2BFQA

Macro domains are adp-ribose binding molecules
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
EVLFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISKKAMREQFGRDYIDHGEVVVTPAMNLEERGIKYVFHTVGPICSGMWSEELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKGSAVKEVALVIYDRKSAEVALKVFERSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Adp ribose-binding protein
molecule keywords HYPOTHETICAL PROTEIN AF1521
publication title The Macro Domain is an Adp-Ribose Binding Module.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 68
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2bfqA00
3Q71A 3KR5A 2BFQA 2XD7A 5CMSA 1SPVA 3T8WA 2FAVA 2EEEA 3EW5A 4JGKA 4X2TA 4ZY2A 2J9AA 2LGRA 4GVVA 3H8EA 1LAPA 3EWRA 5HOLA 2FG1A 4D86A 4ZX8A 4K3NA 3JRUA 3SIGA 4GVWA 4TU0A 4JVVA 3KZWA 4JCAA 3V45A 4KSIA 3JZTA 3SIIA 5CBMA 3KQXA 3EWOA 4KYBA 1GYTA 1TXZA 4ZY1A 1VHUA 3H8GA 3SIHA 3GQOA 1ZR3A 1HJZA 3GPOA 2VRIA 3IIDA 1LAMA 1LANA 4JLLA 2L8RA 3EWQA 1TY8A 5D8NA 3GPGA 4ETKA 4ABLA 5FSYA 5AILA 2BFRA 3GPQA 4R76A 2X47A 4GUAA 5FSZA 4J5SA 3IIFA 3IJ3A 4J5RA 5FSXA 3EJFA 4ETJA 1LCPA 3PEIA 3Q6ZA 4ZY0A 4IQYA 5CB5A 4ZI6A 4UMLA 1ZR5A 3EKEA 3EJGA 2ACFA 3KQZA 3EWPA 2DX6A 2EWBA 1YD9A 1BLLE 4J4ZA 3GQEA 5E3BA 4ZX9A 4ZYQA 3VFQA 5DUSA 5FSVA 3SIJA 5FSUA 4R6TA 4J5QA 4ABKA 4R7MA 1BPMA 1NJRA 2AFCA 4K0CA 3H8FA 4ESSA 3ETIA 2FXKA 3V2BA 3KR4A 1BPNA 5CB3A 5HIHA
chains in the Genus database with same CATH superfamily
3Q71A 3KR5A 2BFQA 2XD7A 5CMSA 1SPVA 3T8WA 2FAVA 2EEEA 3EW5A 4JGKA 4X2TA 4ZY2A 2J9AA 2LGRA 4GVVA 3H8EA 1LAPA 3EWRA 5HOLA 2FG1A 4D86A 2W2GA 4K3NA 4ZX8A 3JRUA 3SIGA 2KQVA 2WCTA 4GVWA 4TU0A 4JVVA 3KZWA 4JCAA 3V45A 4KSIA 3JZTA 3SIIA 5CBMA 3KQXA 3EWOA 4KYBA 2JZFA 1GYTA 1TXZA 4ZY1A 1VHUA 3H8GA 3SIHA 3GQOA 1ZR3A 1HJZA 3GPOA 2VRIA 3IIDA 1LAMA 1LANA 2RNKA 4JLLA 2L8RA 2JZEA 3EWQA 2JZDA 1TY8A 5D8NA 3GPGA 4ETKA 4ABLA 5FSYA 5AILA 2BFRA 3GPQA 4R76A 2X47A 4GUAA 5FSZA 4J5SA 3IIFA 3IJ3A 4J5RA 5FSXA 3EJFA 4ETJA 1LCPA 3PEIA 3Q6ZA 4ZY0A 4IQYA 5CB5A 4ZI6A 4UMLA 1ZR5A 3EKEA 3EJGA 2ACFA 3KQZA 3EWPA 2DX6A 2EWBA 1YD9A 1BLLE 4J4ZA 3GQEA 5E3BA 4ZX9A 4ZYQA 3VFQA 5DUSA 5FSVA 3SIJA 5FSUA 4R6TA 4J5QA 4ABKA 4R7MA 1BPMA 1NJRA 2AFCA 4K0CA 3H8FA 4ESSA 3ETIA 2FXKA 3V2BA 3KR4A 1BPNA 5CB3A 5HIHA
