4ZX8A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 9b
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 174
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx8A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx8A02
1ZG7A 2G9DA 3SJFA 3NH4A 3SIIA 2ZELA 4IK2A 3T8WA 4X2TA 2PJCA 4NGSA 5HOLA 2PIZA 2JBKA 4RUHA 1TXRA 1ELLP 3IIFA 1YD9A 1NSAA 1XJOA 4J5RA 2HC9A 3IO1A 4ZY1A 3SJEA 5FSYA 2GLFA 2LGRA 3B35A 4P6YA 3FX6A 2Q43A 2NSMA 3KHZA 1LAMA 3KGQA 2PJ8A 3IIDA 3GB0A 3SI1A 2PJ5A 5JM6A 2IJZA 3EW5A 4OC5A 4OP4A 4F9VA 2VL1A 5CBMA 3CDXA 1M4LA 4A38A 1XBUA 1YW6A 4FWUA 1AMPA 4ZY0A 4ZYQA 2BCOA 1TKHA 2AFMA 2AFOA 3VFQA 5K8OA 1CP6A 4AXVA 3SIHA 2F8HA 3ETIA 3DGVA 3FF3A 4NFRA 3PFOA 2AFZA 1YW4A 3GUXA 5F09A 2AFUA 2V8VA 3QNVA 2J9AA 3WC6A 1ZG9A 1BLLE 5LRGA 4ESSA 3I1UA 5LRKA 4EFDA 3K2KA 3D7HA 3SIJA 1BPMA 4A39A 3BI1A 4NJRA 2XEIA 2JBJA 4X8IA 1DE4C 3EWPA 5D29A 1QQ9A 3S9MA 3D7FA 3FMCA 1DTDA 1CP7A 2CF4A 4GVWA 4MCSA 3H8GA 2AFWA 4GVVA 1LFWA 3V7ZA 1QMUA 3IFEA 3PB6X 1RTQA 4GM5A 2FVGA 5CB3A 2EEEA 2F7VA 4A37A 3IIBA 4PQAA 3EWOA 3H8EA 2GREA 1TF9A 2ZEDA 1Z2LA 3B3VA 3NH8A 3S9NA 2QYVA 2C6CA 1Y7EA 4K0CA 4OC1A 4F8ZA 1F2OA 1Z8LA 4UEFA 2CTCA 1TY8A 2POKA 3FEEA 2PJBA 5K8PA 1VGYA 1VHOA 4ZX8A 2XEFA 3KZWA 2DEAA 3PB7X 4MMOA 4LQGA 4J5QA 1YSJA 4FBEA 4OC0A 3PBBA 3EWRA 3CPAA 4JVVA 3DLJA 3FJUA 2X47A 2OR4A 1Z5RA 3JZTA 1LCPA 1GYTA 4TNUA 1XFOA 4CPAA 1LAPA 1CPSA 5LRJA 3LMSA 4JGKA 2AFXA 1R3NA 5FSVA 2RFHA 4MXUA 2CTBA 1TXZA 3BHXA 3N5FA 4UF4A 3PBEA 5K8NA 3D7DA 4PXDA 3PRTA 2ANPA 4P4FA 4OIWA 2I3CA 2DX6A 2Q4ZA 4P10A 2V8GA 2BO9A 3MN8A 3VARA 3VATA 1ZR5A 2IQ6A 3FECA 4IAVA 4Q7AA 1TKJA 1TKFA 4O23A 4PXBA 1BPNA 1CBXA 2ZOGA 3B3SA 4WJBA 2PJ7A 3GLJA 4YU9A 2QVPA 4FUUA 1ARLA 1IGBA 1KWMA 1OBRA 1HEEA 1IY7A 2PJ3A 5THWA 3TX8A 5AILA 3RAMA 2ACFA 4DUKA 3SJXA 3RZAA 4JLLA 2ZEOA 2XEGA 1XMBA 2QJ8A 4EWTA 4OC4A 2PRQA 2PJ0A 3BXMA 5DS0A 5HVFA 4DJLA 1PYTB 3GQEA 4PPZA 4P4EA 1Q7LA 1FT7A 2OOTA 5LYIA 5LYFA 2PJ9A 2PJ1A 2C6PA 3IJ3A 3JRUA 3BI0A 2IMOA 4R6TA 4UIAA 1NJRA 1JQGA 2Q51A 4PXCA 4MHPA 2EK9A 3NA6A 3RBUA 4J5SA 4NJQA 4NGMA 2VRIA 2NYQA 1ARMA 5JH9A 2XEJA 1VHEA 3KQZA 5K8MA 3GPQA 2O53A 2AFCA 3WT4A 1BAVA 2AFSA 5I4MA 4MCQA 2V8HA 1ZR3A 3D68A 2PIYA 4R8FA 3B2YA 4TU0A 4OMEA 1LOKA 3D4UA 3H8FA 3TC8A 1ELMP 3NFZA 3KR5A 4ABLA 3IEHA 4ABKA 4P4JA 2V8DA 2ZEMA 3Q6ZA 4P4BA 3SI0A 3B3TA 3L2NA 2FXKA 7CPAA 1Y0RA 3KI9A 3MRUA 4OC3A 4ETJA 3CPXA 1CPXA 2ZOFA 4WWVA 3SJGA 2PCUA 5HVGA 4BD9A 4NGRA 3WC5A 3D7GA 4MCRA 3GPGA 2ABZA 2V77A 1HDQA 4K3NA 3FEDA 3EKEA 3KHXA 4MCPA 4H2KA 4JYWA 4MHYA 3GQOA 4UMLA 3PB4X 8CPAA 5CB5A 4ETKA 1UWYA 3K9TA 1F57A 3FVLA 3VH9A 4IHMA 5LYLA 1TF8A 5JGFA 2C1CA 1YLOA 2PE3A 4IQYA 2EK8A 3CT9A 4W9YA 4NGPA 3KASA 2GLJA 4J4ZA 4GUAA 5FSUA 3LWUA 2O4HA 5HXDA 4P4IA 4G1PA 3PFEA 5CMSA 3KR4A 2BOAA 1R43A 2PVWA 5FSXA 3EJFA 2ZEFA 5D8NA 4OC2A 5HIHA 5FSZA 3V2BA 4P45A 3EWQA 2RB7A 3KQXA 1EE3P 1ZG8A 3V45A 4NGNA 4UIBA 1LANA 5HVHA 2ZEEA 1AYEA 4P4DA 4EMEA 1ZLHA 3IWWA 2PVVA 5CPAA 3PEIA 2PJ2A 4A94A 3EJGA 3SIGA 4R7MA 2L8RA 1YMEA 2PJAA 4KYBA 3GPOA 5DUSA 4UEZA 4P44A 3ISXA 3WABA 4YWYA 4TWEA 2XD7A 4ZX9A 1VHUA 3ISZA 3B7IA 1HJZA 2GU2A 4DYOA 1ZLIA 1F2PA 3PB9X 5J1QA 2EWBA 1FNOA 2PJ6A 1Y0YA 4MHZA 3B3CA 4X3RA 2BFQA 3Q71A 3D66A 2HB6A 4ZY2A 4OIDA 4F9UA 4ZI6A 1HDUA 1CG2A 2CIJA 3IC1A 4OKOA 4KSIA 5ELYA 3KL9A 2PJ4A 2WZNA 3HUVA 3HLPA 3V38A 2ZEGA 5IB9A 1VIXA 4NGTA 2WYRA 4D86A 4Z65A 4R76A 2ZEHA 4UEEA 3FH4A 1H8LA 3B3WA 2JEWA 4NGQA 3D67A 4JZ0A 4JCAA 3WC7A 2BFRA 5LYDA 2FAVA 2C6GA 1XRYA 1PCAA 3NH5A 3PB8X 1SPVA 4B6ZA 5E3BA 2ZENA 4FAIA 4MRIA 2FG1A 3SI2A 6CPAA 4PXEA 3S9LA 2ZEPA 1CX8A 4ONWA 4MHNA
chains in the Genus database with same CATH superfamily
3BLNA 5KTAA 2VI7A 1ZG7A 2G9DA 3SJFA 3NH4A 3SIIA 2J8NA 2VXKA 3T8WA 2ZELA 4IK2A 4ONUA 3TOBA 4F9VA 4X2TA 2PJCA 4KZTA 5HOLA 2ZW7A 2PIZA 4NGSA 2JBKA 4RUHA 1TXRA 4KOVA 1ELLP 4KVME 1M44A 3IIFA 1YD9A 1NSAA 1XJOA 4J5RA 2HC9A 3IO1A 3TE4A 2R1IA 2ATRA 1Z4EA 4ZY1A 3SJEA 5FSYA 4Q38A 2GLFA 2LGRA 2HV2A 3I3GA 3B35A 3P2FA 2QECA 3S6FA 5I0CA 2Y0MA 4LX9A 4P6YA 4KSFA 3VWEA 3FX6A 2YNEA 2Q43A 2NSMA 4AVBA 2OU2A 3KHZA 2PC1A 1LAMA 3KGQA 2PJ8A 4NCZA 3P2HA 3IIDA 2R7HA 2CXAA 2PJ5A 2X7BA 3GB0A 3MGDA 3R9EA 3SI1A 4CGPA 2AJ6A 4MFPA 2JDCA 4UWIA 2IJZA 3EW5A 2D4OA 2A4NA 3QAHA 4OP4A 2VL1A 5CBMA 1S60A 3D3SA 4OC5A 3UY5A 3OWCA 4CAVA 4LUAA 3CDXA 1M4LA 3IU1A 4A38A 1XBUA 5F49A 1YW6A 4FWUA 5KTDA 