4JGKA

Crystal structure of the evolved variant of the computationally designed serine hydrolase, northeast structural genomics consortium (nesg) target or275
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTGVGAWVGGLPAEAVYRVMLEEIKKAPDTLEVTGVHGTEKSAEAFRRAGLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the evolved variant of the computationally designed serine hydrolase, Northeast Structural Genomics Consortium (NESG) Target OR275
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords evolved variant of a designed serine hydrolase
total genus 54
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4jgkA00
5FSUA 4R6TA 3IJ3A 1BPNA 3PEIA 4ZY1A 4JGKA 3GPOA 4JLLA 3JZTA 2DX6A 2ACFA 3GQEA 3Q71A 1LAMA 4ETKA 5CB5A 4JVVA 4JCAA 1SPVA 3VFQA 2BFRA 3EWQA 4ETJA 4GUAA 5DUSA 3H8GA 3SIIA 5D8NA 5AILA 4TU0A 4J4ZA 4X2TA 1VHUA 3JRUA 3KR5A 1ZR5A 2XD7A 4KSIA 2FG1A 4ABKA 2EEEA 5CB3A 4ABLA 3GPQA 4J5SA 5FSXA 1BPMA 1ZR3A 3IIDA 3KR4A 3EWOA 3EKEA 4ESSA 1NJRA 3IIFA 3SIJA 3KZWA 3EWRA 4R7MA 3KQZA 3EWPA 5CBMA 1LANA 4D86A 2L8RA 1TY8A 4ZI6A 2J9AA 3EW5A 4GVWA 4J5RA 2AFCA 3V45A 3ETIA 5CMSA 3EJGA 2LGRA 4IQYA 1BLLE 3KQXA 1LCPA 4J5QA 3GQOA 4GVVA 3Q6ZA 4ZX9A 5HIHA 3V2BA 5FSZA 2EWBA 2FXKA 1GYTA 3H8FA 4ZYQA 3GPGA 4ZY2A 3H8EA 5E3BA 2FAVA 4ZY0A 4K0CA 1HJZA 3EJFA 5HOLA 3SIHA 1LAPA 2BFQA 4K3NA 4R76A 3T8WA 2VRIA 5FSVA 2X47A 4ZX8A 4UMLA 1TXZA 1YD9A 3SIGA 4KYBA 5FSYA
chains in the Genus database with same CATH superfamily
5FSUA 4R6TA 2RNKA 3IJ3A 1BPNA 3PEIA 4ZY1A 4JGKA 2W2GA 3GPOA 4JLLA 3JZTA 2DX6A 2ACFA 3GQEA 3Q71A 1LAMA 4ETKA 5CB5A 4JVVA 4JCAA 1SPVA 3VFQA 2BFRA 3EWQA 4ETJA 4GUAA 5DUSA 3H8GA 3SIIA 5D8NA 5AILA 4TU0A 4J4ZA 4X2TA 1VHUA 3JRUA 3KR5A 1ZR5A 2XD7A 4KSIA 2FG1A 4ABKA 2EEEA 5CB3A 4ABLA 3GPQA 4J5SA 5FSXA 1BPMA 1ZR3A 3IIDA 3KR4A 3EWOA 3EKEA 4ESSA 1NJRA 3IIFA 3SIJA 3KZWA 3EWRA 4R7MA 3KQZA 3EWPA 5CBMA 1LANA 2KQVA 4D86A 2L8RA 2JZEA 1TY8A 2WCTA 2J9AA 4ZI6A 3EW5A 4GVWA 4J5RA 2AFCA 3V45A 3ETIA 5CMSA 3EJGA 2LGRA 4IQYA 1BLLE 3KQXA 1LCPA 4J5QA 3GQOA 4GVVA 3Q6ZA 4ZX9A 5HIHA 3V2BA 5FSZA 2EWBA 2FXKA 2JZDA 1GYTA 3H8FA 4ZYQA 2JZFA 3GPGA 4ZY2A 3H8EA 5E3BA 2FAVA 4ZY0A 4K0CA 1HJZA 3EJFA 5HOLA 3SIHA 1LAPA 2BFQA 4K3NA 4R76A 3T8WA 2VRIA 5FSVA 2X47A 4ZX8A 4UMLA 1TXZA 1YD9A 3SIGA 4KYBA 5FSYA
