  4UEE A;  3KQZ A;  5FSZ A;  2GLJ A;  2PJB A;  3KL9 A;  1ARL A;  1TF9 A;  5CB5 A;  3GPO A;  4ZYQ A;  4UIB A;  3NH8 A;  4IQY A;  4K0C A;  4NJQ A;  4ZX9 A;  1LFW A;  2OR4 A;  4FAI A;  1Y0R A;  2C1C A;  3SJF A;  2PJ7 A;  4UIA A;  3LMS A;  2ZEE A;  5F09 A;  2PIY A;  3SI2 A;  1ELL P;  2PJ4 A;  2VRI A;  3GB0 A;  4R8F A;  5ELY A;  4NGN A;  3B2Y A;  3IIB A;  4OC3 A;  4OKO A;  2PJ5 A;  2PVV A;  4EFD A;  3EJF A;  3B35 A;  2CF4 A;  3B3V A;  4UEF A;  1QQ9 A;  4FWU A;  4J5Q A;  1IY7 A;  2IJZ A;  5K8O A;  2AFX A;  4WWV A;  5LYD A;  3D68 A;  1ZLI A;  3D7G A;  5LYI A;  1UWY A;  4PXB A;  3KI9 A;  4P6Y A;  5HXD A;  3FVL A;  4MRI A;  6CPA A;  2AFZ A;  2Q51 A;  1LAM A;  2BFQ A;  4R7M A;  1TXR A;  4OID A;  1IGB A;  2CTB A;  3GQE A;  1CP7 A;  4ZX8 A;  4JZ0 A;  3WT4 A;  3CPX A;  4P4I A;  3D66 A;  4Z65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...