3TCVA 4NGMA 1AMPA 4ZY0A 4ZYQA 2BCOA 4CGOA 1TKHA 4CYOA 3QB8A 5G21A 4F0YA 2AFMA 2AFOA 3VFQA 5AG5A 5K8OA 1CP6A 5AGEA 3SIHA 4AXVA 4MBUA 2Q04A 4B5OA 3FNCA 2F8HA 4UCPA 2JEVA 2VZZA 5DWNA 4B12A 4U9ZA 3ETIA 2DPTA 3DGVA 3FF3A 1BO4A 4RS2A 4HPSA 4NFRA 3PFOA 3BJ8A 2AFZA 1YW4A 3GUXA 3SHPA 4ORFA 4CGMA 5F09A 2AFUA 2V8VA 1IB1E 2CNSA 2J9AA 3QNVA 2FIWA 1YREA 5IX3A 1JWQA 1ZG9A 3WC6A 2YNDA 1BLLE 5LRGA 4ESSA 3GYAA 1R57A 3I1UA 2JZDA 1YLEA 3K2KA 4EFDA 5LRKA 3D7HA 3SIJA 2J8MA 1BPMA 4A39A 3BI1A 1MJAA 2WPXA 3RYOA 1VHSA 4NJRA 2XEIA 1M1DA 2JBJA 2R98A 1DE4C 4X8IA 3EWPA 5D29A 1QQ9A 3S9MA 2JZFA 2YNCA 2Z3NA 3D7FA 3FMCA 4KS9A 5G1ZA 1DTDA 1CP7A 3DR8A 4AVAA 2CF4A 1LRZA 4GVWA 2F5IA 4MCSA 3LACA 3H8GA 3IWEA 2AFWA 1YVKA 4GVVA 1LFWA 3V7ZA 1QMUA 3IFEA 3PB6X 1RTQA 4GM5A 1QSMA 1S5KA 2FVGA 5CB3A 4MY0A 2EEEA 2F7VA 4A37A 1Y9KA 4FD7A 1IOFA 3DSBA 4U9YA 3FBUA 4CRYB 3IIBA 4PQAA 4JD6A 3EWOA 3H8EA 4A30A 2GREA 5BWAB 1TF9A 2OH1A 2ZEDA 2FIAA 1Z2LA 2B4DB 3G8WA 1P0HA 2PR1A 4XNHB 3B3VA 3NH8A 4JXQA 3S9NA 5AG6A 2QYVA 2C6CA 1Q2YA 2CY2A 3S6GA 2RNKA 1Y7EA 4PK2A 4K0CA 4KOTA 2FCKA 4OC1A 4F8ZA 1F2OA 3TTHA 1Z8LA 4R3KA 4QVTA 2CTCA 1Q2DA 4PK3A 4UEFA 1TY8A 1XE4A 2POKA 1J4JA 3FEEA 2P6GA 1YQEA 4OADA 3GKRA 1XF8A 2PJBA 4Y49C 2K5TA 5K8PA 1VGYA 1VHOA 3TO9A 2ODFA 4HNYB 2G3AA 4ZX8A 2P6EA 2XEFA 3KZWA 1B87A 4ZBGA 3TOAA 2EVNA 2DEAA 3PB7X 4MMOA 1FY7A 4LQGA 1ON0A 1UFHA 3F0AA 4J5QA 1YSJA 2FE7A 5CNPA 2YGWA 3E0KA 4B5PB 4OC0A 4FBEA 3EFAA 3PBBA 1XOVA 5A28A 3EWRA 3CPAA 4JVVA 1I1DA 3DLJA 4M6GA 3PZJA 3FJUA 2Q7SA 4L8AA 4BBHA 2X47A 4Q36A 5FVJA 2OR4A 4MFLA 1Z5RA 3JZTA 1LCPA 4KOYA 4M6HA 4PV6A 1GYTA 1K4JA 4KVXA 1XFOA 3N7ZA 4TNUA 3W6SA 4CPAA 1LAPA 1CPSA 5LRJA 4E8OA 3LMSA 4JGKA 2AFXA 3CXPA 5A27A 1R3NA 3CXQA 5FSVA 2RFHA 2CNTA 2CTBA 1TXZA 1B6BA 3BHXA 3N5FA 4MXUA 1NSLA 4MFJA 3W91A 4UF4A 2QMLA 4CYQA 3PBEA 5EBVA 5K8NA 3D7DA 4UA3A 4PXDA 3PRTA 4YGOA 2ANPA 4P4FA 4OIWA 1YGHA 2I3CA 2DX6A 1OZPA 2Q4ZA 2ZW5A 2V8GA 4P10A 2BO9A 4KOXA 3TO6A 4CAFA 5AG4A 3MN8A 2KQVA 3VARA 3VATA 1Z8WA 1RXTA 2FL4A 1ZR5A 4CRZB 4XPDB 4NXYA 2IQ6A 2O28A 3K9UA 3FECA 2Z3OA 1KZFA 2WSAA 1MJ9A 1KUVA 1TKJA 4IAVA 1TKFA 4O23A 1M4GA 4PXBA 1BPNA 1CBXA 4FD6A 3LODA 2ZOGA 2R8VA 4A95A 2DF5A 3H4QA 2P0WA 4C7IA 5IV0A 3PGPA 2GE3A 3B3SA 4WJBA 2PJ7A 4IUSA 3R95A 1IU8A 3GLJA 4YU9A 2QVPA 4FUUA 4KLWA 1ARLA 4H6ZA 4PSWA 5EMIA 1RO5A 4RN7A 4XPLA 4MFKA 1IGBA 3PP9A 1Z8TA 2Q4YA 1KWMA 1OBRA 1HEEA 1IY7A 2PJ3A 5THWA 3TX8A 5AILA 3RAMA 2ACFA 2ARHA 3JUWA 4XPKA 4DUKA 2PQ8A 3DR6A 4DNCA 3R1KA 5HMNA 1Y7RA 3CXSA 4F0XA 1M4DA 2VEZA 3RZAA 1S7FA 3SJXA 4EVYA 4JLLA 4UBRA 2ZEOA 3JVNA 2XEGA 3T9YA 2I00A 2REFA 5JM6A 4LQ6A 1XMBA 2QJ8A 1YR0A 4OC4A 2PRQA 4EWTA 2PJ0A 2B5GB 3BXMA 5DS0A 5HVFA 3R96A 4DJLA 4B13A 2NMTA 1PYTB 3GQEA 3NE7A 4PPZA 4P4EA 1Q7LA 4MFQA 4B11A 2DXQA 4YFJA 1FT7A 2OOTA 2H5MA 5LYIA 5LYFA 2PJ9A 2PJ1A 2C6PA 1GHEA 3IJ3A 3JRUA 3BI0A 4HKFA 2IMOA 3FRMA 4GXHA 1S3ZA 4R6TA 4MJ8A 4UIAA 1NJRA 2Z3MA 1JQGA 2OB0A 4QUSA 2Q51A 4PXCA 4MHPA 2EK9A 1S7NA 1L0CA 3NA6A 2J8RA 3RBUA 4J5SA 3A9LA 4KORA 4NJQA 2VRIA 2NYQA 2Q4VA 1ARMA 2BSWA 2C27A 5JH9A 2FXFA 2XEJA 1VHEA 3EXNA 1X12A 3KQZA 5G20A 5K8MA 3GPQA 3EO4A 2O53A 2AFCA 3WT4A 4CAEA 1IYLA 4CAXA 5E96A 1BAVA 4ZGYB 2AFSA 5I4MA 2W2GA 5C82A 4E0AA 3D8PA 3EC4A 4MCQA 2VQYA 2V8HA 1ZR3A 4B14A 3D68A 2ZW6A 2PIYA 2Z3LA 1V0CA 4R8FA 4CYNA 3B2YA 4TU0A 1KUYA 4OMEA 4RI1A 4AB7A 2I79A 5H84A 1LOKA 1IIDA 2ZPAA 3D4UA 3H8FA 4J3GA 3TC8A 3VWDA 4CGNA 1ELMP 1QSNA 2BEIA 1BOBA 4OAEA 4R3LA 3S6KA 3NFZA 4KSAA 3KR5A 4A31A 1U6MA 4ABLA 3IEHA 4KUAA 4KVOE 2REEA 3DNSA 4PSXA 2PRBA 4HNXB 4ABKA 4P4JA 4JLYA 2V8DA 2HQYA 1MJBA 4UCMA 2P6FA 2ZEMA 1CM0A 2Q7BA 3Q6ZA 4P4BA 4UFVA 1VKCA 3B3TA 3L2NA 2FXKA 3SI0A 1Y0RA 7CPAA 4GS4A 3KI9A 4CYPA 1YK3A 1MK4A 3MRUA 1YX0A 4ETJA 1P4NA 4OC3A 3CPXA 1CPXA 5F46A 5HH1A 2ZOFA 4WWVA 5F48A 5JPHA 2Z11A 3GIUA 2YNCC 4JXRA 2Z3KA 2B3VA 2Z0ZA 2GIVA 2PCUA 4KOWA 3SJGA 5HVGA 4BD9A 4R87A 4NGRA 3WC5A 1N71A 3D7GA 3GPGA 4MCRA 4Y49B 2ABZA 3SXOA 3JTKA 3IGRA 4C2ZA 2V77A 3T90A 1HDQA 4K3NA 4U5YA 3FEDA 4C7HA 3NE8A 3EKEA 1KUXA 4KOSA 4H6UA 1PU9A 3KHXA 4MCPA 4H2KA 2OZGA 4JYWA 4MHYA 3GQOA 4UMLA 3PB4X 8CPAA 5CB5A 1XIXA 4B10A 5KTCA 4ETKA 2FSRA 1UWYA 3K9TA 1F57A 2B58A 3FVLA 3VH9A 1WWZA 4IHMA 4A2ZA 5LYLA 3R9FA 1TF8A 4CS0B 3ZJ0A 4MFZA 5JGFA 2Z3PA 2C1CA 2WUUA 1YLOA 2PE3A 5IB0A 4IQYA 2EK8A 3CT9A 4JJXA 4W9YA 4NGPA 3I9SA 3KASA 5EC4A 2GLJA 4MI4A 