2X47A

Crystal structure of human macrod1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
235
structure length
229
Chain Sequence
TSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVARYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACRO DOMAIN-CONTAINING PROTEIN 1
publication title Identification of Macro Domain Proteins as Novel O-Acetyl-Adp-Ribose Deacetylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 84
structure length 229
sequence length 235
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2x47A00
4ESSA 3IJ3A 3V2BA 4JGKA 1TXZA 4JCAA 3KQZA 3JZTA 3EKEA 2EEEA 1LAPA 4KSIA 1VHUA 3IIFA 1YD9A 2FAVA 3EJFA 3SIIA 3KR5A 1BPNA 1LANA 3ETIA 4JVVA 4ZX8A 3Q6ZA 1LCPA 3IIDA 4ABLA 5FSYA 5CMSA 5FSXA 4GUAA 2BFQA 3T8WA 1NJRA 4JLLA 2XD7A 4R76A 3KZWA 5HIHA 3SIJA 4ETKA 3EWRA 4IQYA 4ABKA 4ZX9A 4K0CA 3JRUA 4TU0A 2VRIA 2J9AA 3EW5A 4KYBA 5CB3A 1BLLE 3GQEA 2L8RA 4GVWA 4D86A 1ZR5A 5CBMA 3KR4A 1ZR3A 3GQOA 3GPOA 3V45A 5FSZA 2EWBA 1SPVA 3PEIA 1HJZA 1BPMA 3EWPA 4X2TA 5FSVA 4ZY1A 2AFCA 2FG1A 3SIGA 4ETJA 5D8NA 5DUSA 4R6TA 4ZYQA 4J5QA 4J5SA 5FSUA 5HOLA 2DX6A 2ACFA 4J4ZA 1LAMA 2LGRA 3H8FA 1TY8A 2FXKA 4R7MA 3EWOA 3Q71A 4J5RA 5CB5A 4UMLA 3SIHA 5AILA 3KQXA 4K3NA 3H8GA 3GPGA 1GYTA 3VFQA 5E3BA 3EWQA 4ZY0A 4GVVA 3EJGA 2BFRA 4ZY2A 4ZI6A 3GPQA 2X47A 3H8EA
chains in the Genus database with same CATH superfamily
4ESSA 3IJ3A 3V2BA 4JGKA 1TXZA 4JCAA 3KQZA 3JZTA 3EKEA 2EEEA 1LAPA 4KSIA 1VHUA 3IIFA 1YD9A 2FAVA 3EJFA 3SIIA 3KR5A 1BPNA 1LANA 2JZEA 3ETIA 4JVVA 4ZX8A 3Q6ZA 1LCPA 3IIDA 4ABLA 5FSYA 5CMSA 5FSXA 4GUAA 2BFQA 3T8WA 1NJRA 4JLLA 2XD7A 4R76A 3KZWA 5HIHA 3SIJA 4ETKA 3EWRA 4IQYA 4ABKA 4ZX9A 4K0CA 3JRUA 4TU0A 2VRIA 2J9AA 3EW5A 4KYBA 2RNKA 5CB3A 1BLLE 3GQEA 2L8RA 4GVWA 4D86A 1ZR5A 5CBMA 3KR4A 1ZR3A 3GQOA 2WCTA 3GPOA 3V45A 5FSZA 2EWBA 1SPVA 3PEIA 1HJZA 2JZDA 1BPMA 3EWPA 4X2TA 5FSVA 4ZY1A 2AFCA 2FG1A 3SIGA 4ETJA 2W2GA 5D8NA 5DUSA 2KQVA 4R6TA 4ZYQA 4J5QA 4J5SA 5FSUA 5HOLA 2DX6A 2ACFA 4J4ZA 1LAMA 2LGRA 3H8FA 1TY8A 2FXKA 4R7MA 3EWOA 3Q71A 4J5RA 5CB5A 4UMLA 3SIHA 5AILA 3KQXA 4K3NA 3H8GA 3GPGA 1GYTA 3VFQA 5E3BA 2JZFA 3EWQA 4ZY0A 4GVVA 3EJGA 2BFRA 4ZY2A 4ZI6A 3GPQA 2X47A 3H8EA
chains in the Genus database with same CATH topology
