2YQ2A

Structure of bvdv1 envelope glycoprotein e2, ph8
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
332
structure length
332
Chain Sequence
TGCKPEYYYAIAKNDRIGPLGAEGLTTVWKDYSPEMTLEDTMVIASCRDGKFMYLSRCTRETRYLAILHSRALPTSVVFKKLFEGQKQGDTVEMDDDFEFGLCPCDAKPIVRGKYNTTLLNGPAFQMVCPIGWTGTVSCMLANRDTLDTAVVRTYRRSRPFPYRQGCITQKVLGEDLYDCILGGNWTCVTGDQLQYSGGSIESCKWCGFKFQRSEGLPHYPIGKCRLKNETGYRLVDNTSCNREGVAIVPQGTVKCKIGDTTVQVIALDTKLGPMPCKPYEIISSEGPVEKTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords BVDV1 E2
publication title Structure of a Pestivirus Envelope Glycoprotein E2 Clarifies its Role in Cell Entry.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1
total genus 55
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yq2A02
2.60.320.20 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 mini-chromosome maintenance (MCM) complex, domain 2 2yq2A01
4ILDA 2YQ2A 2YQ3A
chains in the Genus database with same CATH superfamily
1DQMH 2JLLA 5ELIA 3FB7A 2ADGA 2FVNA 1CDGA 1OWWA 1S9YB 4G8IA 1BOGA 1AO7D 2NMSA 2HJFA 4Z7VE 4CADB 4JKLA 1BFVL 3SCMC 2WNKA 1FV1B 3EG9A 2DLEA 3PWLA 4LDOB 3QDHA 4AGOA 3IGKA 1UXMA 4G5ZH 3B7TA 3BAKA 4AKQA 7PCYA 1UZ8A 2DJSA 3PHOB 1E90A 5I73C 2CGYA 1GRWA 5AOKA 5IR1A 4KO6A 2VDPB 1RU9H 4F8TA 1S5HB 3H4FA 5I0VA 2CO6A 2QHRH 2BXYA 1RZ8B 3UDWC 1RMFL 3WKMH 4S1QH 1GC1C 1DSFL 1QPXA 4FYQA 3O45A 3NIFF 4JFEA 3Q1EA 1YEFL 1BXVA 3DTUB 4IBTA 5AYQA 4HKJA 2D7OA 1EK3A 1KTCA 4ZTPH 5JHDB 3MBEB 4UINL 3W0WD 5A7EA 1DCLA 1JZ6A 5EEVA 1LK3L 1WBZB 3IJYA 3GTVA 4LRIA 5JUEH 5BW7A 4LVNB 5HPMA 5DQDH 3DROB 3IYLW 3OF6D 3OKLA 1NGWB 3MYJA 3UYRL 3FRUA 4CKVX 2WPGA 5C0IA 1LQSR 5FCUH 5EU3A 5ANMA 1RHHA 4YVUA 4NRXA 5F7YC 3BLBA 3VMOA 4Z7AA 3IXAA 4GKNA 2WBWB 3OZKA 4P9HH 2GCYA 3OZLA 3WKQA 3BGMB 1R9FA 1PVHA 2ZOTA 2CUAA 4AMKH 2ESVA 1GIGL 1MWAB 4F37K 2WV3A 4QRPA 2EILB 4PJ5A 1P5VA 3IDJB 3L6FB 3T77A 1XF2B 3BP6B 1ZVSB 4J23A 4QXUL 4AMWA 3KLHD 2H1PL 1A6TB 1T6WA 2V9TA 4ZTOL 1KY6A 1KT2A 1FRGL 3KEHA 4V2BA 5E4EB 1K2DA 1T4KB 5INCA 4HHWA 1DYZA 3MAWA 1B0GB 3APMA 2GK2A 4S2SA 4AE1A 2BERA 2ITFA 2XPZA 5IY5B 4F92B 4PM1A 3FHAA 5JHDD 1P69B 3EJUA 1MQKL 4ONFH 4LCYA 4NO3A 2YGVA 2K4WA 4LDLB 1CO1A 4N6QA 4U1LA 1YYML 1YO4A 2EXSA 3MR9B 4TLKA 5DFVD 2C9PA 5T1LA 4P99A 3EDEA 1IB5A 4H1LA 2EYTB 1KJMA 3TEWA 4FG2A 5T3XD 1FZMA 2WINB 1ONQA 3CBRA 4NC1E 1EJFA 3BPLB 5CEXA 3O0RL 3L7FA 2CK0H 3TESA 2A2QT 1Z2KA 3HN8A 1E8WA 2BS8A 3CN1A 2F5AL 1XF4B 4NENB 1QLEB 2NZ9C 4KK5D 5BQDA 4FFZL 4QHPA 4ZAKA 4A6YH 4HK3J 4RISL 5IBTL 4CMHC 1BZEA 4L9LA 2WUCH 4OF3A 4YHNA 2F08A 1J8HA 4Z7VB 4A2HA 3U6RB 5B38G 3U0TB 3IGLA 3BYYA 5LBSA 5D7JB 5I1HH 3MRRA 2F18A 5KANI 4PGEA 4Y5VB 3IDNA 5C9KA 1A4KB 1IX2A 2WQXA 1MH5A 1B4JL 2YJQA 4IOIB 4OFPA 5KVDE 3M8OH 3GNML 1TENA 4IK6A 4JUTA 1YY9C 1T2QL 4K8RL 4TUJB 4ADJA 1EO7A 5I9QB 2EIMB 1FCCA 4UAOB 1K4CA 3FO9B 4UBDD 4NP4L 5BS0A 5HI5D 3TJHD 3MJGX 5KSAC 4NKIL 4NP9A 1NUDA 3WNPA 4WWKA 4OBRA 2EDXA 1NANH 3H9HB 4U1KB 2GHWB 4AYFA 3LRMA 3RFRA 1EVTC 5HHQA 1A9BB 4GP8B 3QZWG 5CP3A 1OF2B 1SBBA 3TWYA 1AZUA 2J6EL 4NZTH 4S1SH 1IEBB 3ZZLA 1OP5H 1E3FA 5SV4A 3V0FA 1UA7A 5GS2D 4LSUL 4EF3A 3LIZA 1KJ3L 5E00A 5JW3H 4H5SB 4HUUB 4YDIL 4KKAC 3TPKA 4HWUA 5D7JD 1BQLH 1XGTB 5FFLA 2R0KH 3BI9X 3CDYA 1PZ2A 2C9RA 1EAPB 1TCRB 3CXHJ 3HZYA 4F15B 5I2IB 2FJGA 5AWNH 5J1AB 1NUNB 4M7LL 2Y06H 3KYNB 1XCWA 5E1QA 1I9RH 2BDNH 3EKCA 3LS4L 2FATL 5FYKH 5MENA 4AV5A 3VH8G 5C8JB 4P9ML 1T7YA 3KCPA 3AXHA 4FADA 5B39A 1I3GL 3O2DL 4HU2A 1C1EL 4IRSC 3UO1H 1AR1C 1N64L 2CSPA 4HPYH 1P6FA 4HKBB 3WNMA 3FQUB 4NQVB 5C07A 7PAZA 4G59C 5E1HB 2WVSA 3NSXA 4XMVA 2Z9TA 4U3CA 1F02I 3IJ9A 5A43C 3QSKB 1RZFH 4WHTB 4XO9A 4HS6A 4Z78B 3DX7A 3ILPA 3QHTC 1S9VA 2QPSA 4WW1B 3QDGA 4MJJA 3ZO9A 4EIZC 2YJLA 1IJ9A 1IGML 1V54B 4MS6A 2EYRB 1X7SA 3K80A 4K5PA 3N1QC 3WO4B 1EJOL 1Q0XH 4GQ9H 3AS0A 1T83C 4L8SC 3WUWB 3V79C 2E59A 2QSTA 1VZIA 1NAMA 1TZHA 2HRLA 4FRWA 2CR0A 4W4OA 3VGHA 4ZXBA 4JDZA 5LCVA 3QG7H 5EEWA 1BAFL 4KX9A 4R84A 5DSCB 3D33A 2Y9RT 3GSRB 3P0GB 4J8RB 4MTMA 1T04A 2BWDA 3MJ7A 2W07A 2N4IA 4IQHA 1YNTF 1ZHKA 4ZW8A 4IGBC 2GEQA 3DX8A 2I24N 1UCTA 