4R9MA 4J4ZA 4GUAA 5FSUA 2Q0YA 4FD4A 5H86A 4E2AA 5ISVA 4X5KA 1QSOA 3LWUA 2O4HA 2PSWA 3F5BA 5HXDA 4P4IA 4M6IA 4B5PA 4QB9A 4G1PA 1TIQA 3PFEA 3TT2A 5CMSA 5C88A 4H89A 2DPSA 3KR4A 2BOAA 4XPDC 3R9GA 4UWJA 1R43A 2PVWA 5FSXA 3EJFA 2ZEFA 4QC6A 4BINA 4CAWA 5D8NA 5JQ4A 4OC2A 5HIHA 5FSZA 1AUGA 1YVOA 4IF5A 4UFXA 2BUEA 4UCNA 3V2BA 4P45A 1XMTA 4MHDA 4F6AA 3EWQA 2RB7A 3KQXA 1EE3P 3LD2A 3IU2A 1ZG8A 5F47A 3V45A 1I12A 2ZXVA 4NGNA 4C68A 2GANA 2G0BA 4OLLA 3TO7A 3FXTA 1M4IA 4UIBA 1LANA 2EO8A 4R57A 2VBQA 5HVHA 2ZEEA 1Z9UA 1AYEA 4KLVA 4P4DA 1WK4A 3RNZA 2Q44A 2VZYA 4EMEA 1ZLHA 3IWWA 2JLMA 4AG7A 2PVVA 2PR8A 1Y9WA 3FB3A 3QAYA 5CPAA 2ZW4A 3PEIA 3EY5A 2PJ2A 4HNWB 4A94A 3EJGA 3SIGA 4R7MA 2L8RA 1YMEA 3TFYA 2PJAA 4KYBA 4K30A 3GPOA 5DUSA 4QBJA 4UEZA 4P44A 3ISXA 1CJWA 3WABA 4UFWA 2B3UA 4YWYA 2FS5A 4TWEA 2XD7A 4ZX9A 4KUBA 1VHUA 1Q2CA 1QSRA 3ISZA 3B7IA 1HJZA 2GU2A 4AVCA 4DYOA 2AE6A 1ZLIA 2B5GA 1Z4RA 1F2PA 2CNMA 4A33A 3PB9X 5J1QA 2EWBA 1FNOA 2PJ6A 1Z8XA 1Y0YA 2QIRA 3DDDA 3B3CA 2FT0A 4MHZA 4X3RA 2BFQA 3Q71A 3D66A 3F8KA 2HB6A 4ZY2A 3H5ZA 4OIDA 4XNHC 4F9UA 5AG7A 4ZI6A 1HDUA 1QSTA 3C26A 4NF1A 1S7LA 4CGLA 1CG2A 2CIJA 2JZEA 3IC1A 3BJ7A 4OKOA 4KSIA 5ELYA 2EBJA 2PJ4A 3KL9A 4MY3A 1X10A 2WZNA 3HUVA 3S6HA 3SXNA 3HLPA 3V38A 4YRHA 2ZEGA 5IB9A 5J8CA 2D4PA 1VIXA 3G3SA 4NGTA 1PUAA 2RC4A 2WYRA 4KOUA 4AG9A 4A32A 4D86A 4Z65A 4R76A 2ZEHA 4NSQA 4L89A 4UEEA 3FH4A 3RO0A 2HUZA 5G22A 1H8LA 3B3WA 4Q7AA 4JWPA 2B4DA 2JEWA 1IYKA 3FIXA 2KCWA 4NGQA 1NMTA 3D67A 3CZXA 4JZ0A 3ZZIA 3B8GA 2OZUA 4JCAA 3WC7A 3KKWA 1ZO0A 2EUIA 5J8FA 2BFRA 2Z10A 5DWMA 3GY9A 5LYDA 2FAVA 2C6GA 1XRYA 1PCAA 2WPWA 3W6XA 4BMHA 3IWGA 2GFQA 1SPVA 3NH5A 3PB8X 2G3TA 4B6ZA 4M85A 5E3BA 4FD5A 4M3SA 1NE9A 2PDOA 2ZENA 1IOIA 3D2PA 3V8IA 4FAIA 2WCTA 1XEBA 1IICA 2JDDA 1I21A 4MRIA 2FG1A 1SQHA 4I49A 3D2MA 3WR7A 3SI2A 6CPAA 2BL1A 4NEXA 4PXEA 5GCNA 4II9A 2B4BA 3S9LA 1A2ZA 2ZEPA 1CX8A 1S7KA 3FYNA 4ONWA 2IL4A 4C2XA 4MHNA 4C2YA 2OZHA
chains in the Genus database with same CATH topology
1ZG7A 2G9DA 3SJFA 3NH4A 3SIIA 2ZELA 4IK2A 3T8WA 4X2TA 2PJCA 4NGSA 5HOLA 2PIZA 2JBKA 4RUHA 1TXRA 1ELLP 3IIFA 1YD9A 1NSAA 1XJOA 4J5RA 2HC9A 3IO1A 4ZY1A 3SJEA 5FSYA 2GLFA 2LGRA 3B35A 4P6YA 3FX6A 2Q43A 2NSMA 3KHZA 1LAMA 3KGQA 2PJ8A 3IIDA 3GB0A 3SI1A 2PJ5A 5JM6A 2IJZA 3EW5A 4OC5A 4OP4A 4F9VA 2VL1A 5CBMA 3CDXA 1M4LA 4A38A 1XBUA 1YW6A 4FWUA 1AMPA 4ZY0A 4ZYQA 2BCOA 1TKHA 2AFMA 2AFOA 3VFQA 5K8OA 1CP6A 4AXVA 3SIHA 2F8HA 3ETIA 3DGVA 3FF3A 4NFRA 3PFOA 2AFZA 1YW4A 3GUXA 5F09A 2AFUA 2V8VA 3QNVA 2J9AA 3WC6A 1ZG9A 1BLLE 5LRGA 4ESSA 3I1UA 5LRKA 4EFDA 3K2KA 3D7HA 3SIJA 1BPMA 4A39A 3BI1A 4NJRA 2XEIA 2JBJA 4X8IA 1DE4C 3EWPA 5D29A 1QQ9A 3S9MA 3D7FA 3FMCA 1DTDA 1CP7A 2CF4A 4GVWA 4MCSA 3H8GA 2AFWA 4GVVA 1LFWA 3V7ZA 1QMUA 3IFEA 3PB6X 1RTQA 4GM5A 2FVGA 5CB3A 2EEEA 2F7VA 4A37A 3IIBA 4PQAA 3EWOA 3H8EA 2GREA 1TF9A 2ZEDA 1Z2LA 3B3VA 3NH8A 3S9NA 2QYVA 2C6CA 1Y7EA 4K0CA 4OC1A 4F8ZA 1F2OA 1Z8LA 4UEFA 2CTCA 1TY8A 2POKA 3FEEA 2PJBA 5K8PA 1VGYA 1VHOA 4ZX8A 2XEFA 3KZWA 2DEAA 3PB7X 4MMOA 4LQGA 4J5QA 1YSJA 4FBEA 4OC0A 3PBBA 3EWRA 3CPAA 4JVVA 3DLJA 3FJUA 2X47A 2OR4A 1Z5RA 3JZTA 1LCPA 1GYTA 4TNUA 1XFOA 4CPAA 1LAPA 1CPSA 5LRJA 3LMSA 4JGKA 2AFXA 1R3NA 5FSVA 2RFHA 4MXUA 2CTBA 1TXZA 3BHXA 3N5FA 4UF4A 3PBEA 5K8NA 3D7DA 4PXDA 3PRTA 2ANPA 4P4FA 4OIWA 2I3CA 2DX6A 2Q4ZA 4P10A 2V8GA 2BO9A 3MN8A 3VARA 3VATA 1ZR5A 2IQ6A 3FECA 4IAVA 4Q7AA 1TKJA 1TKFA 4O23A 4PXBA 1BPNA 1CBXA 2ZOGA 3B3SA 4WJBA 2PJ7A 3GLJA 4YU9A 2QVPA 4FUUA 1ARLA 1IGBA 1KWMA 1OBRA 1HEEA 1IY7A 2PJ3A 5THWA 3TX8A 5AILA 3RAMA 2ACFA 4DUKA 3SJXA 3RZAA 4JLLA 2ZEOA 2XEGA 1XMBA 2QJ8A 4EWTA 4OC4A 2PRQA 2PJ0A 3BXMA 5DS0A 5HVFA 4DJLA 1PYTB 3GQEA 4PPZA 4P4EA 1Q7LA 1FT7A 2OOTA 5LYIA 5LYFA 2PJ9A 2PJ1A 2C6PA 3IJ3A 3JRUA 3BI0A 2IMOA 4R6TA 4UIAA 1NJRA 1JQGA 2Q51A 4PXCA 4MHPA 2EK9A 3NA6A 3RBUA 4J5SA 4NJQA 4NGMA 2VRIA 2NYQA 1ARMA 5JH9A 2XEJA 1VHEA 3KQZA 5K8MA 3GPQA 2O53A 2AFCA 3WT4A 1BAVA 2AFSA 5I4MA 4MCQA 2V8HA 1ZR3A 3D68A 2PIYA 4R8FA 3B2YA 4TU0A 4OMEA 1LOKA 3D4UA 3H8FA 3TC8A 1ELMP 3NFZA 3KR5A 4ABLA 3IEHA 4ABKA 4P4JA 2V8DA 2ZEMA 3Q6ZA 4P4BA 3SI0A 3B3TA 3L2NA 2FXKA 7CPAA 1Y0RA 3KI9A 3MRUA 4OC3A 4ETJA 3CPXA 1CPXA 2ZOFA 4WWVA 3SJGA 2PCUA 5HVGA 4BD9A 4NGRA 3WC5A 3D7GA 4MCRA 3GPGA 2ABZA 2V77A 1HDQA 4K3NA 3FEDA 3EKEA 3KHXA 4MCPA 4H2KA 4JYWA 4MHYA 3GQOA 4UMLA 3PB4X 8CPAA 5CB5A 4ETKA 1UWYA 3K9TA 