chains in the Genus database with same CATH topology
5FSUA 4R6TA 3IJ3A 1BPNA 3PEIA 4ZY1A 4JGKA 3GPOA 4JLLA 3JZTA 2DX6A 2ACFA 3GQEA 3Q71A 1LAMA 4ETKA 5CB5A 4JVVA 4JCAA 1SPVA 3VFQA 2BFRA 3EWQA 4ETJA 4GUAA 5DUSA 3H8GA 3SIIA 5D8NA 5AILA 4TU0A 4J4ZA 4X2TA 1VHUA 3JRUA 3KR5A 1ZR5A 2XD7A 4KSIA 2FG1A 4ABKA 2EEEA 5CB3A 4ABLA 3GPQA 4J5SA 5FSXA 1BPMA 1ZR3A 3IIDA 3KR4A 3EWOA 3EKEA 4ESSA 1NJRA 3IIFA 3SIJA 3KZWA 3EWRA 4R7MA 3KQZA 3EWPA 5CBMA 1LANA 4D86A 2L8RA 1TY8A 4ZI6A 2J9AA 3EW5A 4GVWA 4J5RA 2AFCA 3V45A 3ETIA 5CMSA 3EJGA 2LGRA 4IQYA 1BLLE 3KQXA 1LCPA 4J5QA 3GQOA 4GVVA 3Q6ZA 4ZX9A 5HIHA 3V2BA 5FSZA 2EWBA 2FXKA 1GYTA 3H8FA 4ZYQA 3GPGA 4ZY2A 3H8EA 5E3BA 2FAVA 4ZY0A 4K0CA 1HJZA 3EJFA 5HOLA 3SIHA 1LAPA 2BFQA 4K3NA 4R76A 3T8WA 2VRIA 5FSVA 2X47A 4ZX8A 4UMLA 1TXZA 1YD9A 3SIGA 4KYBA 5FSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSU A;  4R6T A;  3IJ3 A;  1BPN A;  3PEI A;  4ZY1 A;  4JGK A;  3GPO A;  4JLL A;  3JZT A;  2DX6 A;  2ACF A;  3GQE A;  3Q71 A;  1LAM A;  4ETK A;  5CB5 A;  4JVV A;  4JCA A;  1SPV A;  3VFQ A;  2BFR A;  3EWQ A;  4ETJ A;  4GUA A;  5DUS A;  3H8G A;  3SII A;  5D8N A;  5AIL A;  4TU0 A;  4J4Z A;  4X2T A;  1VHU A;  3JRU A;  3KR5 A;  1ZR5 A;  2XD7 A;  4KSI A;  2FG1 A;  4ABK A;  2EEE A;  5CB3 A;  4ABL A;  3GPQ A;  4J5S A;  5FSX A;  1BPM A;  1ZR3 A;  3IID A;  3KR4 A;  3EWO A;  3EKE A;  4ESS A;  1NJR A;  3IIF A;  3SIJ A;  3KZW A;  3EWR A;  4R7M A;  3KQZ A;  3EWP A;  5CBM A;  1LAN A;  4D86 A;  2L8R A;  1TY8 A;  4ZI6 A;  2J9A A;  3EW5 A;  4GVW A;  4J5R A;  2AFC A;  3V45 A;  3ETI A;  5CMS A;  3EJG A;  2LGR A;  4IQY A;  1BLL E;  3KQX A;  1LCP A;  4J5Q A;  3GQO A;  4GVV A;  3Q6Z A;  4ZX9 A;  5HIH A;  3V2B A;  5FSZ A;  2EWB A;  2FXK A;  1GYT A;  3H8F A;  4ZYQ A;  3GPG A;  4ZY2 A;  3H8E A;  5E3B A;  2FAV A;  4ZY0 A;  4K0C A;  1HJZ A;  3EJF A;  5HOL A;  3SIH A;  1LAP A;  2BFQ A;  4K3N A;  4R76 A;  3T8W A;  2VRI A;  5FSV A;  2X47 A;  4ZX8 A;  4UML A;  1TXZ A;  1YD9 A;  3SIG A;  4KYB A;  5FSY A; 
#chains in the Genus database with same CATH topology