3HG2A 2DM4A 4MASA 2I85A 3KEDA 4PWJA 4B5ZA 4LPCA 4QF1B 1IBGL 2XLLA 4HLZG 5I1LA 5F6HJ 2KLSA 3TTSA 3QISA 3TX4A 3ARDA 1J8RA 1MCOH 4EVNA 2IAMB 5A6IA 5HHPA 1A6AA 3T3MF 2DEWX 3NCJL 4TS6A 1NCBH 1XGYH 2VMDA 5F1NA 4I9WE 4L5FL 5ETUA 4UTAL 2IJ0C 1FZOA 2JIXA 4BWWA 2YQ2A 3EOBA 2YXVA 4DTGH 2H9GB 3D9AL 2K45A 5DJZB 3CFKA 1CI5A 4Q9RH 3OHMB 3T65A 3WTVA 1R3JA 3JUYA 2BP5M 1L7TL 3GKWL 5AL0A 1Q9WA 3AC0A 4PV9B 3UG4A 3L4UA 3BWUF 3LNFA 3OKKB 3IKCB 4G6MH 5F1OB 5HHME 5LNGA 1OSZB 2AVGA 2H0JA 4N5ED 2NXYC 2BY0A 2VITA 1JPFA 2OULB 1UTDA 1P1VA 3ALWA 4XPGL 3V0WH 3IDYC 1QQDA 1SFHA 2X0VA 3N3EA 4DP5X 4KY1H 4NQEA 4YJZL 4KY2A 4PJEA 1AGEA 4LZKA 1BWWA 1OE1A 1M1GA 3ZRFC 1CVSC 3NDZE 2EEFA 5EEZA 2DDQH 3HS0C 3GHBH 4RNRB 2EDDA 2NUPB 5DRXB 1EO8L 4FFYH 5HGHA 4MXVE 3Q13A 1NEZB 1NLDL 1OEZW 2COQA 3L45A 3NH7H 4PQXA 4Y4HA 4JLRA 2QQKH 2MEJB 3ZRSA 1M1HA 3SODB 1R3LA 4AEHL 3FCBA 4I1NB 2X3CA 4MWFA 2IEPA 2Y2TA 5KS9E 3CHPA 4MMZC 4N2OA 1OCZB 4Y4FB 3WHE1 5C0RL 1U91A 4GI8A 4F37F 2BSEA 3K0WA 5KG9A 2PO6A 3S34L 5I1DA 4OLVL 3T8XA 4WCYH 4U6VH 1P7QA 4H13C 1KENH 4WUKH 5DRNB 4NUQA 5C3LD 3F7KA 5TDOB 2DJ4A 3MO1B 3ULUF 2OMXB 1Z66A 1KPUA 3KBHE 3MJ9A 3OLDA 4PD4J 1K3IA 1KOAA 4GQQA 4JQIL 3WN5C 4BDVB 5JQ6H 1S7SB 4YDKH 1O9WA 1N6UA 4FYSA 2ZXCA 3G5XB 5A16A 1O5DT 2G2PA 3A3YB 4TUOA 2A73B 1EANA 2AEWA 2F5BL 4E5XB 4KK6D 4PJIE 4WV1A 3LZPA 5DVKA 1MAKA 1AGDA 3BQUB 2QVTA 2ZJSH 3X12B 4Z3HA 4Q6YA 5KEZA 4W70A 3HG1E 2V33A 5BXFA 2CO7A 2YKLL 4F2EA 1YEEL 4S0TD 1TT6A 1OGAA 5J0BA 1ZLVH 4NIYE 3LHAA 2VM4A 4OZHE 4Y4FD 2DLGA 3V4VB 3RRQA 4BWUA 2XZAL 1KB5L 1J9TA 4PJ7F 2V2XB 2F74A 5KVFH 2CUHA 2XQYG 2ZOUA 4YL4A 3WEAA 2CDEA 1RULH 2LW3A 3K1DA 2IANA 2VR8A 4JHWH 2EIDA 4PVNA 4R2GB 2QGBA 2YPLA 5HJBA 4F7TB 2B1OA 5JIKA 3IDIA 1AHWA 3I85A 2CJUH 5J13C 1DJZA 3BAYA 3FQNA 4X8XA 1DBBL 1NGQL 5DT1H 1YA5A 3BWAA 5HHMB 4XTRC 3WNOA 1JVLA 4AQEA 2P5PA 3R4DA 3OPUA 1G7QB 4OTXL 2LQRA 3RE0A 2PR4H 2X4OA 4H8WC 3EJZC 3LNDA 3BQUD 1LDSA 2KERA 2OM5A 2X53A 4U1SA 5SX4I 3HI6L 4DHLA 3LXBA 4LKCB 1ZDQA 3GXMA 1JP5A 4JG1H 1J05A 3GO1L 4CSTA 1HHIB 4U6HA 3OXSA 3WS3B 3U48A 4PJHA 1MN4A 4F1ZA 2HVJB 2OMZA 2ZG3A 1S7VB 4OZGB 5AVQB 4FXGA 4Z7OF 1BLIA 1V10A 4I9WD 2YO3A 3HG3A 4OLWH 1XZWA 1R75A 2XNAB 4KKLC 8FABB 3MLZH 4R2GD 4A04A 4GRMA 3D3VA 2OZ4H 1FHNA 1R5VB 2JKWA 4OLYH 3U4EB 5EC1B 2NW2A 1KJ2B 1N10A 3QJFA 5BZWA 5HHMD 1MJJB 3FQ4A 4POUB 4XBEL 5E7FA 5E4AA 2JKXA 5DUBA 2VL5B 3RWEA 4X9GA 2A6DB 4I9XA 1WZLA 3E2HB 3QUKB 4X7EC 4ZQKB 3BE1H 1U95B 2JXMA 5GRVK 5G2NA 2BK8A 1WPCA 4GSDH 2QPFA 5D2NA 4YLBA 5DJAB 3SIKA 4AYSA 4NZRH 1UOKA 5F7NC 3QPQD 2FGWL 2X4QB 4YHLL 1EEUA 1ETZA 1M9SA 2BS9A 1AGBB 2LHAA 4HW6A 4WW2C 1F3RB 5EUKA 3OGCB 3W9EB 2VLLA 1LMIA 4MCYA 3QUMB 4UM8A 1VFBB 1FBIH 3QCVL 1OSYA 1P4LA 4Y16A 3SE8H 2PW2B 3UC0L 4ZDHB 1OWRM 1LO5B 3AWEA 1CFBA 3HFML 2XA8H 3S97C 1GYAA 4PYGA 4HSAC 3TBWB 3US1A 2LU7A 2ZCKL 3E9TA 3O8XB 1H5BB 3ARFD 3HZKB 5F7KC 3QEQB 5IVOA 2IGFL 4YXHH 4XODA 1HTYA 4N8VB 3IFNH 4WK0B 2IDQA 1V8HA 4K4KA 3OL2A 1FGNH 2I25N 2WAHA 2F19H 2GJZB 4GQZA 3Q8CA 5FYKU 3TURA 2IADB 2EDFA 2EDBA 4S1DD 4JM4L 4Z7WE 1JXJA 1YPZE 1RLWA 3QWRA 3DC0A 4YUEL 1M6OB 2HPOA 1BJMA 5LBGA 3PLYA 3O9WC 3HI1A 2IGLA 3S6CA 3DUHA 5F0JB 2DWXA 3BZ4B 2VDQB 2VISA 3IS1X 5FA4B 1INDH 2KQNA 4G7SB 2BCKB 2O26U 4OW6A 1XGRB 4JZNA 5EZIH 2DYPB 5ITBL 1Q9KB 2BVQA 4KH9A 4UQ3A 3ARTA 4DZBB 4E36A 4YHOH 4NWTL 3SE9H 2E3VA 2W5PA 1SNRA 3NCYP 5EO0A 3OMNB 3HG1D 4R4BA 1J87A 5EUOF 1XB8A 1M3IA 5F7BA 1JGIA 4O2FA 2OMBA 1BVKA 2Y7LA 3UAAA 3QO1A 5ALBH 4IK7A 1T3FA 3GMNB 4ZMQA 1X9UA 5I8OH 1OQOA 1IL1B 2OYPA 1TQBC 3DO7B 2H0EA 4AGLA 1G4RA 3IT8D 5FO2A 1TIUA 2CUMA 4WIQA 4U1JA 3NIDF 2VXTL 4JJHA 4XWGH 1JK8B 4WO4C 4NBXB 4L1BA 1U4EA 4NNPH 5A2JH 3CZLA 1E40A 4GUPB 4EUPG 2IDUA 2X6BA 2E75C 5KYXB 4G43A 3JWNG 1AC0A 2D0HA 4TVPL 1WAAE 1THCA 2H3XC 2X4PB 1XTMA 3W38A 3RY6C 1OZUA 3L4YA 5GGVH 1IEAA 5EIQA 1BZDA 2XZCL 5A2KH 2J2ZB 4EN3C 1ET8A 4G80A 5F88A 4WK4B 1S7UB 3FO1A 5EBGA 1KCBA 2DQEH 4KMTL 4JFOA 4YWGL 1HEZB 1MAMH 3KVPA 1IU1A 4Q2ZB 2VH5H 3L1OL 3LKOB 5CGBA 1TETL 4QHKJ 2WLMA 5K1VA 3PFUA 1B9KA 3QUMH 5D7LA 1QACA 4I48B 1UGKA 1V7ML 1PKQE 4KXBA 3RUGF 2WO4A 