chains in the Genus database with same CATH topology
3Q71A 3KR5A 2BFQA 2XD7A 5CMSA 1SPVA 3T8WA 2FAVA 2EEEA 3EW5A 4JGKA 4X2TA 4ZY2A 2J9AA 2LGRA 4GVVA 3H8EA 1LAPA 3EWRA 5HOLA 2FG1A 4D86A 4ZX8A 4K3NA 3JRUA 3SIGA 4GVWA 4TU0A 4JVVA 3KZWA 4JCAA 3V45A 4KSIA 3JZTA 3SIIA 5CBMA 3KQXA 3EWOA 4KYBA 1GYTA 1TXZA 4ZY1A 1VHUA 3H8GA 3SIHA 3GQOA 1ZR3A 1HJZA 3GPOA 2VRIA 3IIDA 1LAMA 1LANA 4JLLA 2L8RA 3EWQA 1TY8A 5D8NA 3GPGA 4ETKA 4ABLA 5FSYA 5AILA 2BFRA 3GPQA 4R76A 2X47A 4GUAA 5FSZA 4J5SA 3IIFA 3IJ3A 4J5RA 5FSXA 3EJFA 4ETJA 1LCPA 3PEIA 3Q6ZA 4ZY0A 4IQYA 5CB5A 4ZI6A 4UMLA 1ZR5A 3EKEA 3EJGA 2ACFA 3KQZA 3EWPA 2DX6A 2EWBA 1YD9A 1BLLE 4J4ZA 3GQEA 5E3BA 4ZX9A 4ZYQA 3VFQA 5DUSA 5FSVA 3SIJA 5FSUA 4R6TA 4J5QA 4ABKA 4R7MA 1BPMA 1NJRA 2AFCA 4K0CA 3H8FA 4ESSA 3ETIA 2FXKA 3V2BA 3KR4A 1BPNA 5CB3A 5HIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q71 A;  3KR5 A;  2BFQ A;  2XD7 A;  5CMS A;  1SPV A;  3T8W A;  2FAV A;  2EEE A;  3EW5 A;  4JGK A;  4X2T A;  4ZY2 A;  2J9A A;  2LGR A;  4GVV A;  3H8E A;  1LAP A;  3EWR A;  5HOL A;  2FG1 A;  4D86 A;  4ZX8 A;  4K3N A;  3JRU A;  3SIG A;  4GVW A;  4TU0 A;  4JVV A;  3KZW A;  4JCA A;  3V45 A;  4KSI A;  3JZT A;  3SII A;  5CBM A;  3KQX A;  3EWO A;  4KYB A;  1GYT A;  1TXZ A;  4ZY1 A;  1VHU A;  3H8G A;  3SIH A;  3GQO A;  1ZR3 A;  1HJZ A;  3GPO A;  2VRI A;  3IID A;  1LAM A;  1LAN A;  4JLL A;  2L8R A;  3EWQ A;  1TY8 A;  5D8N A;  3GPG A;  4ETK A;  4ABL A;  5FSY A;  5AIL A;  2BFR A;  3GPQ A;  4R76 A;  2X47 A;  4GUA A;  5FSZ A;  4J5S A;  3IIF A;  3IJ3 A;  4J5R A;  5FSX A;  3EJF A;  4ETJ A;  1LCP A;  3PEI A;  3Q6Z A;  4ZY0 A;  4IQY A;  5CB5 A;  4ZI6 A;  4UML A;  1ZR5 A;  3EKE A;  3EJG A;  2ACF A;  3KQZ A;  3EWP A;  2DX6 A;  2EWB A;  1YD9 A;  1BLL E;  4J4Z A;  3GQE A;  5E3B A;  4ZX9 A;  4ZYQ A;  3VFQ A;  5DUS A;  5FSV A;  3SIJ A;  5FSU A;  4R6T A;  4J5Q A;  4ABK A;  4R7M A;  1BPM A;  1NJR A;  2AFC A;  4K0C A;  3H8F A;  4ESS A;  3ETI A;  2FXK A;  3V2B A;  3KR4 A;  1BPN A;  5CB3 A;  5HIH A; 
#chains in the Genus database with same CATH topology