 5FSU A;  4R6T A;  2RNK A;  3IJ3 A;  1BPN A;  3PEI A;  4ZY1 A;  4JGK A;  2W2G A;  3GPO A;  4JLL A;  3JZT A;  2DX6 A;  2ACF A;  3GQE A;  3Q71 A;  1LAM A;  4ETK A;  5CB5 A;  4JVV A;  4JCA A;  1SPV A;  3VFQ A;  2BFR A;  3EWQ A;  4ETJ A;  4GUA A;  5DUS A;  3H8G A;  3SII A;  5D8N A;  5AIL A;  4TU0 A;  4J4Z A;  4X2T A;  1VHU A;  3JRU A;  3KR5 A;  1ZR5 A;  2XD7 A;  4KSI A;  2FG1 A;  4ABK A;  2EEE A;  5CB3 A;  4ABL A;  3GPQ A;  4J5S A;  5FSX A;  1BPM A;  1ZR3 A;  3IID A;  3KR4 A;  3EWO A;  3EKE A;  4ESS A;  1NJR A;  3IIF A;  3SIJ A;  3KZW A;  3EWR A;  4R7M A;  3KQZ A;  3EWP A;  5CBM A;  1LAN A;  2KQV A;  4D86 A;  2L8R A;  2JZE A;  1TY8 A;  2WCT A;  2J9A A;  4ZI6 A;  3EW5 A;  4GVW A;  4J5R A;  2AFC A;  3V45 A;  3ETI A;  5CMS A;  3EJG A;  2LGR A;  4IQY A;  1BLL E;  3KQX A;  1LCP A;  4J5Q A;  3GQO A;  4GVV A;  3Q6Z A;  4ZX9 A;  5HIH A;  3V2B A;  5FSZ A;  2EWB A;  2FXK A;  2JZD A;  1GYT A;  3H8F A;  4ZYQ A;  2JZF A;  3GPG A;  4ZY2 A;  3H8E A;  5E3B A;  2FAV A;  4ZY0 A;  4K0C A;  1HJZ A;  3EJF A;  5HOL A;  3SIH A;  1LAP A;  2BFQ A;  4K3N A;  4R76 A;  3T8W A;  2VRI A;  5FSV A;  2X47 A;  4ZX8 A;  4UML A;  1TXZ A;  1YD9 A;  3SIG A;  4KYB A;  5FSY A; 
#chains in the Genus database with same CATH homology
 5FSU A;  4R6T A;  3IJ3 A;  1BPN A;  3PEI A;  4ZY1 A;  4JGK A;  3GPO A;  4JLL A;  3JZT A;  2DX6 A;  2ACF A;  3GQE A;  3Q71 A;  1LAM A;  4ETK A;  5CB5 A;  4JVV A;  4JCA A;  1SPV A;  3VFQ A;  2BFR A;  3EWQ A;  4ETJ A;  4GUA A;  5DUS A;  3H8G A;  3SII A;  5D8N A;  5AIL A;  4TU0 A;  4J4Z A;  4X2T A;  1VHU A;  3JRU A;  3KR5 A;  1ZR5 A;  2XD7 A;  4KSI A;  2FG1 A;  4ABK A;  2EEE A;  5CB3 A;  4ABL A;  3GPQ A;  4J5S A;  5FSX A;  1BPM A;  1ZR3 A;  3IID A;  3KR4 A;  3EWO A;  3EKE A;  4ESS A;  1NJR A;  3IIF A;  3SIJ A;  3KZW A;  3EWR A;  4R7M A;  3KQZ A;  3EWP A;  5CBM A;  1LAN A;  4D86 A;  2L8R A;  1TY8 A;  4ZI6 A;  2J9A A;  3EW5 A;  4GVW A;  4J5R A;  2AFC A;  3V45 A;  3ETI A;  5CMS A;  3EJG A;  2LGR A;  4IQY A;  1BLL E;  3KQX A;  1LCP A;  4J5Q A;  3GQO A;  4GVV A;  3Q6Z A;  4ZX9 A;  5HIH A;  3V2B A;  5FSZ A;  2EWB A;  2FXK A;  1GYT A;  3H8F A;  4ZYQ A;  3GPG A;  4ZY2 A;  3H8E A;  5E3B A;  2FAV A;  4ZY0 A;  4K0C A;  1HJZ A;  3EJF A;  5HOL A;  3SIH A;  1LAP A;  2BFQ A;  4K3N A;  4R76 A;  3T8W A;  2VRI A;  5FSV A;  2X47 A;  4ZX8 A;  4UML A;  1TXZ A;  1YD9 A;  3SIG A;  4KYB A;  5FSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...