4PRNA 4C57C 1FH2A 4PFEA 1P4IH 4FNLL 4BWTA 2Y36H 1NGPH 2QR0B 4H1LG 2BP8A 3MN8A 1GKEA 4ZOAA 5G4MA 3U7WH 2AF2A 1BG9A 3O3UN 3IBOA 5SX4H 1AGFB 1QX1A 2LABA 3WI9A 4HUMB 4JW3A 1HE7A 1OAYH 2VDKB 5SWSE 1HNYA 3Q2CA 2O61A 2UWEA 4JCMA 4UF7C 5I18L 1FA4A 3NFSH 4L1LA 3F8UB 4FTVA 4Z0XB 2Z8WC 3IDMB 2QQLL 1G6RB 1AS6A 3MA9H 1W0WA 3LXUX 3EGXB 1YPZB 4ANUA 1B4TA 1N59A 4M61B 4F9LC 5JPMB 4KJWC 4PRPA 4Y2DB 2ZKMX 2DMHA 3L3IA 4AUYA 2I9LB 3PGFL 2Y3AA 1KXVA 1V55B 1I4FA 2F58H 2HMID 1PZBA 5I1CH 1T1YB 4RFEB 5LAXA 4A0UA 2L3BA 2HRGA 2OL3L 1OCWH 5I1AA 4YGVA 1S9WB 5IMMB 3P77A 3DIDA 5AW1B 3UPCA 5ACZA 1KGCE 4GAAA 3RFZB 1VAHA 1TCMA 4HD5A 3ZSSA 3MV8B 5C09B 2WNWA 3LRSB 4KZ0A 1P9MA 2AK1L 3GUTB 4Y4KC 1GVIA 2FWOA 3T4AB 3T2NL 2PXYD 2YZ8A 4IDJH 2EE0A 2YD1A 4BXSV 4MQSB 5IGXL 5IB4A 5IQOA 1HI6B 1CGXA 1H8OA 1XXDC 3SKMB 3EZ8A 2JF1A 4XCCL 4JEGB 3Q0HA 5DZOA 3F3HA 4U1GC 4U3SB 3D4ZA 1NC2D 3S88L 3RU8H 4Y2OA 5E94B 1UWXK 1U3HA 4O51A 2YXWA 4G7VH 4YX2L 3SPVA 4UILH 5HYIA 4PREA 5KBNC 4XHJC 5B1AB 2EVIA 1V3MA 5ADPH 1SJHA 3KAAA 4KAQH 3QZMA 4OZFB 1JV2B 4W9KC 4G83A 3HC3L 4AQ1C 4P5SA 2D7TL 3EYVA 4OJEH 2H2SD 2J57A 4WNSA 5GIRB 5B8CA 3FQYA 3UJTL 4YNYA 4HJ0D 2WJ7A 4MNQA 1NWOA 3A6CH 1UXSA 3DTXB 2J8UA 3THML 3WU1A 4IKJA 1VGKA 4MMXB 5B1JA 1QWNA 2RMNA 3QDAA 4HK0B 1YVLA 5E5MA 3PWNA 1NOFA 4O58H 1HINH 4ELKA 3ISWA 2Z92B 5GRJL 4ZOEA 1CMOA 3IK2A 3GM0A 1F8TH 3DX6B 1RH8A 3LZLA 2O6PA 4FFVC 4M62H 4JAMA 4NHUB 4BFIA 1YMHA 4G6KL 4BZ2H 1JZIA 2YMXL 2LT9A 2OJZL 3SCMB 1HFUA 4XPHH 4PG9A 4R9HA 2K3TA 5GS3A 3MNZA 2R69H 4ANKA 1QBMH 4KGLA 5DYFA 4LPTA 4MAUH 4FS0A 5JXED 4N2CA 3IXTA 3JWDC 1RSFA 3EIFA 1Y7VA 2Q8AL 2FSEA 2ITDB 2BNRE 1UGNA 1QYGH 1R19A 2N0MA 5J6HA 2KDYA 1ZY9A 5DD0L 5DWUH 5C0EB 2DZEA 1VEOA 1F6FB 4GO8A 2XV0A 4PW3A 2LLGA 4UQDA 3VUAA 4NDMB 4KX7A 3VM7A 1EBAA 3BJLA 3CIQA 2AEOA 2FLMA 4L8BA 5E8EA 4ZUTB 3JYCA 4JPVL 1QFUH 4Q6KA 3LZQA 1EHKB 1S3RA 3B9KC 3ZX1A 2VDMB 4LNRB 2ZCLL 4C4BA 1GOGA 4WI7A 3HC0A 3T6ZA 2LU3A 1XSIA 3AG4B 3OGOE 4PN6A 1JZHA 2WMPB 1FLTX 3M88A 4XP9L 1Y07A 3ESOA 5E8NA 1Z3GH 3H56A 4IMKC 3RWFB 5JIIA 5IB2B 4LVEA 3TA3A 2DQDH 3BLPX 3SCMD 3IETB 2ZXQA 5DK0A 3RKDD 3CXDL 3PAZA 5D93B 5SWSD 3K3QA 4ZI8A 3DUUB 2CXKA 5DVNA 2ZXBA 2F7QA 2YK1L 1I1AB 1BQHA 4MJIA 4P23A 3QDJA 5DHYA 4AOFA 4Y1AB 4FQXA 2ZT9C 4OZFH 1G0DA 3O4LB 5D4JA 3FT2B 4L5FE 3FSZA 5L7XL 4RMBA 3KPTA 3K6SA 1LWJA 3JWDL 4H0GA 3RDTA 2PWEA 1Q0YL 3BEVA 3SO3C 4O00A 1CFNA 2ZOOA 1EHLH 1T1WA 3UP1A 3VFSB 4A7GF 3CHRA 1GJUA 1KGCD 4Z0BL 3FT3A 3PHAA 2EINB 3O3DB 3OJDA 3CZSA 4QMEA 2HB0A 2MPAL 1CLYL 4P46C 4WKXA 4YE4H 3HPLB 4X7CC 4K7PH 1NLBL 4TKWA 5HHVH 1MUJB 2WZAA 5ESAB 3T2LA 3BSZL 4BV1A 1A4AA 1QEWA 1XGPB 2AK4B 4J28A 2FZ3A 3AY4A 1MLBA 2C9AA 4QY8A 2GC4C 4B9IA 3NCWA 5C71A 3VB8A 5LG1A 4AQ8C 3VXUA 4AENA 3M1OA 4JMNA 4MXWH 3L13A 1J5HA 3MLUH 1FFOB 3TC9A 1JYXA 1DP0A 5MERB 3TZVA 5MEOB 4N0YL 2BJMH 4O2EA 2HRPH 4Z3FA 4X5LA 5KJRL 4UTCA 2YUXA 3T04D 5FM8A 4ZMOA 1MG2C 4WI0B 1MDTA 1NWPA 2K9UA 3DETC 4UZGA 5I5RA 5DK2B 3MCKB 3RIAF 4K94H 3VE0B 3MRDA 2HZHA 3V8OA 3VACA 2CJTA 4JM2A 3UG3A 1IAIM 1O6TA 5GPRA 2BNRB 3KLAB 5C0DB 2TSBA 5I6XC 4K3DL 2ZIDA 3L5WB 1LP9A 5KSAB 3CVHA 1MCNA 1UKSA 2O6FA 5JIQA 4KJPD 4ODWA 1MFEL 2EIZA 1HSAA 3IB4A 3T8MA 5DJ2A 1H0DB 4RGNC 2VE6B 5F6IB 4F3FA 1A6WL 4UUJA 3KYAA 4QRSA 1VKXB 2NZ9D 2CAKA 2R2HB 2ARJQ 1CTNA 3NEEA 4LNVA 1F0LA 2YIHA 4HUKB 4P2OB 4N0UA 4RRPA 4GBXA 5TE7L 3NQKA 5E1AA 3CWGA 1AY1L 4OCYL 4OIIH 3SGEI 5F7UA 4Z7UB 1KIRA 4TQ8A 2BFVL 5HY9A 4F1SA 3T09A 1MFBL 4WJ5B 3R0MA 1S78C 1XGUB 2MTPA 4DGIH 4F2ME 1X4ZA 2CDGA 4JFEE 1VIWA 3NP3A 1A4CA 1PLCA 1YY9D 4EKJA 4JL2A 2CUIA 1CJYA 1GAFL 2BNRD 2C9VA 1V7NL 5DJ0B 2TRYA 3VRJB 1ZGLA 2X4TA 4KTDH 1AR1B 4JRXE 5KSAD 1U8LA 2EDKA 2YA1A 1WZKA 2O93L 5JHMA 1F2XK 4OJAA 2R2BA 4JHVA 1EJ6A 1IVLA 2UYLB 1F3JA 3Q2NA 4I0PC 2NY0C 3UZQB 4M6MH 1SLXA 5KYWA 5F1IB 3ILQC 3NACH 3AJ7A 3K7UA 4XNMB 9CGTA 4B95C 2X2JA 3R4RA 3N41F 4JPWL 2ESVE 3OHXA 4AYDC 1QR1A 1ZGLM 4QHUB 1TZ8A 4L8SB 5HHXH 4KKAD 1T22A 4JKPL 2ARJB 1RJZB 5C0GB 5DJ8B 3BX7C 4DEPB 5J6GA 4EZMA 1JDAA 1F6LL 2D7QA 1CICC 2HFTA 3ZL4H 3HRPA 3RVUC 3B7SA 2CBPA 2WTPA 4PYHA 1JF1A 3QRGL 