The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
184
|
structure length |
184
|
Chain Sequence |
MGHVLQLESASDKAHYILSKDGNRNNWYIGRGSDNNNDCTFHSYVHGTTLTLKQDYAVVNKHFHVGQAVVATDGNIQGTKWGGKWLDAYLRDSFVAKSKAWTQVWSGSAGGGVSVTVSQDLRFRNIWIKCANNSWNFFRTGPDGIYFIASDGGWLRFQIHSNGLGFKNIADSRSVPNAIMVENE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of the receptor-binding carboxy-terminal domain of bacteriophage T7 tail fibers.
pubmed doi rcsb |
molecule keywords |
TAIL FIBER PROTEIN
|
molecule tags |
Viral protein
|
source organism |
Enterobacteria phage t7
|
total genus |
44
|
structure length |
184
|
sequence length |
184
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2011-09-12 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; | ||
Mainly Beta | Single Sheet | Glycosyl hydrolase fold | Glycosyl hydrolase fold | ||
Mainly Beta | Sandwich | mini-chromosome maintenance (MCM) complex, domain 2 | mini-chromosome maintenance (MCM) complex, domain 2 |
#chains in the Genus database with same CATH superfamily 4A0U A; 4A0T A; #chains in the Genus database with same CATH topology 2XP3 A; 5C8B B; 3TDB A; 2YQ2 A; 3LKX B; 1F8A B; 1RP5 A; 2XP4 A; 2E45 A; 4QIB A; 4REX A; 2YSI A; 3MCB B; 2MDI A; 2ZR4 A; 1PIN A; 1K9Q A; 2XPA A; 2YAJ B; 1TK7 A; 1NPP A; 3LD7 A; 1EG3 A; 3FSB A; 2WAE A; 3KAF A; 3NTP A; 3LE4 A; 2WAD A; 5E64 A; 2Y8N B; 2YSF A; 2GDV A; 3TCZ A; 2L4J A; 3L4H A; 1TR8 A; 2KXQ A; 2JXW A; 4U84 A; 3KAH A; 4A0U A; 2OWO A; 5CQ2 A; 3M85 A; 3MCB A; 3KAB A; 2F21 A; 2XP7 A; 3PQH A; 3WH0 A; 2M8J A; 3FS8 A; 1EG4 A; 3OOB A; 3KAD A; 2ZQS A; 5U47 A; 1JMQ A; 4U85 A; 3WIT A; 2ZQV A; 3MQH A; 3M7N A; 4ESN A; 2ZR6 A; 2ZQU A; 5E62 A; 1YW5 A; 3ODK A; 5E66 A; 2M8I A; 5AHT A; 2YSG A; 2EZ5 W; 3CNG A; 2XP9 A; 3LKX A; 3MQG A; 4GLX A; 2KPP A; 2XPB A; 4OBI A; 2XP8 A; 4E5R A; 5E5W A; 2JV4 A; 2DMV A; 2ITK A; 1K9R A; 2RE3 A; 3KAI A; 4A0T A; 2YSB A; 2ZQT A; 1M1H A; 1R7A A; 3KAG A; 2QRV A; 1FLC A; 3FSC A; 1M1G A; 3KCE A; 4U86 A; 1I5H W; 3TC5 A; 5E65 A; 1WR7 A; 2DK1 A; 1NMV A; 2JMF A; 2M3O W; 2DWV A; 2DK7 A; 2ZR5 A; 1O6W A; 2XP5 A; 2GDU A; 2YSH A; 1WMV A; 2XP6 A; 2BA1 A; 1ZCN A; 2ZAJ A; 2Q5A A; 2DJY A; 1NPR A; 2LAJ A; 2JX8 A; #chains in the Genus database with same CATH homology 2XP3 A; 2YQ2 A; 3TDB A; 3LKX B; 1F8A B; 1RP5 A; 2XP4 A; 2E45 A; 4QIB A; 4REX A; 2YSI A; 3MCB B; 2MDI A; 2ZR4 A; 1PIN A; 1K9Q A; 2XPA A; 2YAJ B; 1TK7 A; 1EG3 A; 3FSB A; 2WAE A; 3KAF A; 3NTP A; 3LE4 A; 2WAD A; 5E64 A; 2Y8N B; 2YSF A; 3TCZ A; 2L4J A; 3L4H A; 1TR8 A; 2KXQ A; 2JXW A; 4U84 A; 3KAH A; 4A0U A; 2OWO A; 5CQ2 A; 3M85 A; 3MCB A; 3KAB A; 2F21 A; 2XP7 A; 3PQH A; 3WH0 A; 2M8J A; 3FS8 A; 1EG4 A; 3OOB A; 3KAD A; 2ZQS A; 5U47 A; 1JMQ A; 4U85 A; 3WIT A; 2ZQV A; 3MQH A; 3M7N A; 2ZR6 A; 2ZQU A; 5E62 A; 1YW5 A; 3ODK A; 5E66 A; 2M8I A; 5AHT A; 2YSG A; 2EZ5 W; 3CNG A; 2XP9 A; 3LKX A; 3MQG A; 4GLX A; 2XPB A; 2XP8 A; 4E5R A; 5E5W A; 2JV4 A; 2DMV A; 2ITK A; 1K9R A; 2RE3 A; 3KAI A; 4A0T A; 2YSB A; 2ZQT A; 3KAG A; 2QRV A; 1FLC A; 3FSC A; 3KCE A; 4U86 A; 1I5H W; 3TC5 A; 5E65 A; 1WR7 A; 2DK1 A; 1NMV A; 2JMF A; 2M3O W; 2DWV A; 2DK7 A; 2ZR5 A; 1O6W A; 2XP5 A; 2YSH A; 1WMV A; 2XP6 A; 2BA1 A; 1ZCN A; 2ZAJ A; 2Q5A A; 2DJY A; 2LAJ A; 2JX8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...