4ESSA 3IJ3A 3V2BA 4JGKA 1TXZA 4JCAA 3KQZA 3JZTA 3EKEA 2EEEA 1LAPA 4KSIA 1VHUA 3IIFA 1YD9A 2FAVA 3EJFA 3SIIA 3KR5A 1BPNA 1LANA 3ETIA 4JVVA 4ZX8A 3Q6ZA 1LCPA 3IIDA 4ABLA 5FSYA 5CMSA 5FSXA 4GUAA 2BFQA 3T8WA 1NJRA 4JLLA 2XD7A 4R76A 3KZWA 5HIHA 3SIJA 4ETKA 3EWRA 4IQYA 4ABKA 4ZX9A 4K0CA 3JRUA 4TU0A 2VRIA 2J9AA 3EW5A 4KYBA 5CB3A 1BLLE 3GQEA 2L8RA 4GVWA 4D86A 1ZR5A 5CBMA 3KR4A 1ZR3A 3GQOA 3GPOA 3V45A 5FSZA 2EWBA 1SPVA 3PEIA 1HJZA 1BPMA 3EWPA 4X2TA 5FSVA 4ZY1A 2AFCA 2FG1A 3SIGA 4ETJA 5D8NA 5DUSA 4R6TA 4ZYQA 4J5QA 4J5SA 5FSUA 5HOLA 2DX6A 2ACFA 4J4ZA 1LAMA 2LGRA 3H8FA 1TY8A 2FXKA 4R7MA 3EWOA 3Q71A 4J5RA 5CB5A 4UMLA 3SIHA 5AILA 3KQXA 4K3NA 3H8GA 3GPGA 1GYTA 3VFQA 5E3BA 3EWQA 4ZY0A 4GVVA 3EJGA 2BFRA 4ZY2A 4ZI6A 3GPQA 2X47A 3H8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESS A;  3IJ3 A;  3V2B A;  4JGK A;  1TXZ A;  4JCA A;  3KQZ A;  3JZT A;  3EKE A;  2EEE A;  1LAP A;  4KSI A;  1VHU A;  3IIF A;  1YD9 A;  2FAV A;  3EJF A;  3SII A;  3KR5 A;  1BPN A;  1LAN A;  3ETI A;  4JVV A;  4ZX8 A;  3Q6Z A;  1LCP A;  3IID A;  4ABL A;  5FSY A;  5CMS A;  5FSX A;  4GUA A;  2BFQ A;  3T8W A;  1NJR A;  4JLL A;  2XD7 A;  4R76 A;  3KZW A;  5HIH A;  3SIJ A;  4ETK A;  3EWR A;  4IQY A;  4ABK A;  4ZX9 A;  4K0C A;  3JRU A;  4TU0 A;  2VRI A;  2J9A A;  3EW5 A;  4KYB A;  5CB3 A;  1BLL E;  3GQE A;  2L8R A;  4GVW A;  4D86 A;  1ZR5 A;  5CBM A;  3KR4 A;  1ZR3 A;  3GQO A;  3GPO A;  3V45 A;  5FSZ A;  2EWB A;  1SPV A;  3PEI A;  1HJZ A;  1BPM A;  3EWP A;  4X2T A;  5FSV A;  4ZY1 A;  2AFC A;  2FG1 A;  3SIG A;  4ETJ A;  5D8N A;  5DUS A;  4R6T A;  4ZYQ A;  4J5Q A;  4J5S A;  5FSU A;  5HOL A;  2DX6 A;  2ACF A;  4J4Z A;  1LAM A;  2LGR A;  3H8F A;  1TY8 A;  2FXK A;  4R7M A;  3EWO A;  3Q71 A;  4J5R A;  5CB5 A;  4UML A;  3SIH A;  5AIL A;  3KQX A;  4K3N A;  3H8G A;  3GPG A;  1GYT A;  3VFQ A;  5E3B A;  3EWQ A;  4ZY0 A;  4GVV A;  3EJG A;  2BFR A;  4ZY2 A;  4ZI6 A;  3GPQ A;  2X47 A;  3H8E A; 
#chains in the Genus database with same CATH topology