3LN9A 4JFYA 3L3HA 2AKRB 4TNVK 2ICWA 2F7PA 5D7IF 4FAAB 3RX7A 2YD6A 3FN9A 2DQFA 3T6VA 2P26A 4PJXE 1ZEAL 1UXWB 4IGBB 1WD9A 3F65A 2Y7NA 1AR1D 3OR6A 3I50H 4QAMB 5D96B 2UZXB 3PHQB 4QXVA 5HHOE 4DAGL 2QQNH 3GSNL 4HFWA 5L2KA 3N55A 2NY1B 4NAQA 4G6AD 3ZPDA 1YUHA 6CGTA 1N68A 3ZDXF 4NQXA 3WTYA 2DMCA 2ED7A 3FCTB 4W6WB 4A68A 4AKOA 2B20A 1U3YA 1J0HA 4YZFF 1IFHL 1M2VB 2AGJL 2C1PB 1P5UC 5CWSB 4GRLC 1H6TA 1IGFL 2UY7A 2N56A 3WUWG 3VFPB 3VTTA 2VC2B 2ADGB 2CNZA 4WI5A 3NA9L 2E7LA 4G8IB 1XF1A 3VFMA 1YYCA 3HG0A 4NCDA 1ORQA 4C58B 2JJSA 4WSJA 2YQ3A 2HT4C 1CR9L 2XWRA 3EG9B 1JI2A 3PWLB 3QI9A 1I31A 4IOSD 3VFVA 1K4DB 1NBYB 3L95B 2B3RA 4KRMB 4R5TA 4W6XB 4S0HA 4IJ3C 5I0WA 2K70A 2VMFA 2YRLA 5IR1B 3CK0L 4IGBD 1P84J 1TYJA 1NOLA 4NUGL 2JCWA 3VFRA 3KH3A 3TA4D 2CO6B 1JMZA 5AOIA 3ZE1E 5AVYB 1SXAA 4GXVH 2R2EA 1OHZA 3ZUNC 5ABAA 3H8NA 4N5UA 2LOEA 3O45B 4F2MB 4EI5C 4JFEB 1DDTA 1LE9A 1FORH 3QQNA 3UMTA 3PQYA 3K6NA 4PTTA 3PYCA 4DO4A 1DQQA 4WSKA 4W9CC 3U7YL 1HKLL 2AV7B 5AKVA 3SQOL 1VPOL 3IJYB 4MBOA 4JBSA 5J8OA 1DN0A 4HIXH 4Z3JA 4AVIA 2OTUA 5HPMB 5E2VL 1XIWC 4MA8H 2VYRE 3OKLB 3MYJB 4MJHA 4QNPF 3IJEA 5EU3B 5ANMB 2X6VA 1RHHB 4WTZA 4NRXB 2H3NA 3C6LA 1IC7L 4YH6A 1QO3A 2EDMA 1KXQE 3IXAB 4GKNB 4NZUL 2QPDB 2JTDA 2GCYB 5DQ9A 2WGNB 2XU9A 2EUWA 2GJPA 2ATPA 5KOVC 2ESVB 6PCYA 4QRPB 1WCQA 4PJ5B 4LDEB 3T77B 1U33A 1FNHA 4JCWA 4O4YH 4FKHA 4C83B 3WN5B 3N42B 1YEGL 3CH8A 1YY8B 3DUSA 4JFED 4NJ9L 4B3VA 4I89A 4YSOA 4M9OA 3HG5A 2YEQA 1AXTL 4XPTH 4WEMB 5HDQH 2ADFH 3EH1A 2J6EA 4HWBH 2EZ0C 1JFHA 1MRDH 4NO3B 5F71A 4OV6F 4U1LB 1BF8A 1CF8H 1IM9A 2ZSWA 3KLQA 2C8NA 3MV11 4HSCX 4WI3A 1E5YA 3AB0B 4ZX5A 1IIIA 1L7IL 2HH0H 1KJMB 4U7KA 4HG4K 1W6LA 4YR6A 4P5TC 1ONQB 3UEQA 4J3OD 1C7SA 5GGQL 5CEYA 3TBYA 1HXMA 5CEXB 1SOSA 4ELME 4GMSH 2WZ5A 1XO8A 2HG0A 1IC5H 2ESVD 3NAAH 1SRDA 1MRFH 3NJLA 4ZJ9A 1DQTA 1VFMA 4R4FH 3D0LA 2AQSA 1UOWA 1QSEA 4ZAKB 4FTDA 4L9LB 3UYOD 4D9QD 1WT5C 4YHNB 3TTYA 5IESL 5I1IL 1W80A 4TULH 1OT2A 2ERJB 4J4PC 1KBPA 2X2HA 3MRRB 4GB9A 4XXWC 2H0FA 4PGEB 4HWZB 3IDNB 4UOQA 2G3ZA 3IGFA 3G6DL 3IMUA 3B2VH 3MRJB 1TJGH 2H41A 4BCZA 1UQSA 1T80A 4J39A 1MIEL 5HHOD 1IBZA 1K4CB 4OI8A 2BVEA 2RQEA 2AITA 2XG4B 2FEJA 3ZXAC 3BKJL 2VN3A 4WWKB 2J73A 4LFHD 1BXXA 1R6VA 3V7AE 4AYFB 4LASL 2VQTA 5K39A 3DYMA 5HHQB 5FO7A 4TQPA 1N7MH 2MQ3A 1DQDH 4YSUA 5F8QC 3VQLA 4WU7A 3N04A 4P06A 4J3OH 3AS3A 1EFQA 5IQNA 3UZEA 2IXQA 4XP5H 3CE1A 1Z9MA 2IO5A 4RESB 2WLZA 4NCC2 1QSZA 5E00B 4Y19A 1UATA 4QT5A 3CSPA 1RY7B 4I2XA 4PJ8C 5H4ZA 4PBXA 1ZLUK 4XNBA 1LO4L 4OGQC 3KDMB 3QDMA 4U1NA 3OAWA 4TN9A 3TN0A 3B2UD 3EJZD 3IU4L 1GGYA 4G8EA 1VSCA 3E6HA 5FUZL 1SMOA 1T21B 3T08A 4H4NA 5IVXE 3KCPB 2ZKYA 2DIJA 5FO9B 4LLDB 5F7EL 2OXGB 4F8NA 5B39B 2ZUYA 4PB0L 2Z7ZA 1FYTA 1IBBA 2NY7L 1FG2A 4WFGE 4WWKD 5C07B 3LTVA 4Z7QE 4JO4L 4TNFA 3VA2C 4JREC 4WAFA 2R1YA 4H1LH 2EDOA 5I1GL 1SXBA 3UJIL 3VU1A 1IE5A 3DARA 4KKLD 4HS6B 4P2YA 2WKOF 1FE8L 3ILPB 1S9VB 3QDGB 5C2UB 3TBBA 4H88H 2AXGA 2H1LM 1PF3A 1A7QL 1TKWA 2AXFB 2QTVA 4XN5A 1XGQA 1OANA 1NAMB 3K8KA 4ZXBB 1ZANL 3FTVA 3C6SA 1EXGA 3U46A 4HOWA 3BN9D 5GGTA 3SEPA 1J7VR 1OW0A 2X7LA 5LBSH 3U2JA 3TM6A 5F8RC 2DIAA 5CU5A 1T04B 3MJ7B 2OYKA 3O9WB 3TO4A 3AZUA 1ZHKB 5FHAH 1GCFA 1G7MA 4NUPA 4FNTA 1UWXH 5C07D 2FWSA 4AL8C 4EVNB 3ARDB 1T5WB 5HHPB 1HNFA 1JGVH 4YPJA 3RWIA 1A6AB 3VGEA 3EJPA 2BIPA 1E4XI 1TPXB 4JQVC 4W9HC 4MCMA 5DJ6A 3LD7A 1C5DB 5ETUB 2G60L 2A9NL 2JIXB 1FZOB 4Y0GA 2XT1B 3MNVB 2WO2B 3RX8A 2HP4A 3L7EA 4X7DC 4X99A 2WM0A 3RZCA 5CCKH 1TJHL 3CFKB 2FQFA 2GJ6A 5CP3H 4Q9QL 5L4FA 4N8VG 4G5AA 3T65B 5ICYA 1R3JB 5A2LH 4YFLI 1JIBA 2DQIL 1UWGH 1CLOH 2CM6A 3D85D 3MPCA 4OCNC 5F93C 1FNGA 1QAWA 2IPTH 1Q9WB 2HAZA 3FQRA 3RNQA 5GXBB 3LIZH 2AJZA 3BKYL 5D9SB 4F80A 4WO4B 5CIPH 2PPEA 2K3HA 5BOJA 1AQ8A 4KVNL 1KELH 3K4ZA 1MW0A 4L3FA 2JI3A 2VITB 1JPFB 1IQDA 3OAUL 4LSQH 1LTXA 1UYWL 3O9WD 3QAZB 4OCXH 3HPJA 4E9QA 4AYBA 1NDMA 3SPGA 1CFQB 1XSOA 4L4TA 3WIFA 3WXWH 1UACH 5FGSA 5KSUB 3KR3L 3H2PA 3OMZA 3QCTL 1AGEB 4XAKD 2BW5A 5ICZB 4WHDA 1HZLA 1KB5A 2F1EA 5I76A 1BQHG 4YO0A 4PJAE 1HILA 3VI4E 5GISL 2I27N 3KPPB 3Q2VA 4X98A 5IVXB 2IFGA 3J07A 