1F57A 3FVLA 3VH9A 4IHMA 5LYLA 1TF8A 5JGFA 2C1CA 1YLOA 2PE3A 4IQYA 2EK8A 3CT9A 4W9YA 4NGPA 3KASA 2GLJA 4J4ZA 4GUAA 5FSUA 3LWUA 2O4HA 5HXDA 4P4IA 4G1PA 3PFEA 5CMSA 3KR4A 2BOAA 1R43A 2PVWA 5FSXA 3EJFA 2ZEFA 5D8NA 4OC2A 5HIHA 5FSZA 3V2BA 4P45A 3EWQA 2RB7A 3KQXA 1EE3P 1ZG8A 3V45A 4NGNA 4UIBA 1LANA 5HVHA 2ZEEA 1AYEA 4P4DA 4EMEA 1ZLHA 3IWWA 2PVVA 5CPAA 3PEIA 2PJ2A 4A94A 3EJGA 3SIGA 4R7MA 2L8RA 1YMEA 2PJAA 4KYBA 3GPOA 5DUSA 4UEZA 4P44A 3ISXA 3WABA 4YWYA 4TWEA 2XD7A 4ZX9A 1VHUA 3ISZA 3B7IA 1HJZA 2GU2A 4DYOA 1ZLIA 1F2PA 3PB9X 5J1QA 2EWBA 1FNOA 2PJ6A 1Y0YA 4MHZA 3B3CA 4X3RA 2BFQA 3Q71A 3D66A 2HB6A 4ZY2A 4OIDA 4F9UA 4ZI6A 1HDUA 1CG2A 2CIJA 3IC1A 4OKOA 4KSIA 5ELYA 3KL9A 2PJ4A 2WZNA 3HUVA 3HLPA 3V38A 2ZEGA 5IB9A 1VIXA 4NGTA 2WYRA 4D86A 4Z65A 4R76A 2ZEHA 4UEEA 3FH4A 1H8LA 3B3WA 2JEWA 4NGQA 3D67A 4JZ0A 4JCAA 3WC7A 2BFRA 5LYDA 2FAVA 2C6GA 1XRYA 1PCAA 3NH5A 3PB8X 1SPVA 4B6ZA 5E3BA 2ZENA 4FAIA 4MRIA 2FG1A 3SI2A 6CPAA 4PXEA 3S9LA 2ZEPA 1CX8A 4ONWA 4MHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG7 A;  2G9D A;  3SJF A;  3NH4 A;  3SII A;  2ZEL A;  4IK2 A;  3T8W A;  4X2T A;  2PJC A;  4NGS A;  5HOL A;  2PIZ A;  2JBK A;  4RUH A;  1TXR A;  1ELL P;  3IIF A;  1YD9 A;  1NSA A;  1XJO A;  4J5R A;  2HC9 A;  3IO1 A;  4ZY1 A;  3SJE A;  5FSY A;  2GLF A;  2LGR A;  3B35 A;  4P6Y A;  3FX6 A;  2Q43 A;  2NSM A;  3KHZ A;  1LAM A;  3KGQ A;  2PJ8 A;  3IID A;  3GB0 A;  3SI1 A;  2PJ5 A;  5JM6 A;  2IJZ A;  3EW5 A;  4OC5 A;  4OP4 A;  4F9V A;  2VL1 A;  5CBM A;  3CDX A;  1M4L A;  4A38 A;  1XBU A;  1YW6 A;  4FWU A;  1AMP A;  4ZY0 A;  4ZYQ A;  2BCO A;  1TKH A;  2AFM A;  2AFO A;  3VFQ A;  5K8O A;  1CP6 A;  4AXV A;  3SIH A;  2F8H A;  3ETI A;  3DGV A;  3FF3 A;  4NFR A;  3PFO A;  2AFZ A;  1YW4 A;  3GUX A;  5F09 A;  2AFU A;  2V8V A;  3QNV A;  2J9A A;  3WC6 A;  1ZG9 A;  1BLL E;  5LRG A;  4ESS A;  3I1U A;  5LRK A;  4EFD A;  3K2K A;  3D7H A;  3SIJ A;  1BPM A;  4A39 A;  3BI1 A;  4NJR A;  2XEI A;  2JBJ A;  4X8I A;  1DE4 C;  3EWP A;  5D29 A;  1QQ9 A;  3S9M A;  3D7F A;  3FMC A;  1DTD A;  1CP7 A;  2CF4 A;  4GVW A;  4MCS A;  3H8G A;  2AFW A;  4GVV A;  1LFW A;  3V7Z A;  1QMU A;  3IFE A;  3PB6 X;  1RTQ A;  4GM5 A;  2FVG A;  5CB3 A;  2EEE A;  2F7V A;  4A37 A;  3IIB A;  4PQA A;  3EWO A;  3H8E A;  2GRE A;  1TF9 A;  2ZED A;  1Z2L A;  3B3V A;  3NH8 A;  3S9N A;  2QYV A;  2C6C A;  1Y7E A;  4K0C A;  4OC1 A;  4F8Z A;  1F2O A;  1Z8L A;  4UEF A;  2CTC A;  1TY8 A;  2POK A;  3FEE A;  2PJB A;  5K8P A;  1VGY A;  1VHO A;  4ZX8 A;  2XEF A;  3KZW A;  2DEA A;  3PB7 X;  4MMO A;  4LQG A;  4J5Q A;  1YSJ A;  4FBE A;  4OC0 A;  3PBB A;  3EWR A;  3CPA A;  4JVV A;  3DLJ A;  3FJU A;  2X47 A;  2OR4 A;  1Z5R A;  3JZT A;  1LCP A;  1GYT A;  4TNU A;  1XFO A;  4CPA A;  1LAP A;  1CPS A;  5LRJ A;  3LMS A;  4JGK A;  2AFX A;  1R3N A;  5FSV A;  2RFH A;  4MXU A;  2CTB A;  1TXZ A;  3BHX A;  3N5F A;  4UF4 A;  3PBE A;  5K8N A;  3D7D A;  4PXD A;  3PRT A;  2ANP A;  4P4F A;  4OIW A;  2I3C A;  2DX6 A;  2Q4Z A;  4P10 A;  2V8G A;  2BO9 A;  3MN8 A;  3VAR A;  3VAT A;  1ZR5 A;  2IQ6 A;  3FEC A;  4IAV A;  4Q7A A;  1TKJ A;  1TKF A;  4O23 A;  4PXB A;  1BPN A;  1CBX A;  2ZOG A;  3B3S A;  4WJB A;  2PJ7 A;  3GLJ A;  4YU9 A;  2QVP A;  4FUU A;  1ARL A;  1IGB A;  1KWM A;  1OBR A;  1HEE A;  1IY7 A;  2PJ3 A;  5THW A;  3TX8 A;  5AIL A;  3RAM A;  2ACF A;  4DUK A;  3SJX A;  3RZA A;  4JLL A;  2ZEO A;  2XEG A;  1XMB A;  2QJ8 A;  4EWT A;  4OC4 A;  2PRQ A;  2PJ0 A;  3BXM A;  5DS0 A;  5HVF A;  4DJL A;  1PYT B;  3GQE A;  4PPZ A;  4P4E A;  1Q7L A;  1FT7 A;  2OOT A;  5LYI A;  5LYF A;  2PJ9 A;  2PJ1 A;  2C6P A;  3IJ3 A;  3JRU A;  3BI0 A;  2IMO A;  4R6T A;  4UIA A;  1NJR A;  1JQG A;  2Q51 A;  4PXC A;  4MHP A;  2EK9 A;  3NA6 A;  3RBU A;  4J5S A;  4NJQ A;  4NGM A;  2VRI A;  2NYQ A;  1ARM A;  5JH9 A;  2XEJ A;  1VHE A;  3KQZ A;  5K8M A;  3GPQ A;  2O53 A;  2AFC A;  3WT4 A;  1BAV A;  2AFS A;  5I4M A;  4MCQ A;  2V8H A;  1ZR3 A;  3D68 A;  2PIY A;  4R8F A;  3B2Y A;  4TU0 A;  4OME A;  1LOK A;  3D4U A;  3H8F A;  3TC8 A;  1ELM P;  3NFZ A;  3KR5 A;  4ABL A;  3IEH A;  4ABK A;  4P4J A;  2V8D A;  2ZEM A;  3Q6Z A;  4P4B A;  3SI0 A;  3B3T A;  3L2N A;  2FXK A;  7CPA A;  1Y0R A;  3KI9 A;  3MRU A;  4OC3 A;  4ETJ A;  3CPX A;  1CPX A;  2ZOF A;  4WWV A;  3SJG A;  2PCU A;  5HVG A;  4BD9 A;  4NGR A;  