 4ESS A;  3IJ3 A;  3V2B A;  4JGK A;  1TXZ A;  4JCA A;  3KQZ A;  3JZT A;  3EKE A;  2EEE A;  1LAP A;  4KSI A;  1VHU A;  3IIF A;  1YD9 A;  2FAV A;  3EJF A;  3SII A;  3KR5 A;  1BPN A;  1LAN A;  2JZE A;  3ETI A;  4JVV A;  4ZX8 A;  3Q6Z A;  1LCP A;  3IID A;  4ABL A;  5FSY A;  5CMS A;  5FSX A;  4GUA A;  2BFQ A;  3T8W A;  1NJR A;  4JLL A;  2XD7 A;  4R76 A;  3KZW A;  5HIH A;  3SIJ A;  4ETK A;  3EWR A;  4IQY A;  4ABK A;  4ZX9 A;  4K0C A;  3JRU A;  4TU0 A;  2VRI A;  2J9A A;  3EW5 A;  4KYB A;  2RNK A;  5CB3 A;  1BLL E;  3GQE A;  2L8R A;  4GVW A;  4D86 A;  1ZR5 A;  5CBM A;  3KR4 A;  1ZR3 A;  3GQO A;  2WCT A;  3GPO A;  3V45 A;  5FSZ A;  2EWB A;  1SPV A;  3PEI A;  1HJZ A;  2JZD A;  1BPM A;  3EWP A;  4X2T A;  5FSV A;  4ZY1 A;  2AFC A;  2FG1 A;  3SIG A;  4ETJ A;  2W2G A;  5D8N A;  5DUS A;  2KQV A;  4R6T A;  4ZYQ A;  4J5Q A;  4J5S A;  5FSU A;  5HOL A;  2DX6 A;  2ACF A;  4J4Z A;  1LAM A;  2LGR A;  3H8F A;  1TY8 A;  2FXK A;  4R7M A;  3EWO A;  3Q71 A;  4J5R A;  5CB5 A;  4UML A;  3SIH A;  5AIL A;  3KQX A;  4K3N A;  3H8G A;  3GPG A;  1GYT A;  3VFQ A;  5E3B A;  2JZF A;  3EWQ A;  4ZY0 A;  4GVV A;  3EJG A;  2BFR A;  4ZY2 A;  4ZI6 A;  3GPQ A;  2X47 A;  3H8E A; 
#chains in the Genus database with same CATH homology
 4ESS A;  3IJ3 A;  3V2B A;  4JGK A;  1TXZ A;  4JCA A;  3KQZ A;  3JZT A;  3EKE A;  2EEE A;  1LAP A;  4KSI A;  1VHU A;  3IIF A;  1YD9 A;  2FAV A;  3EJF A;  3SII A;  3KR5 A;  1BPN A;  1LAN A;  3ETI A;  4JVV A;  4ZX8 A;  3Q6Z A;  1LCP A;  3IID A;  4ABL A;  5FSY A;  5CMS A;  5FSX A;  4GUA A;  2BFQ A;  3T8W A;  1NJR A;  4JLL A;  2XD7 A;  4R76 A;  3KZW A;  5HIH A;  3SIJ A;  4ETK A;  3EWR A;  4IQY A;  4ABK A;  4ZX9 A;  4K0C A;  3JRU A;  4TU0 A;  2VRI A;  2J9A A;  3EW5 A;  4KYB A;  5CB3 A;  1BLL E;  3GQE A;  2L8R A;  4GVW A;  4D86 A;  1ZR5 A;  5CBM A;  3KR4 A;  1ZR3 A;  3GQO A;  3GPO A;  3V45 A;  5FSZ A;  2EWB A;  1SPV A;  3PEI A;  1HJZ A;  1BPM A;  3EWP A;  4X2T A;  5FSV A;  4ZY1 A;  2AFC A;  2FG1 A;  3SIG A;  4ETJ A;  5D8N A;  5DUS A;  4R6T A;  4ZYQ A;  4J5Q A;  4J5S A;  5FSU A;  5HOL A;  2DX6 A;  2ACF A;  4J4Z A;  1LAM A;  2LGR A;  3H8F A;  1TY8 A;  2FXK A;  4R7M A;  3EWO A;  3Q71 A;  4J5R A;  5CB5 A;  4UML A;  3SIH A;  5AIL A;  3KQX A;  4K3N A;  3H8G A;  3GPG A;  1GYT A;  3VFQ A;  5E3B A;  3EWQ A;  4ZY0 A;  4GVV A;  3EJG A;  2BFR A;  4ZY2 A;  4ZI6 A;  3GPQ A;  2X47 A;  3H8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...