3FCGA 2HSIA 1SUHA 1JGEB 1MVYA 2R4RL 3LRGA 2PF6A 3LS5H 4AL8L 1AD0A 2XSKA 4JLRB 1Z3RA 4BHUA 4JNXA 1UT9A 4B41A 1R3LB 2DLFH 4V1DE 4Z7QB 5BOZG 5HVWA 5DLLA 3SGKA 5CJXA 4MWFB 2KDGA 4JHUA 3S5YA 2BC4A 1RK1A 5I26A 2YWYA 1U91B 1D7DA 2X88A 4QRUA 2Y7MA 3S36H 3G6JA 5KG9B 1RIVL 4WO4D 4I88A 1XB3A 4FQCH 4Q6IC 3NJNA 1ECZA 5I1DB 1PLGH 1NAMH 5DZLA 3GIZL 2FBJL 1P7QB 2NZ1A 5LCVH 2OZNA 6FABL 4AEIL 5I17A 2XOTA 4GRWF 1KPUB 4NUJA 1HYSC 1ADQL 3CBJB 3BH8A 3V9FA 1ASPA 2HWZL 2YRBA 1ZS8A 3SOTA 5A16B 4G6JH 4K0OA 1A6VL 4AQAA 3AXLA 1ORSA 4WV1B 3N43F 4H20H 1GYVA 1AGDB 1BP3B 3D34A 1CE6A 1A22B 3CFCH 3TNNA 2FT7A 2GT9A 1C5BH 2Z35B 1FH5L 2UX7A 5HVHC 1HCVA 3HMWH 5BXFB 4WFGD 1V3LA 1KFAH 2CO7B 2EH8H 1WZMA 3EJSA 4YHYC 1OGAB 3P0YL 4FQLH 2PWFA 3RVTC 4X5WA 2F8OA 1EBPA 3I2CL 2HJKB 3GBEA 4B9YA 1AH1A 3RJOA 3KNBA 5DC4B 2MOQA 4ZMPA 2F74B 4UDTB 4BCXA 2CDEB 2OP4L 2IANB 1A3RL 2RCSL 3A21A 1NUGA 1IAOA 4EBQH 2YPLB 4WUUA 3FB8B 4C56E 3SHSA 1MPAL 1AHWB 2JFCA 3ES6A 4YBLC 3FQNB 1J9SA 2D31A 2BZ7A 4XC1H 1WAPA 3D05A 3T0VA 3BWAB 5KBLA 1BPLB 1O7SA 4M7LT 4PLNC 4ZUWB 4KJWD 1E50A 1W0YT 2FB4H 3NZSA 2X4OB 3OPZH 4FCAA 4PJ9A 3V6OC 3VB9A 3ARZA 1TTAA 1EZUA 1KYDA 3J8F7 4OZIA 2PNDA 4U1SB 4M8QB 1ZRUA 4JO2H 3V52H 5L4MA 2H5UA 3M07A 3FFCE 3IJ8A 3MCLL 1IZJA 1J05B 1QFOA 3F12A 4K23L 4RMSA 1NL0L 4U6HB 3OXSB 3ZMNA 3ULVC 3EHBB 4PJHB 2FHFA 1IM3A 2OMZB 3LB6C 4LHJB 4OY9A 1DUZA 3IFOA 4Y4KD 1J8SA 3MLTA 1B2WL 3ROOA 3WKNA 5L9DH 1TXKA 3FUNA 2H26A 1Q1JH 4AT6A 2KS0A 5CD3A 4IEFA 4V1DB 4UT9L 4GRMB 3D3VB 4X6CE 1GS6X 3OB8A 3BT2H 3NCMA 1DVZA 3BXNA 4KUZL 3DMMA 1XZ0A 4K15A 4U2YA 4I77H 1FAKT 3DPDA 4R7VA 4YHMH 3RNKA 5KBPA 1FNSH 5BZWB 2FJSA 4L3CA 4DVRL 1NKGA 5CSZA 5DUBB 1E4XH 4K3JH 4MDJA 4YHZH 3RWEB 4LLQA 4A2LA 3MJ9H 4LSPH 4XHJD 1CL7L 3B1UA 3U2SB 2JXMB 4NERA 1L9PA 4Q56A 4P57A 4ZYKA 1UT1A 5T1JA 4PLKD 3HHRB 5EZLA 3KXFA 5D2NB 4HH9A 3FYEB 2ZYIA 5AYUH 1EH9A 5DJYA 2QSCL 1B0RA 1I9IH 4LHUA 4W6YB 4CSSA 1MFNA 1ETZB 1KCVL 4L4VE 1KXTA 5CJQH 1CD0A 3JBG7 5D7LE 2G4GA 3JV6A 1TQTA 5EUKB 5C9JA 3ETTA 2VLLB 1TTGA 3QJUB 3PL6A 4WO0A 4MCYB 5TF1H 3UOAB 3U0WH 4UM8B 5E6RB 1DVYA 3BP7A 4Y16B 4CDHA 1DBAH 3ULVL 1S2EA 3WFEL 3I9GL 3KLDA 2FYVA 4RGNE 1E4JA 4QTHA 4HOZA 1W72A 4G7YL 1JHKH 3IBEA 3QJQB 4V1DD 1MFMA 5IBUB 3CXFA 3FUKA 4MXVF 3AQZA 1X7QB 4FFVD 1OARL 2QDVA 4XVSL 4LVHC 5FM5M 2B3IA 2XY1A 4Y8AA 3H7BA 4ORGB 5EB9A 1GGBH 4AWJC 1ZTMA 5FV1L 2OXHA 3TV3H 3HRZA 2W0FB 5KS9F 1KFGA 1NSNH 1OAZH 3FTGA 4K55A 5DHMC 2EO7A 4TSBL 3TT1L 5DO2D 1RK0A 3CQFA 3PP4L 3SE3A 3IAGC 5HDLA 4WHYH 2RHEA 3HI1B 4ZTEA 4OUUA 4LU5L 2L7JA 2R0LL 1IBYA 1J12A 1ZPUA 1H3VA 4HJJH 3FQTA 2ICEA 4J3BA 1LYQA 1X5GA 2A9AA 3Q8AA 4BA0A 4JZNB 4MJ2A 3X3GL 5FOBA 2BVQB 2JNZA 5JIHA 4UQ3B 3VW3L 2BHUA 4OKVA 4POZC 3PXHA 3VFGH 4D2NA 3C8HA 3KYMA 4PV8A 4RDBA 1MJUL 4R4BB 4QHMA 5HJGA 2DD8H 1BEYH 3FFCB 4HZLB 2UXVA 1MHPL 4IBLT 4PJIF 4ZFOL 1IZKA 4J3UA 4HWEL 1TSRA 4O2FB 1FAIH 3U25A 3MACH 2FECL 1JYNA 1BVKB 4G82A 1NEPA 1BM7A 43CAA 4Y9FA 4DW2L 1I3RB 3ZU8A 3ERXA 3LKQA 3GBNL 3SBWA 4OFYA 1J0ZA 2EDTA 4U1JB 1TJXA 2CGZA 1RUAL 2AQ1A 3NSYA 5TPWH 4OZHF 2MQ0A 4OT1H 1GYUA 3IAPA 4WTZG 4X6CB 2JMRA 3TYGL 4C56D 1GTNA 3QWRD 3ZR5A 3QQ4A 2HLFC 1MHHA 5L8JB 4H2AA 5E1IA 1S7RA 2MHAA 1VENA 3MRFB 3HKZA 1PD1A 1Q72H 3ABKB 2JJTA 3HMXL 4XNXH 5TQ0L 5CEZH 1QNZL 2V8MA 4GS7B 4HETA 1NPNA 4R26L 1X4YA 2AW2A 1N4XH 4G80B 2UX6A 5GS1C 3H6JA 5DQJB 3FO1B 2G0LA 2MH4A 3WDJA 4XNQA 2ODIA 2VN6A 3HLKA 4L0PB 5BV7B 4Y1SA 5GGUB 1RPUA 5IQ9A 3UCQA 5DMIL 3FFCD 1P1ZB 1OKEA 4L4VB 5I19L 1OO2A 4U0RC 1T03H 5FF6A 4UIKH 5D7LB 1MFDL 3WFBH 2G75B 4N85A 2QVMA 1WEJL 1S3KH 3KS0H 2WYZA 4RMWA 4Y5XC 1A7NH 4P46D 3DKHA 4Z3GA 4BYHA 1ES0A 1NH6A 3FFDA 1TG8A 2E7DA 4KK8C 4OLUL 1OM3L 1SOKA 2BP8B 2WN3A 4ANWA 3TNMA 4Q58C 3QG6A 3UROR 1W8EA 5DFAA 2E6PA 3F00A 3FUHA 4NBZB 3LX9A 2WXFA 4U4IA 1MNUH 3P30H 4JFWA 5DMGC 3VVWA 2O61B 2UWEB 3LZFL 12E8H 4FTVB 4J3WA 4UU9B 1PNCA 4PGBA 4PJBE 4MQTB 1W0WB 4TNWK 1N59B 3B6SB 3DETD 4HS8L 3SYOA 3L3IB 4QJ4B 3PGDA 1AXSA 1CD1A 2W81C 5PAZA 3SDAA 2XIIA 1BF2A 3IPBA 4RMTA 3VXSE 4L4VD 2Y07L 2D4FA 5D7LD 2BSDA 3ZUCA 3BPCB 4J27A 2FX9H 3P77B 3LNGA 3GMQA 5ACZB 