3WC5 A;  3D7G A;  4MCR A;  3GPG A;  2ABZ A;  2V77 A;  1HDQ A;  4K3N A;  3FED A;  3EKE A;  3KHX A;  4MCP A;  4H2K A;  4JYW A;  4MHY A;  3GQO A;  4UML A;  3PB4 X;  8CPA A;  5CB5 A;  4ETK A;  1UWY A;  3K9T A;  1F57 A;  3FVL A;  3VH9 A;  4IHM A;  5LYL A;  1TF8 A;  5JGF A;  2C1C A;  1YLO A;  2PE3 A;  4IQY A;  2EK8 A;  3CT9 A;  4W9Y A;  4NGP A;  3KAS A;  2GLJ A;  4J4Z A;  4GUA A;  5FSU A;  3LWU A;  2O4H A;  5HXD A;  4P4I A;  4G1P A;  3PFE A;  5CMS A;  3KR4 A;  2BOA A;  1R43 A;  2PVW A;  5FSX A;  3EJF A;  2ZEF A;  5D8N A;  4OC2 A;  5HIH A;  5FSZ A;  3V2B A;  4P45 A;  3EWQ A;  2RB7 A;  3KQX A;  1EE3 P;  1ZG8 A;  3V45 A;  4NGN A;  4UIB A;  1LAN A;  5HVH A;  2ZEE A;  1AYE A;  4P4D A;  4EME A;  1ZLH A;  3IWW A;  2PVV A;  5CPA A;  3PEI A;  2PJ2 A;  4A94 A;  3EJG A;  3SIG A;  4R7M A;  2L8R A;  1YME A;  2PJA A;  4KYB A;  3GPO A;  5DUS A;  4UEZ A;  4P44 A;  3ISX A;  3WAB A;  4YWY A;  4TWE A;  2XD7 A;  4ZX9 A;  1VHU A;  3ISZ A;  3B7I A;  1HJZ A;  2GU2 A;  4DYO A;  1ZLI A;  1F2P A;  3PB9 X;  5J1Q A;  2EWB A;  1FNO A;  2PJ6 A;  1Y0Y A;  4MHZ A;  3B3C A;  4X3R A;  2BFQ A;  3Q71 A;  3D66 A;  2HB6 A;  4ZY2 A;  4OID A;  4F9U A;  4ZI6 A;  1HDU A;  1CG2 A;  2CIJ A;  3IC1 A;  4OKO A;  4KSI A;  5ELY A;  3KL9 A;  2PJ4 A;  2WZN A;  3HUV A;  3HLP A;  3V38 A;  2ZEG A;  5IB9 A;  1VIX A;  4NGT A;  2WYR A;  4D86 A;  4Z65 A;  4R76 A;  2ZEH A;  4UEE A;  3FH4 A;  1H8L A;  3B3W A;  2JEW A;  4NGQ A;  3D67 A;  4JZ0 A;  4JCA A;  3WC7 A;  2BFR A;  5LYD A;  2FAV A;  2C6G A;  1XRY A;  1PCA A;  3NH5 A;  3PB8 X;  1SPV A;  4B6Z A;  5E3B A;  2ZEN A;  4FAI A;  4MRI A;  2FG1 A;  3SI2 A;  6CPA A;  4PXE A;  3S9L A;  2ZEP A;  1CX8 A;  4ONW A;  4MHN A; 
#chains in the Genus database with same CATH topology
 3BLN A;  5KTA A;  2VI7 A;  1ZG7 A;  2G9D A;  3SJF A;  3NH4 A;  3SII A;  2J8N A;  2VXK A;  3T8W A;  2ZEL A;  4IK2 A;  4ONU A;  3TOB A;  4F9V A;  4X2T A;  2PJC A;  4KZT A;  5HOL A;  2ZW7 A;  2PIZ A;  4NGS A;  2JBK A;  4RUH A;  1TXR A;  4KOV A;  1ELL P;  4KVM E;  1M44 A;  3IIF A;  1YD9 A;  1NSA A;  1XJO A;  4J5R A;  2HC9 A;  3IO1 A;  3TE4 A;  2R1I A;  2ATR A;  1Z4E A;  4ZY1 A;  3SJE A;  5FSY A;  4Q38 A;  2GLF A;  2LGR A;  2HV2 A;  3I3G A;  3B35 A;  3P2F A;  2QEC A;  3S6F A;  5I0C A;  2Y0M A;  4LX9 A;  4P6Y A;  4KSF A;  3VWE A;  3FX6 A;  2YNE A;  2Q43 A;  2NSM A;  4AVB A;  2OU2 A;  3KHZ A;  2PC1 A;  1LAM A;  3KGQ A;  2PJ8 A;  4NCZ A;  3P2H A;  3IID A;  2R7H A;  2CXA A;  2PJ5 A;  2X7B A;  3GB0 A;  3MGD A;  3R9E A;  3SI1 A;  4CGP A;  2AJ6 A;  4MFP A;  2JDC A;  4UWI A;  2IJZ A;  3EW5 A;  2D4O A;  2A4N A;  3QAH A;  4OP4 A;  2VL1 A;  5CBM A;  1S60 A;  3D3S A;  4OC5 A;  3UY5 A;  3OWC A;  4CAV A;  4LUA A;  3CDX A;  1M4L A;  3IU1 A;  4A38 A;  1XBU A;  5F49 A;  1YW6 A;  4FWU A;  5KTD A;  3TCV A;  4NGM A;  1AMP A;  4ZY0 A;  4ZYQ A;  2BCO A;  4CGO A;  1TKH A;  4CYO A;  3QB8 A;  5G21 A;  4F0Y A;  2AFM A;  2AFO A;  3VFQ A;  5AG5 A;  5K8O A;  1CP6 A;  5AGE A;  3SIH A;  4AXV A;  4MBU A;  2Q04 A;  4B5O A;  3FNC A;  2F8H A;  4UCP A;  2JEV A;  2VZZ A;  5DWN A;  4B12 A;  4U9Z A;  3ETI A;  2DPT A;  3DGV A;  3FF3 A;  1BO4 A;  4RS2 A;  4HPS A;  4NFR A;  3PFO A;  3BJ8 A;  2AFZ A;  1YW4 A;  3GUX A;  3SHP A;  4ORF A;  4CGM A;  5F09 A;  2AFU A;  2V8V A;  1IB1 E;  2CNS A;  2J9A A;  3QNV A;  2FIW A;  1YRE A;  5IX3 A;  1JWQ A;  1ZG9 A;  3WC6 A;  2YND A;  1BLL E;  5LRG A;  4ESS A;  3GYA A;  1R57 A;  3I1U A;  2JZD A;  1YLE A;  3K2K A;  4EFD A;  5LRK A;  3D7H A;  3SIJ A;  2J8M A;  1BPM A;  4A39 A;  3BI1 A;  1MJA A;  2WPX A;  3RYO A;  1VHS A;  4NJR A;  2XEI A;  1M1D A;  2JBJ A;  2R98 A;  1DE4 C;  4X8I A;  3EWP A;  5D29 A;  1QQ9 A;  3S9M A;  2JZF A;  2YNC A;  2Z3N A;  3D7F A;  3FMC A;  4KS9 A;  5G1Z A;  1DTD A;  1CP7 A;  3DR8 A;  4AVA A;  2CF4 A;  1LRZ A;  4GVW A;  2F5I A;  4MCS A;  3LAC A;  3H8G A;  3IWE A;  2AFW A;  1YVK A;  4GVV A;  1LFW A;  3V7Z A;  1QMU A;  3IFE A;  3PB6 X;  1RTQ A;  4GM5 A;  1QSM A;  1S5K A;  2FVG A;  5CB3 A;  4MY0 A;  2EEE A;  2F7V A;  4A37 A;  1Y9K A;  4FD7 A;  1IOF A;  3DSB A;  4U9Y A;  3FBU A;  4CRY B;  3IIB A;  4PQA A;  4JD6 A;  3EWO A;  3H8E A;  4A30 A;  2GRE A;  5BWA B;  1TF9 A;  2OH1 A;  2ZED A;  2FIA A;  1Z2L A;  2B4D B;  3G8W A;  1P0H A;  2PR1 A;  4XNH B;  3B3V A;  3NH8 A;  4JXQ A;  3S9N A;  5AG6 