 3Q71 A;  3KR5 A;  2BFQ A;  2XD7 A;  5CMS A;  1SPV A;  3T8W A;  2FAV A;  2EEE A;  3EW5 A;  4JGK A;  4X2T A;  4ZY2 A;  2J9A A;  2LGR A;  4GVV A;  3H8E A;  1LAP A;  3EWR A;  5HOL A;  2FG1 A;  4D86 A;  2W2G A;  4K3N A;  4ZX8 A;  3JRU A;  3SIG A;  2KQV A;  2WCT A;  4GVW A;  4TU0 A;  4JVV A;  3KZW A;  4JCA A;  3V45 A;  4KSI A;  3JZT A;  3SII A;  5CBM A;  3KQX A;  3EWO A;  4KYB A;  2JZF A;  1GYT A;  1TXZ A;  4ZY1 A;  1VHU A;  3H8G A;  3SIH A;  3GQO A;  1ZR3 A;  1HJZ A;  3GPO A;  2VRI A;  3IID A;  1LAM A;  1LAN A;  2RNK A;  4JLL A;  2L8R A;  2JZE A;  3EWQ A;  2JZD A;  1TY8 A;  5D8N A;  3GPG A;  4ETK A;  4ABL A;  5FSY A;  5AIL A;  2BFR A;  3GPQ A;  4R76 A;  2X47 A;  4GUA A;  5FSZ A;  4J5S A;  3IIF A;  3IJ3 A;  4J5R A;  5FSX A;  3EJF A;  4ETJ A;  1LCP A;  3PEI A;  3Q6Z A;  4ZY0 A;  4IQY A;  5CB5 A;  4ZI6 A;  4UML A;  1ZR5 A;  3EKE A;  3EJG A;  2ACF A;  3KQZ A;  3EWP A;  2DX6 A;  2EWB A;  1YD9 A;  1BLL E;  4J4Z A;  3GQE A;  5E3B A;  4ZX9 A;  4ZYQ A;  3VFQ A;  5DUS A;  5FSV A;  3SIJ A;  5FSU A;  4R6T A;  4J5Q A;  4ABK A;  4R7M A;  1BPM A;  1NJR A;  2AFC A;  4K0C A;  3H8F A;  4ESS A;  3ETI A;  2FXK A;  3V2B A;  3KR4 A;  1BPN A;  5CB3 A;  5HIH A; 
#chains in the Genus database with same CATH homology
 3Q71 A;  3KR5 A;  2BFQ A;  2XD7 A;  5CMS A;  1SPV A;  3T8W A;  2FAV A;  2EEE A;  3EW5 A;  4JGK A;  4X2T A;  4ZY2 A;  2J9A A;  2LGR A;  4GVV A;  3H8E A;  1LAP A;  3EWR A;  5HOL A;  2FG1 A;  4D86 A;  4ZX8 A;  4K3N A;  3JRU A;  3SIG A;  4GVW A;  4TU0 A;  4JVV A;  3KZW A;  4JCA A;  3V45 A;  4KSI A;  3JZT A;  3SII A;  5CBM A;  3KQX A;  3EWO A;  4KYB A;  1GYT A;  1TXZ A;  4ZY1 A;  1VHU A;  3H8G A;  3SIH A;  3GQO A;  1ZR3 A;  1HJZ A;  3GPO A;  2VRI A;  3IID A;  1LAM A;  1LAN A;  4JLL A;  2L8R A;  3EWQ A;  1TY8 A;  5D8N A;  3GPG A;  4ETK A;  4ABL A;  5FSY A;  5AIL A;  2BFR A;  3GPQ A;  4R76 A;  2X47 A;  4GUA A;  5FSZ A;  4J5S A;  3IIF A;  3IJ3 A;  4J5R A;  5FSX A;  3EJF A;  4ETJ A;  1LCP A;  3PEI A;  3Q6Z A;  4ZY0 A;  4IQY A;  5CB5 A;  4ZI6 A;  4UML A;  1ZR5 A;  3EKE A;  3EJG A;  2ACF A;  3KQZ A;  3EWP A;  2DX6 A;  2EWB A;  1YD9 A;  1BLL E;  4J4Z A;  3GQE A;  5E3B A;  4ZX9 A;  4ZYQ A;  3VFQ A;  5DUS A;  5FSV A;  3SIJ A;  5FSU A;  4R6T A;  4J5Q A;  4ABK A;  4R7M A;  1BPM A;  1NJR A;  2AFC A;  4K0C A;  3H8F A;  4ESS A;  3ETI A;  2FXK A;  3V2B A;  3KR4 A;  1BPN A;  5CB3 A;  5HIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...