3BZEA 3D09A 1NOAA 4NWUL 5IV2A 3AT9A 1CI3M 3MLSH 4HX1A 4M5SA 3MU3A 4AM0A 3ISYA 5CILH 1RLBA 1A7PL 1WBYA 2MFNA 2X44D 2FWOB 3IJHA 4GRWH 4PBDA 4RGND 1J0YA 1WA1X 2DBJA 4IS6A 4AE0A 1E28B 3D30A 5ID0A 1XMEB 3MUHL 2ZKHH 4QRBA 2P80D 2VR7A 5IB4B 1YUKB 3LIUA 1UG9A 1IV8A 3QEUA 3HNTH 4TSCH 3C2AL 2B0SH 5IT2L 3SSGA 3WLWD 1YAIA 5AZEL 4LOVA 1K6QH 4IKLA 2FD6L 4Y2OB 1JTTA 5C2BL 1U3HB 4O51B 5IUCA 3SPVB 4H7VA 1ID5I 1CLZL 4PREB 3VYOA 3WJLA 1XSKA 1S78D 3OKMA 3WFDH 4AKPA 3K5SA 2C3GA 4RA3A 3SKOA 4PRDA 2OQJA 1SJHB 5DVMA 4L2LA 3O0LA 4KO9A 4Z7WF 5D1XA 2XACC 5D55A 5EN2A 5BV7H 1AQKL 5AAMC 4OGYH 4XZUA 3MUUA 4DIXA 1BBDH 4P3CL 2ITCB 1OPGL 3FUFA 2V6HA 4HDIA 5C6WH 4YNYB 1TQSA 3E9UA 1QSFA 2Q3AA 4XAKE 4I0PD 2NY0D 4LBEA 2J8UB 3ILQD 5HYFA 3KYKH 3DGGB 3VXOA 2EIEA 3GHEH 3PWNB 2E9WA 2P7TA 4M8RA 4ELKB 1TLMA 2BSBA 3O2VH 1JHLL 1B3JA 5EZOL 3BESR 5BRPA 1GGIH 4M5YL 2F6AA 4FCHA 5CBEB 3VXMA 4GAGH 1CF1A 2EDLA 4JAMB 3EF7A 3RB5A 3TYFB 4M6NL 1ETB1 2XX1A 1CICD 2X2UA 2ZG1A 4CC4C 3RVUD 4JL1A 1G5GA 2ZNWA 4LEOB 3TO2B 3SDYL 2QQQA 3WCYA 4PG9B 3DVFA 1QFPA 1NUFA 1ESOA 5CSGA 1CN4A 5HTSA 4G1EB 5TTRA 2E9GA 2ROYA 3IXTB 2AJSH 5ESQA 4I85A 1MW1A 4FQIL 2FSEB 4NN5B 1CYGA 1DL7H 1IC4L 1WAAF 2IG2H 2W88A 4KZDL 1CK0L 4IRJA 4UV4H 1ZLUH 4EI5B 2NTFB 1HH9A 1IAII 1YYLL 2QKIC 3CMOL 4WKZA 5MI0B 2X9WA 4GSRA 4CJ1A 1EEQA 2W0KA 3EGDA 4L8BB 3UERA 5K1NA 2CH8A 3INUH 2BVOA 5E8EB 4R8WH 4NGHL 2XDHA 4HPOL 4YE0A 3FQ2A 4N3TA 15C8L 3H54A 1RD6A 1HSBA 3HC0B 3NK3A 3SDXA 1XIWB 4Q89A 5EORL 2KLRA 5B3JE 3MBXL 4XNDA 2R4SL 4M1GH 5IW6B 1TMQA 3ME0A 5PCYA 4P07A 4YHPA 4IBWA 1PD0A 1NMCC 2L4OA 2HT4D 4MCZB 3L3OC 5E9AA 5T1MA 4DPCX 5BMFL 3QXUA 3L3JA 4XXCC 5DK0B 5CR8A 4ERSL 2MWCA 3QIBC 3SQBA 2E0PA 1XD0A 3VI3A 2YAMA 3GBMH 3T6WA 4MKTA 4NKOA 5CAYB 1BGXL 1D6VL 1KTRL 3QHZH 2V37A 1YCSA 4MJIB 3HZMB 4P23B 3QDJB 5JHLA 1WCBB 2P48B 1EUTA 4NI3A 3CFEB 2X89A 2HFFA 1TYEB 2FJUB 4FLQA 4EI5D 3WE6A 2O30A 3X1BA 3SJVE 3HR5A 1COBA 3V6FA 3OXRA 4ONOA 3BEVB 1T7ZA 2WSKA 3MUGA 4YIQB 1CFNB 4X80H 4K2UH 5E6IA 3LHPL 1QG3A 1TZIB 5IHUH 2VW4A 1FVEA 3FT3B 4YDJA 1PTZA 1XIWD 4JGNA 5JDSA 1DLHB 1V5JA 2WXIA 4HFUL 4B9KC 4IDLA 3H2WA 1BM3H 4CSPA 1PS3A 1ZTXH 1U8NA 4HPHA 2NOYA 4KTYA 1QEWB 3AAZA 2HX8A 4DEWA 1VACA 1TLKA 1MLBB 1NJ9A 5E8OA 1GA2A 1KEML 2EUXA 1GS7A 2E5EA 3OJVC 4AENB 4D3CL 4D9LL 2APWA 2Y23A 5HYSG 4KV5E 1QRNA 3POHA 3EJCA 1B88A 1Q0EA 4XO4A 4P23D 3VXRA 1NFDE 1F00I 1LO2L 3UAJA 5I66A 4O2EB 1DCEA 4S0SD 4KDTC 2YGOA 3IFPB 3QUZA 2QLVB 3BQVA 3X3FH 3MRDB 1OXYA 2V7NA 4JM2B 3UPRA 2EZ0D 1TTFA 3BDYH 3IWVA 5L8LB 2KKQA 4N2GA 4UOJA 3ELAT 3HKFA 2VRAA 2VDOL 5MEQB 1CDBA 1LP9B 3QFJE 3CVHB 5DRZA 3LNHA 1U93A 1ZVYA 2ICWI 1F18A 4I87A 2PPFA 3LRLA 2Z0UA 4P5TD 4GG8A 3OD3A 5FYJH 5J11B 4W81A 3D07A 1HSAB 5DJ2B 1AACA 1G0YR 1KBGH 3MFFB 1AP2A 2R9HC 4XVOA 5TE4L 4ZD3H 2PPCA 4F3FB 4UUJB 1MHCA 3JV4A 4F58L 1CE1L 4TF4A 4PIBA 1YQVH 2ZWLT 1ZWIA 2ZWKA 1F97A 2XIDA 4GBXB 3W11C 1L9TA 3IGUA 3IFLH 5K9QI 3LPGA 4J4PD 4PJ8B 5B21A 5ES4B 5HY9B 1NFIB 1I7ZA 4KKQA 1HWGB 2Z34A 3SZ6A 2EVGA 3G5YB 3GI8L 4ZPTA 5DLMH 1HL4A 3HVDA 5AKRA 3U2IA 4ZZFA 1HZHL 5D7SL 1ZGLB 2X4TB 1U8LB 1ACCA 1JSYA 4PH8A 3SJVB 4I3SL 2R2BB 5L0QC 2J55A 1G9HA 2FJHA 1SN0A 1ZDSA 1F3JB 2VDRH 1N5AB 2FDBP 4J5VA 1N0XH 2R15A 4NN7B 3ARBA 2BIMA 4PS3A 1JNLL 3QK0A 2YN3A 5KYWB 1WZ1H 1G9ML 2X2YA 4HLJA 5L88L 4N8PA 4K9EH 4UNUA 2R0WL 3N85L 1RKRA 3OHXB 1SY6A 1QR1B 3X13A 1W91A 4F7PA 4Q0XL 2K7QA 4Z95L 3I84A 2LAAA 1L9MA 5B7FA 3CDGA 2P46B 2LGNA 1E5AA 4PJ8D 2APBA 4APQC 1CFVL 3GUFA 3UZVA 2LTQB 1ZHLA 2X4SA 2HFGL 2WQVA 5CN3A 4ZX4A 4N68A 4DP1X 4JFYB 5LWYL 3L3HB 4HQQL 4Y2NA 3VWKC 1NIDA 5EOQH 2DQFB 3QYCA 3VNZA 1H3UA 3BFWA 1CD8A 1TYRA 3KZ8A 4MHHI 3OR6B 4M48L 1FPTH 3BCDA 2P8MA 4PLJC 2D0GA 3EO0A 2CCLA 2L7QA 2RB8A 5LGHH 3SJVD 5L2KB 4LKXB 3FH7A 2C3VA 1YUHB 2ZP9A 4NQXB 3RWHA 3P9MA 3HLAA 2YD3A 4PJGA 5ECGA 3QCUL 3DGCR 3QIWA 1DBML 2DI8A 3TWCH 2Q2EB 4QRRA 4CUCA 3ARGA 1FL3A 2AHIA 1JWUA 2ICCA 3QFJB 3HB3B 5E2TH 1JTOA 5FECA 2UY7B 1MZZA 3VG9B 4LSSH 5L4JA 4OGAC 5DS8B 1UWEL 4XMLH 1M1XB 2OR9L 4N1EA 5HJ3A 4MS8D 3VFMB 1D5ZA 5CUSL 3KL3A 4HUNB 4JFZH 1CB4A 1HXKA 3LDBB 3RYMA 