A;  2QYV A;  2C6C A;  1Q2Y A;  2CY2 A;  3S6G A;  2RNK A;  1Y7E A;  4PK2 A;  4K0C A;  4KOT A;  2FCK A;  4OC1 A;  4F8Z A;  1F2O A;  3TTH A;  1Z8L A;  4R3K A;  4QVT A;  2CTC A;  1Q2D A;  4PK3 A;  4UEF A;  1TY8 A;  1XE4 A;  2POK A;  1J4J A;  3FEE A;  2P6G A;  1YQE A;  4OAD A;  3GKR A;  1XF8 A;  2PJB A;  4Y49 C;  2K5T A;  5K8P A;  1VGY A;  1VHO A;  3TO9 A;  2ODF A;  4HNY B;  2G3A A;  4ZX8 A;  2P6E A;  2XEF A;  3KZW A;  1B87 A;  4ZBG A;  3TOA A;  2EVN A;  2DEA A;  3PB7 X;  4MMO A;  1FY7 A;  4LQG A;  1ON0 A;  1UFH A;  3F0A A;  4J5Q A;  1YSJ A;  2FE7 A;  5CNP A;  2YGW A;  3E0K A;  4B5P B;  4OC0 A;  4FBE A;  3EFA A;  3PBB A;  1XOV A;  5A28 A;  3EWR A;  3CPA A;  4JVV A;  1I1D A;  3DLJ A;  4M6G A;  3PZJ A;  3FJU A;  2Q7S A;  4L8A A;  4BBH A;  2X47 A;  4Q36 A;  5FVJ A;  2OR4 A;  4MFL A;  1Z5R A;  3JZT A;  1LCP A;  4KOY A;  4M6H A;  4PV6 A;  1GYT A;  1K4J A;  4KVX A;  1XFO A;  3N7Z A;  4TNU A;  3W6S A;  4CPA A;  1LAP A;  1CPS A;  5LRJ A;  4E8O A;  3LMS A;  4JGK A;  2AFX A;  3CXP A;  5A27 A;  1R3N A;  3CXQ A;  5FSV A;  2RFH A;  2CNT A;  2CTB A;  1TXZ A;  1B6B A;  3BHX A;  3N5F A;  4MXU A;  1NSL A;  4MFJ A;  3W91 A;  4UF4 A;  2QML A;  4CYQ A;  3PBE A;  5EBV A;  5K8N A;  3D7D A;  4UA3 A;  4PXD A;  3PRT A;  4YGO A;  2ANP A;  4P4F A;  4OIW A;  1YGH A;  2I3C A;  2DX6 A;  1OZP A;  2Q4Z A;  2ZW5 A;  2V8G A;  4P10 A;  2BO9 A;  4KOX A;  3TO6 A;  4CAF A;  5AG4 A;  3MN8 A;  2KQV A;  3VAR A;  3VAT A;  1Z8W A;  1RXT A;  2FL4 A;  1ZR5 A;  4CRZ B;  4XPD B;  4NXY A;  2IQ6 A;  2O28 A;  3K9U A;  3FEC A;  2Z3O A;  1KZF A;  2WSA A;  1MJ9 A;  1KUV A;  1TKJ A;  4IAV A;  1TKF A;  4O23 A;  1M4G A;  4PXB A;  1BPN A;  1CBX A;  4FD6 A;  3LOD A;  2ZOG A;  2R8V A;  4A95 A;  2DF5 A;  3H4Q A;  2P0W A;  4C7I A;  5IV0 A;  3PGP A;  2GE3 A;  3B3S A;  4WJB A;  2PJ7 A;  4IUS A;  3R95 A;  1IU8 A;  3GLJ A;  4YU9 A;  2QVP A;  4FUU A;  4KLW A;  1ARL A;  4H6Z A;  4PSW A;  5EMI A;  1RO5 A;  4RN7 A;  4XPL A;  4MFK A;  1IGB A;  3PP9 A;  1Z8T A;  2Q4Y A;  1KWM A;  1OBR A;  1HEE A;  1IY7 A;  2PJ3 A;  5THW A;  3TX8 A;  5AIL A;  3RAM A;  2ACF A;  2ARH A;  3JUW A;  4XPK A;  4DUK A;  2PQ8 A;  3DR6 A;  4DNC A;  3R1K A;  5HMN A;  1Y7R A;  3CXS A;  4F0X A;  1M4D A;  2VEZ A;  3RZA A;  1S7F A;  3SJX A;  4EVY A;  4JLL A;  4UBR A;  2ZEO A;  3JVN A;  2XEG A;  3T9Y A;  2I00 A;  2REF A;  5JM6 A;  4LQ6 A;  1XMB A;  2QJ8 A;  1YR0 A;  4OC4 A;  2PRQ A;  4EWT A;  2PJ0 A;  2B5G B;  3BXM A;  5DS0 A;  5HVF A;  3R96 A;  4DJL A;  4B13 A;  2NMT A;  1PYT B;  3GQE A;  3NE7 A;  4PPZ A;  4P4E A;  1Q7L A;  4MFQ A;  4B11 A;  2DXQ A;  4YFJ A;  1FT7 A;  2OOT A;  2H5M A;  5LYI A;  5LYF A;  2PJ9 A;  2PJ1 A;  2C6P A;  1GHE A;  3IJ3 A;  3JRU A;  3BI0 A;  4HKF A;  2IMO A;  3FRM A;  4GXH A;  1S3Z A;  4R6T A;  4MJ8 A;  4UIA A;  1NJR A;  2Z3M A;  1JQG A;  2OB0 A;  4QUS A;  2Q51 A;  4PXC A;  4MHP A;  2EK9 A;  1S7N A;  1L0C A;  3NA6 A;  2J8R A;  3RBU A;  4J5S A;  3A9L A;  4KOR A;  4NJQ A;  2VRI A;  2NYQ A;  2Q4V A;  1ARM A;  2BSW A;  2C27 A;  5JH9 A;  2FXF A;  2XEJ A;  1VHE A;  3EXN A;  1X12 A;  3KQZ A;  5G20 A;  5K8M A;  3GPQ A;  3EO4 A;  2O53 A;  2AFC A;  3WT4 A;  4CAE A;  1IYL A;  4CAX A;  5E96 A;  1BAV A;  4ZGY B;  2AFS A;  5I4M A;  2W2G A;  5C82 A;  4E0A A;  3D8P A;  3EC4 A;  4MCQ A;  2VQY A;  2V8H A;  1ZR3 A;  4B14 A;  3D68 A;  2ZW6 A;  2PIY A;  2Z3L A;  1V0C A;  4R8F A;  4CYN A;  3B2Y A;  4TU0 A;  1KUY A;  4OME A;  4RI1 A;  4AB7 A;  2I79 A;  5H84 A;  1LOK A;  1IID A;  2ZPA A;  3D4U A;  3H8F A;  4J3G A;  3TC8 A;  3VWD A;  4CGN A;  1ELM P;  1QSN A;  2BEI A;  1BOB A;  4OAE A;  4R3L A;  3S6K A;  3NFZ A;  4KSA A;  3KR5 A;  4A31 A;  1U6M A;  4ABL A;  3IEH A;  4KUA A;  4KVO E;  2REE A;  3DNS A;  4PSX A;  2PRB A;  4HNX B;  4ABK A;  4P4J A;  4JLY A;  2V8D A;  2HQY A;  1MJB A;  4UCM A;  2P6F A;  2ZEM A;  1CM0 A;  2Q7B A;  3Q6Z A;  4P4B A;  4UFV A;  1VKC A;  3B3T A;  3L2N A;  2FXK A;  3SI0 A;  1Y0R A;  7CPA A;  4GS4 A;  3KI9 A;  4CYP A;  1YK3 A;  1MK4 A;  3MRU A;  1YX0 A;  4ETJ A;  1P4N A;  4OC3 A;  3CPX A;  1CPX A;  5F46 A;  5HH1 A;  2ZOF A;  4WWV A;  5F48 A;  5JPH A;  2Z11 A;  3GIU A;  2YNC C;  4JXR A;  2Z3K A;  2B3V A;  2Z0Z A;  2GIV A;  2PCU A;  4KOW A;  3SJG A;  5HVG A;  4BD9 A;  4R87 A;  4NGR A;  3WC5 A;  1N71 A;  3D7G A;  3GPG A;  4MCR A;  4Y49 