2AEPL 4NZDA 4Z18A 1RUKH 1TO4A 4I3RH 5T3ZL 3VFVB 3V6OE 2GI0A 2XWBA 3D2TA 1ZLSL 4BFFA 4RQQA 4FFWC 1SJMA 3VGFA 1S5IH 3VFRB 2VWEC 3FC8A 1G7LA 1OAUH 5DZAA 4H26A 2P24B 2AEIT 3HN3A 5IFHH 4QRQA 3F84A 4XPFH 5EBWA 3ULVE 5E6ZA 2APSA 4HUWA 2XWZA 4ZMAT 3CFIC 5F89A 5BUPA 2XICA 1LE9B 2H6UA 3PQYB 2V7HA 4AW7A 4PTTB 5ESVA 5E5RB 1LO0H 3SDCC 5AAWA 1KY7A 1QPPA 3F7RA 1BFVH 1HXYA 4GEIA 1SVZA 2NY3C 3EJYC 3HB3D 3QFJD 1GPOL 1TVBA 4F7MA 5D1ZA 2OTUB 5F7DB 3V7AG 4CBZA 4QOKE 5I30L 2NY4B 3EDFA 4RX4D 3R8BB 4K3EL 4W9ZA 4N2BA 3S3DB 3IJEB 1F1AA 1F4WL 2GTZA 4LARL 5EF3A 2WIMA 2H3NB 4YZWA 1XFPA 4FC3E 4XBMA 3VTMA 5EDXA 4M1CC 5LO7A 2BCMA 4QDGA 3SD2A 2DTML 2VABA 3ABMB 2ATPB 3NFNB 1S6NA 1OAXL 2NYYC 1YEFH 3RJDA 2PYEA 3CSGA 4FXTA 2D9QB 2IWEA 1KIUA 5EF0A 3G6AA 1U6AH 2DQTL 3F83A 2X6AA 5T1KB 1L4IA 4XCEA 3Q44A 4FNPA 2CHDA 1C08A 4RSVA 4ELDA 5E08L 1Q94A 3X11A 3BO8B 4BZ1L 4MA3B 5FKPB 4ENEC 5F7HA 1EA9C 1OAKL 4GI6A 2DLTA 2X0UA 1NCCH 2V0AA 4ATWA 2DJMA 4MDRA 2X2IA 4FXKA 5HVHB 5LN4A 2ZSWB 1GIGH 3HOGA 2NY4D 2C1OA 3LQAC 1Y1DA 4YR6B 1Z5YD 1P7BA 2GITA 4G6FB 1UFGA 4QXUH 4XNUH 5CZKA 2GBVA 2H1PH 4XP1L 3CN0A 4FQ1L 5CEYB 3TBYB 4ACTA 1S4IA 2Y6SC 5JW4Q 2NYKA 3M6DA 3TH2T 3HS9A 2NQDA 3ESUF 2K1MA 1ZT1A 3A6BH 3MRCA 3NCYS 3O6ML 3HBGA 3D0LB 1QSEB 3RGVA 4NYLA 1IGJA 2FR4B 4GIOA 3ARWA 5T1KD 1ZD6A 2W65B 3VDAA 4YBLB 2HTLD 1HYSD 2BW4A 2TSAA 2ZZUT 2XTJE 5ERWA 3UC2A 1YYMH 4OD1L 1I8LC 3ZDWA 1S7XA 4IBSA 3VXQA 4DOHE 3PREA 4TUKH 3WIIL 4I1RA 2P47B 2ZXAA 3UBXG 3T0EA 1E4HA 4AJVA 1KTBA 4PUBL 4WWID 3ZYZA 5I6OA 2V9RA 1UQSB 5E56A 3O0RH 2PCFA 1XTLA 1G7JA 1AIFA 2N59A 3LQZA 3T6XA 5LNDA 5AW6B 2AJYL 4AZ8B 4O02A 4PWGA 3DHPA 4L37B 4FFZH 4PJXF 3RVTD 1ZIBA 1QUNA 4RISH 5IBTH 4D0DA 4PJFA 4N0FA 1EGJL 5K39B 5D5ME 1CWVA 2APVA 5FO7B 1E27B 5JW4N 3QRBA 1ROCA 5EBMA 4WU7B 3LQAL 3P4MA 1B2YA 4QOKB 5KVEL 1EJ8A 1UM5L 1D5MA 2BOCA 5AW0B 3ATAA 4C4KT 3PFQA 3GNMH 4MZ2A 2OLDA 4QT5B 3FAWA 1T2QH 3LRKA 4K8RH 4KDVA 1YNLL 4TQEL 4I2XB 3NCFB 4L4TE 2JB5H 1KV7A 2ZWNA 2DRUA 3QDMB 4NKIH 2ZOLA 2R1XA 4PWHA 1UOVA 2FLBT 3HC4H 4ESNA 1HIMH 3D06A 4G8EB 3JQOB 2D7NA 1KGXA 3KDPB 2R56L 2X70A 3DNKA 4KOCA 2LFEA 5I24A 2OI9B 1SOXA 3TH3T 4QGYA 1P4UA 4M7KH 3DK0A 2BMKA 2EKJA 5AKTA 1EUUA 1FYTB 2J6EH 2XV3A 3Q5TA 1SN2A 3L1GA 3LB6D 2EE3A 4LSUH 1KJ3H 5FUCC 3ZE1F 4CVXB 4QUOA 4P2QA 4YDIH 1DBJH 3PE9A 2RAMA 3MGAA 1CGWA 1JAEA 4QOKD 4ACPA 2MNJB 4GIPD 1RZKC 4M7LH 1N0LA 3OLEA 1CG9B 4O5LL 4KI1A 3V0GA 5F1SA 1GGUA 3LS4H 4JO8A 1FNAA 1MFCH 1A2YA 2W94A 3F7LA 1YJDH 3QFDB 3ZIMA 5BOPA 2DQCH 2L0DA 1XGQB 5TFSL 1I3GH 4LCCA 1FLRL 3S5LG 3CDFA 4E9SA 4BHUI 5JQIB 3KM2A 3FAXA 1SXCA 3OTTA 4FA8A 1UD5A 2VN5A 1WAEA 2P44B 4ODHL 3TO4B 3ZTNL 2XTJB 2QSQA 3GMRA 4ZS7H 4D8PA 5AB9A 3EYOA 1CQKA 2O5NA 2FGZA 5D6DA 2OMYA 1KNOA 1IGMH 5ICXA 2EC9T 5GGRY 4W9LC 1VJSA 5CMAA 1EJOH 3RWIB 4I8DA 4OF8A 5ID1A 2Z1PA 5CINL 5DJ6B 1C12A 3KJ4B 2KPPA 5T33L 3DVGA 4WW2F 3RZWA 3WBDA 3L7EB 3VD4A 3HZ3A 1YEKL 3GLZA 1BAFH 3AM8C 4LRNL 4LPUA 2ORBL 2FX7H 5GSRB 3RZCB 1EHAA 4U2ZA 2GJ6B 2JQMA 4DGVH 4WFHE 4A7QA 4QO1A 4GW4B 3VFNA 1FNGB 2YD0A 3CU7A 2P5WE 3SD5A 1RZKL 3FQRB 2ZPKL 3VWJA 2AJZB 3MGOA 4LL1A 5EOTB 3V0DA 3ZRCC 1Z9OA 4YSPA 1IBGH 3KWXA 2NW3B 3O2WL 1JV5A 3CBKB 4MNGE 2F54E 1ASQA 4ELMF 1BVNP 3NCJH 2I07B 1A0QL 1IQDB 1IBFA 2OJ1A 3BHBA 3NN8A 3TO4D 1OOAA 1MCCA 1MCDA 1S7TB 2XTJD 1ZPLA 2H2PC 4UTAH 2I9TA 3K1KC 1NDMB 4YN3A 4L4TB 2ISDA 3WIFB 3HI5L 2A77H 4IKKA 3D7PA 3GIVB 3QHFL 3D9AH 2VZ3A 4XB3A 4UYQA 4RMVA 5GS1B 1H6EA 4IHOB 4WSGA 5A6LA 4F5CE 4POZD 5IM7B 4X98B 2J5LB 1HQ4A 3PV6B 4OR1A 2X9YA 2CKBL 4M9PA 4KQ0A 1NGYB 3T0WA 5FLVA 1UHVA 3VXPA 2VAAA 1JE6A 1AD0B 3KL5A 4U0RB 1WUZA 4NKDB 3U7AA 1LD9A 3WJJA 3RQ3A 1N6QH 2W60A 3K46A 3PWVA 4GXUN 4WEUD 4DO6A 5JO5A 3SKNA 1JCVA 1RK1B 2YFOA 3L3KA 4PI0A 1YN6A 3LH2H 2C3XA 3G6JB 4KQ4L 3TJEL 2PPAA 1X6LA 3ESPA 1WQVT 2HLFD 4FQHA 2VZVA 1RUMH 2WSPA 2X1QA 4TXVB 1QFWM 1WFOA 1YEHL 3OQRA 4MD5A 2R2CA 1BZ9A 2IMMA 2BIIA 5GGTH 2IQAA 4ZUSA 1HCYA 3KXFE 4G1MA 2O5ZL 4ECNA 4L4TD 4NUJB 1SBSL 3FU5A 3C8KB 4PS8A 1XGZA 3BH8B 1K3ZA 3QQ3A 2YRZA 3QNYB 2MKWA 2DF3A 3KLLA 4AEHH 4F7CA 3UBFA 1XR9B 4HXAL 3A4AA 1QASA 4U1MA 