B;  2ABZ A;  3SXO A;  3JTK A;  3IGR A;  4C2Z A;  2V77 A;  3T90 A;  1HDQ A;  4K3N A;  4U5Y A;  3FED A;  4C7H A;  3NE8 A;  3EKE A;  1KUX A;  4KOS A;  4H6U A;  1PU9 A;  3KHX A;  4MCP A;  4H2K A;  2OZG A;  4JYW A;  4MHY A;  3GQO A;  4UML A;  3PB4 X;  8CPA A;  5CB5 A;  1XIX A;  4B10 A;  5KTC A;  4ETK A;  2FSR A;  1UWY A;  3K9T A;  1F57 A;  2B58 A;  3FVL A;  3VH9 A;  1WWZ A;  4IHM A;  4A2Z A;  5LYL A;  3R9F A;  1TF8 A;  4CS0 B;  3ZJ0 A;  4MFZ A;  5JGF A;  2Z3P A;  2C1C A;  2WUU A;  1YLO A;  2PE3 A;  5IB0 A;  4IQY A;  2EK8 A;  3CT9 A;  4JJX A;  4W9Y A;  4NGP A;  3I9S A;  3KAS A;  5EC4 A;  2GLJ A;  4MI4 A;  4R9M A;  4J4Z A;  4GUA A;  5FSU A;  2Q0Y A;  4FD4 A;  5H86 A;  4E2A A;  5ISV A;  4X5K A;  1QSO A;  3LWU A;  2O4H A;  2PSW A;  3F5B A;  5HXD A;  4P4I A;  4M6I A;  4B5P A;  4QB9 A;  4G1P A;  1TIQ A;  3PFE A;  3TT2 A;  5CMS A;  5C88 A;  4H89 A;  2DPS A;  3KR4 A;  2BOA A;  4XPD C;  3R9G A;  4UWJ A;  1R43 A;  2PVW A;  5FSX A;  3EJF A;  2ZEF A;  4QC6 A;  4BIN A;  4CAW A;  5D8N A;  5JQ4 A;  4OC2 A;  5HIH A;  5FSZ A;  1AUG A;  1YVO A;  4IF5 A;  4UFX A;  2BUE A;  4UCN A;  3V2B A;  4P45 A;  1XMT A;  4MHD A;  4F6A A;  3EWQ A;  2RB7 A;  3KQX A;  1EE3 P;  3LD2 A;  3IU2 A;  1ZG8 A;  5F47 A;  3V45 A;  1I12 A;  2ZXV A;  4NGN A;  4C68 A;  2GAN A;  2G0B A;  4OLL A;  3TO7 A;  3FXT A;  1M4I A;  4UIB A;  1LAN A;  2EO8 A;  4R57 A;  2VBQ A;  5HVH A;  2ZEE A;  1Z9U A;  1AYE A;  4KLV A;  4P4D A;  1WK4 A;  3RNZ A;  2Q44 A;  2VZY A;  4EME A;  1ZLH A;  3IWW A;  2JLM A;  4AG7 A;  2PVV A;  2PR8 A;  1Y9W A;  3FB3 A;  3QAY A;  5CPA A;  2ZW4 A;  3PEI A;  3EY5 A;  2PJ2 A;  4HNW B;  4A94 A;  3EJG A;  3SIG A;  4R7M A;  2L8R A;  1YME A;  3TFY A;  2PJA A;  4KYB A;  4K30 A;  3GPO A;  5DUS A;  4QBJ A;  4UEZ A;  4P44 A;  3ISX A;  1CJW A;  3WAB A;  4UFW A;  2B3U A;  4YWY A;  2FS5 A;  4TWE A;  2XD7 A;  4ZX9 A;  4KUB A;  1VHU A;  1Q2C A;  1QSR A;  3ISZ A;  3B7I A;  1HJZ A;  2GU2 A;  4AVC A;  4DYO A;  2AE6 A;  1ZLI A;  2B5G A;  1Z4R A;  1F2P A;  2CNM A;  4A33 A;  3PB9 X;  5J1Q A;  2EWB A;  1FNO A;  2PJ6 A;  1Z8X A;  1Y0Y A;  2QIR A;  3DDD A;  3B3C A;  2FT0 A;  4MHZ A;  4X3R A;  2BFQ A;  3Q71 A;  3D66 A;  3F8K A;  2HB6 A;  4ZY2 A;  3H5Z A;  4OID A;  4XNH C;  4F9U A;  5AG7 A;  4ZI6 A;  1HDU A;  1QST A;  3C26 A;  4NF1 A;  1S7L A;  4CGL A;  1CG2 A;  2CIJ A;  2JZE A;  3IC1 A;  3BJ7 A;  4OKO A;  4KSI A;  5ELY A;  2EBJ A;  2PJ4 A;  3KL9 A;  4MY3 A;  1X10 A;  2WZN A;  3HUV A;  3S6H A;  3SXN A;  3HLP A;  3V38 A;  4YRH A;  2ZEG A;  5IB9 A;  5J8C A;  2D4P A;  1VIX A;  3G3S A;  4NGT A;  1PUA A;  2RC4 A;  2WYR A;  4KOU A;  4AG9 A;  4A32 A;  4D86 A;  4Z65 A;  4R76 A;  2ZEH A;  4NSQ A;  4L89 A;  4UEE A;  3FH4 A;  3RO0 A;  2HUZ A;  5G22 A;  1H8L A;  3B3W A;  4Q7A A;  4JWP A;  2B4D A;  2JEW A;  1IYK A;  3FIX A;  2KCW A;  4NGQ A;  1NMT A;  3D67 A;  3CZX A;  4JZ0 A;  3ZZI A;  3B8G A;  2OZU A;  4JCA A;  3WC7 A;  3KKW A;  1ZO0 A;  2EUI A;  5J8F A;  2BFR A;  2Z10 A;  5DWM A;  3GY9 A;  5LYD A;  2FAV A;  2C6G A;  1XRY A;  1PCA A;  2WPW A;  3W6X A;  4BMH A;  3IWG A;  2GFQ A;  1SPV A;  3NH5 A;  3PB8 X;  2G3T A;  4B6Z A;  4M85 A;  5E3B A;  4FD5 A;  4M3S A;  1NE9 A;  2PDO A;  2ZEN A;  1IOI A;  3D2P A;  3V8I A;  4FAI A;  2WCT A;  1XEB A;  1IIC A;  2JDD A;  1I21 A;  4MRI A;  2FG1 A;  1SQH A;  4I49 A;  3D2M A;  3WR7 A;  3SI2 A;  6CPA A;  2BL1 A;  4NEX A;  4PXE A;  5GCN A;  4II9 A;  2B4B A;  3S9L A;  1A2Z A;  2ZEP A;  1CX8 A;  1S7K A;  3FYN A;  4ONW A;  2IL4 A;  4C2X A;  4MHN A;  4C2Y A;  2OZH A; 
#chains in the Genus database with same CATH homology
 1ZG7 A;  2G9D A;  3SJF A;  3NH4 A;  3SII A;  2ZEL A;  4IK2 A;  3T8W A;  4X2T A;  2PJC A;  4NGS A;  5HOL A;  2PIZ A;  2JBK A;  4RUH A;  1TXR A;  1ELL P;  3IIF A;  1YD9 A;  1NSA A;  1XJO A;  4J5R A;  2HC9 A;  3IO1 A;  4ZY1 A;  3SJE A;  5FSY A;  2GLF A;  2LGR A;  3B35 A;  4P6Y A;  3FX6 A;  2Q43 A;  2NSM A;  3KHZ A;  1LAM A;  3KGQ A;  2PJ8 A;  3IID A;  3GB0 A;  3SI1 A;  2PJ5 A;  5JM6 A;  2IJZ A;  3EW5 A;  4OC5 A;  4OP4 A;  4F9V A;  2VL1 A;  5CBM A;  3CDX A;  1M4L A;  4A38 A;  1XBU A;  1YW6 A;  4FWU A;  1AMP A;  4ZY0 A;  4ZYQ A;  2BCO A;  1TKH A;  2AFM A;  2AFO A;  3VFQ A;  5K8O A;  1CP6 A;  4AXV A;  3SIH A;  2F8H A;  3ETI A;  3DGV A;  3FF3 A;  4NFR A;  3PFO A;  2AFZ A;  1YW4 A;  3GUX A;  5F09 A;  2AFU A;  2V8V A;  3QNV A;  2J9A A;  3WC6 A;  1ZG9 A;  1BLL E;  5LRG A;  4ESS A;  3I1U A;  5LRK A;  4EFD A;  3K2K A;  3D7H A;  3SIJ A;  1BPM A;  4A39 A;  3BI1 A;  4NJR A;  2XEI A;  2JBJ A;  4X8I A;  1DE4 C;  3EWP A;  5D29 A;  1QQ9 A;  3S9M A;  3D7F A;  3FMC A;  1DTD A;  1CP7 A;  2CF4 A;  4GVW A;  4MCS A;  3H8G A;  2AFW A;  4GVV A;  1LFW A;  3V7Z A;  1QMU A;  3IFE A;  3PB6 X;  1RTQ A;  4GM5 A;  2FVG A;  5CB3 A;  2EEE A;  2F7V A;  4A37 A;  3IIB A;  4PQA A;  3EWO A;  3H8E A;  2GRE A;  1TF9 A;  2ZED A;  1Z2L A;  3B3V A;  3NH8 A;  3S9N A;  2QYV A;  2C6C A;  1Y7E A;  4K0C A;  4OC1 A;  4F8Z A;  1F2O A;  1Z8L A;  4UEF A;  2CTC A;  1TY8 A;  2POK A;  3FEE A;  2PJB A;  5K8P A;  1VGY A;  1VHO A;  4ZX8 A;  2XEF A;  3KZW A;  2DEA A;  3PB7 X;  4MMO A;  4LQG A;  4J5Q A;  1YSJ A;  4FBE A;  4OC0 A;  3PBB A;  3EWR A;  3CPA A;  4JVV A;  3DLJ A;  3FJU A;  2X47 A;  2OR4 A;  1Z5R A;  3JZT A;  1LCP A;  1GYT A;  4TNU A;  1XFO A;  4CPA A;  1LAP A;  1CPS A;  5LRJ A;  3LMS A;  4JGK A;  2AFX A;  1R3N A;  5FSV A;  2RFH A;  4MXU A;  2CTB A;  1TXZ A;  3BHX A;  3N5F A;  4UF4 A;  3PBE A;  5K8N A;  3D7D A;  4PXD A;  3PRT A;  2ANP A;  4P4F A;  4OIW A;  2I3C A;  2DX6 A;  2Q4Z A;  4P10 A;  2V8G A;  2BO9 A;  3MN8 A;  3VAR A;  3VAT A;  1ZR5 A;  2IQ6 A;  3FEC A;  4IAV A;  4Q7A A;  1TKJ A;  1TKF A;  4O23 A;  4PXB A;  1BPN A;  1CBX A;  2ZOG A;  3B3S A;  4WJB A;  2PJ7 A;  3GLJ A;  4YU9 A;  2QVP A;  4FUU A;  1ARL A;  1IGB A;  1KWM A;  1OBR A;  1HEE A;  1IY7 A;  2PJ3 A;  5THW A;  3TX8 A;  5AIL A;  3RAM A;  2ACF A;  4DUK A;  3SJX A;  3RZA A;  4JLL A;  2ZEO A;  2XEG A;  1XMB A;  2QJ8 A;  4EWT A;  4OC4 A;  2PRQ A;  2PJ0 A;  3BXM A;  5DS0 A;  5HVF A;  4DJL A;  1PYT B;  3GQE A;  4PPZ A;  4P4E A;  1Q7L A;  1FT7 A;  2OOT A;  5LYI A;  5LYF A;  2PJ9 A;  2PJ1 A;  2C6P A;  3IJ3 A;  3JRU A;  3BI0 A;  2IMO A;  4R6T A;  4UIA A;  1NJR A;  1JQG A;  2Q51 A;  4PXC A;  4MHP A;  2EK9 A;  3NA6 A;  3RBU A;  4J5S A;  4NJQ A;  4NGM A;  2VRI A;  2NYQ A;  1ARM A;  5JH9 A;  2XEJ A;  1VHE A;  3KQZ A;  5K8M A;  3GPQ A;  2O53 A;  2AFC A;  3WT4 A;  1BAV A;  2AFS A;  5I4M A;  4MCQ A;  2V8H A;  1ZR3 A;  3D68 A;  2PIY A;  4R8F A;  3B2Y A;  4TU0 A;  4OME A;  1LOK A;  3D4U A;  3H8F A;  3TC8 A;  1ELM P;  3NFZ A;  3KR5 A;  4ABL A;  3IEH A;  4ABK A;  4P4J A;  2V8D A;  2ZEM A;  3Q6Z A;  4P4B A;  3SI0 A;  3B3T A;  3L2N A;  2FXK A;  7CPA A;  1Y0R A;  3KI9 A;  3MRU A;  4OC3 A;  4ETJ A;  3CPX A;  1CPX A;  2ZOF A;  4WWV A;  3SJG A;  2PCU A;  5HVG A;  4BD9 A;  4NGR A;  3WC5 A;  3D7G A;  4MCR A;  3GPG A;  2ABZ A;  2V77 A;  1HDQ A;  4K3N A;  3FED A;  3EKE A;  3KHX A;  4MCP A;  4H2K A;  4JYW A;  4MHY A;  3GQO A;  4UML A;  3PB4 X;  8CPA A;  5CB5 A;  4ETK A;  1UWY A;  3K9T A;  1F57 A;  3FVL A;  3VH9 A;  4IHM A;  5LYL A;  1TF8 A;  5JGF A;  2C1C A;  1YLO A;  2PE3 A;  4IQY A;  2EK8 A;  3CT9 A;  4W9Y A;  4NGP A;  3KAS A;  2GLJ A;  4J4Z A;  4GUA A;  5FSU A;  3LWU A;  2O4H A;  5HXD A;  4P4I A;  4G1P A;  3PFE A;  5CMS A;  3KR4 A;  2BOA A;  1R43 A;  2PVW A;  5FSX A;  3EJF A;  2ZEF A;  5D8N A;  4OC2 A;  5HIH A;  5FSZ A;  3V2B A;  4P45 A;  3EWQ A;  2RB7 A;  3KQX A;  1EE3 P;  1ZG8 A;  3V45 A;  4NGN A;  4UIB A;  1LAN A;  5HVH A;  2ZEE A;  1AYE A;  4P4D A;  4EME A;  1ZLH A;  3IWW A;  2PVV A;  5CPA A;  3PEI A;  2PJ2 A;  4A94 A;  3EJG A;  3SIG A;  4R7M A;  2L8R A;  1YME A;  2PJA A;  4KYB A;  3GPO A;  5DUS A;  4UEZ A;  4P44 A;  3ISX A;  3WAB A;  4YWY A;  4TWE A;  2XD7 A;  4ZX9 A;  1VHU A;  3ISZ A;  3B7I A;  1HJZ A;  2GU2 A;  4DYO A;  1ZLI A;  1F2P A;  3PB9 X;  5J1Q A;  2EWB A;  1FNO A;  2PJ6 A;  1Y0Y A;  4MHZ A;  3B3C A;  4X3R A;  2BFQ A;  3Q71 A;  3D66 A;  2HB6 A;  4ZY2 A;  4OID A;  4F9U A;  4ZI6 A;  1HDU A;  1CG2 A;  2CIJ A;  3IC1 A;  4OKO A;  4KSI A;  5ELY A;  3KL9 A;  2PJ4 A;  2WZN A;  3HUV A;  3HLP A;  3V38 A;  2ZEG A;  5IB9 A;  1VIX A;  4NGT A;  2WYR A;  4D86 A;  4Z65 A;  4R76 A;  2ZEH A;  4UEE A;  3FH4 A;  1H8L A;  3B3W A;  2JEW A;  4NGQ A;  3D67 A;  4JZ0 A;  4JCA A;  3WC7 A;  2BFR A;  5LYD A;  2FAV A;  2C6G A;  1XRY A;  1PCA A;  3NH5 A;  3PB8 X;  1SPV A;  4B6Z A;  5E3B A;  2ZEN A;  4FAI A;  4MRI A;  2FG1 A;  3SI2 A;  6CPA A;  4PXE A;  3S9L A;  2ZEP A;  1CX8 A;  4ONW A;  4MHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...