4AQAB 5K9JL 1I8AA 1ORSB 2DIEA 5KVGH 2OX5A 5IROC 5ACMA 2ZUQB 1CE6B 4KJQC 3B5HA 2UZPA 1FO0L 2WQWA 2GT9B 1W16A 1NEUA 1A5FH 3RGHA 3MFGB 3S34H 5E9DA 3DXAA 5I5MA 4PV1C 2WWNA 3ZIYA 5B4MC 2EACA 4K9JA 1H3TA 5IVXF 4DN4H 1W15A 1JZ3A 3RWJA 4X5WB 2ZUTA 5C0FA 3WNIA 4KK8D 3MLRL 4I18A 3KNBB 4ZODA 25C8H 3ASNB 3T3PB 3HW7A 1G7HB 3UTTE 4ZK8A 4PJDE 5FS5A 3Q5OA 4W68A 5CLXA 2F5BH 1E9QB 4WUUB 1OT4A 3HE7A 1A21A 1KYUA 1T5XA 2NQ3A 2D31B 4JJ5B 4OF0A 2VIRA 4KMLB 4CA4A 3VXTA 3QQXA 4XNZC 1V27A 1MG3C 4M3KB 1L9RA 2YKLH 1XH2A 1R17A 1YEEH 1IGIL 2Z93A 3MLVH 2F54B 3V0IA 4E9VA 3IM1A 2WLLA 1HHJA 3KPNA 3MREA 2F7RA 2BLFA 3N9GH 5F96L 2O5XH 1WLHA 2UY6A 1KB5H 4EJ1C 4OZIB 5J57B 1RZPA 1TQVA 2CO4A 4X5RA 2G9HA 2RH0A 3CD4A 2WWMC 3DHMA 4AQZA 1EDYA 2Q7YA 3GLEA 3HHMA 3U30C 4PJCE 3WEXA 4KU1A 4YFLF 2GUOA 1IM3B 3BUTA 2WWKT 4P9HC 5DK3A 4ZMWA 3TFKC 1NDTA 3IFOB 1XMWA 4P2AA 4HMDA 1DQML 1ODUA 3FYIB 2EUVA 5GRZA 5C0AE 3O3EA 5CD3B 2BS71 2ZWSA 4IEFB 3WG7B 4OIBA 1OY3B 4WFHD 5DJXB 3KPSA 5DWPA 1XZ0B 3IF1A 3MI6A 2R1WA 4IIQA 1ZAGA 2AJVL 3C60C 4HBQA 2BZDA 4L3CB 2ALWA 4NJAH 1RU9L 2B5IC 4XZ4A 5CSZB 5AZ2L 5DZJA 4MDJB 2QHRL 2F54D 3GXPA 5DS1A 5BVJA 3WKML 4S1QL 4P57B 4ZYKB 5GGSY 1KCRH 3SKJH 5D70L 1PLAA 5LAPA 5TH2A 3KXFB 4HH9B 1MRCH 2JKJA 5CO1A 1B0RB 2AMGA 4ZTPL 1B0WA 1KXTB 1F86A 4M5ZL 4N9OB 3TEYA 1TEGA 5C9JB 5JUEL 1BECA 2VTFA 1ETA1 2QTEA 2QKIB 5DQDL 1P6AB 5I75C 5CFHA 1KDJA 1SMDA 1AI1L 5FCUL 4R96A 3V5HA 4CMMA 4BKSC 4XBEH 4PJAF 4QTHB 1IT9L 1RZ7H 1W72B 1WG3A 3VI4F 1KPRB 3HMXA 3DJZA 3FO0H 4GAFB 4KRPC 3E8UL 3EJQA 4B7LA 1Q38A 4AMKL 1P6WA 3P02A 5CM1A 3GSOB 2XN9A 1NPRA 3KLHC 4QRTB 1CBVL 4X4YA 1U8PA 3H7BB 2FGWH 3MLXL 4PLOB 4YHLH 2R39A 2OXHB 5F21B 1PCSA 4IU3B 2VZTA 3FTGB 5ISZA 4CKQA 1DJIA 3GT6A 2YAHA 3ZY7A 1JZ5A 1RK0B 3WS6C 4OV5A 5B1KA 3KXFD 3EO9H 3UTQB 1ZIAA 3VD5A 1J86A 3QCVH 4OUUB 3MBEC 3OR7A 4E9XA 2FBOJ 4KKCD 3FQTB 2ICEB 1A7OH 3H53A 4LVNC 3N0AA 2ZCKH 4ONFL 4CVWA 5E8DH 5BQ7B 2GBAA 2V8LA 4LPYA 2WXMA 2XA3A 5D71L 2PKDA 4OKVB 2LU4A 2A0LC 3ZHDA 3R18A 3TCLA 3NJFA 3KYMB 4PV8B 2YUWA 3K2UL 3DECA 4JFDE 4QHMB 4X6FA 4WNQA 3PUCA 2G3MA 5AOMA 3GB7A 1KPVB 3EJTA 1RIUL 3NZHL 2GB2A 4U3HA 3NYKA 1VA9A 4YUEH 5FYLH 5EDSA 43CAB 1FJ1A 1UKQA 3N1GC 1RP9A 1AGCA 3LKQB 2NDFA 3TH4T 4KVCH 4NXSA 2NY2B 5T3ZE 2EXYD 4MGXA 3F7YA 4XBPB 2E8ZA 2QGDA 5E4EC 3WUZA 1L9NA 3HUJE 5CKGA 2DMGA 3NZ8A 4HZ1A 4QTFA 4HG4J 4KNQA 3QQ4B 1MHHB 2VDPL 4MD0B 2ROXA 4NWTH 4PGCA 3ZE2E 1ACYH 4KWUA 1S7RB 2MHAB 4F2FA 3FT4B 5EG6C 1Z1WA 1MY5A 2AP2A 2W92A 2J8HA 2HVBA 3I6LE 4A66A 5ACLA 4UT6A 3B9AA 1CXKA 4EZJA 3D2UA 2CIKB 1RFDH 4MB4A 4JK0D 1KIPA 4XNQB 1UJ3A 3BPLC 1C16B 3D6GA 4PRIA 3DURA 5IQ9B 2JE8A 2VXTH 4Y7MA 2HKAA 2QKSA 4AM0Q 5T3XL 3G08B 3V5DA 1W72H 4TVPH 2E9JA 3C5ZC 3M45A 1DO6A 5CBAA 3VXME 1MWAL 2Y5QA 5C0JA 2XZCH 3MROA 5LJYH 5DURB 5JPNA 3QG6B 4X5XA 1CXEA 1H9VA 2F7IA 1FDLL 2R0KL 5DD5L 4KMTH 1T4WA 1SN5A 4YWGH 1LHZA 2FO8A 5CLTA 1I9RL 3L1OH 4PGBB 1INEH 4X6CF 1A6PA 3CLWA 3FTZA 4JO1H 2VWEE 4R3SA 5DHEA 4E9WA 4YDNA 4TNGA 3WO3B 3RTLA 1PZCA 5J56B 3UO1L 4MZIA 1JPST 1KTKE 3WKYA 1E4WL 2ZP0T 3PGDB 4UM9A 3MJ8A 3CLFL 4FNLH 2P5EA 3P2DA 2K8MA 4XR8C 1EEYB 3SKUD 5IJBC 3BEWB 2XFXB 2DH3A 2WTRA 4BH7A 1PY4A 3GMQB 2NSMA 1YNTA 4XMXA 3D4GA 5IV2B 4DKFH 2Y4SA 3LY6A 5I18H 2FH8A 4XN7A 4AM0B 4JFDB 3RJQB 4GG6B 4GQ9L 1QLEL 3IJHB 2R9HD 4IS6B 1DZ0A 2QQLH 4HJGA 5DURD 5ID0B 3FT9A 4F15C 4EEEA 4W9IC 4CGUB 3S37H 1KXHA 1TNMA 3CCHB 3QEUB 5CFAA 3PGFH 2FEEL 3VCLA 3OWRA 4QCIB 3W11D 2B9BA 2MNUA 2CE6A 4JFFE 1A3LL 1T89C 4Z23A 1UXLA 1DFXA 1XWVA 3BZ5A 5F0LB 3QZLA 5AALA 3HUJB 1AHMA 1KGYE 4MB1A 2DWEA 1QLRA 2A4ZA 3OKMB 1QW8A 4HUVA 2AK1H 5BRQA 3U4AA 3VWKB 3SKOB 2ZYRA 4PRDB 4DFIA 1MCOL 3IMWA 4UANA 1T0OA 2YD4A 5DI8A 3FRPG 3LKSA 4L8DB 5EN2B 3K2KA 5IGXH 4JRYE 4JN2B 3KWTA 5TDNA 4XZUB 1R5IA 3LSOA 4GW5A 1GGTA 4XCCH 3WO4C 2AJ3A 4DTGL 4EZLA 4HDIB 5FAAA 1JBJA 2Y7QA 4Q9RL 2SEBB 4JFDD 3S88H 3I75A 1KJVA 4FKEA 1ICTA 4HEMA 4LBEB 4N8UA 5LGJA 1G1OA 3O6LH 4YX2H 3VXOB 3SBQA 5J3HC 1XAKA 5AVZB 4AIZA 3FTYA 2P7TB 4JZOA 1F4YL 1TQUA 4DKAA 1MLCA 1NIBA 3BUPA 2WN2A 4JFUA 2NDGA 2X87A 3BGAA 3PPEA 4UQAA 1JGUH 3VXMB 2ZOWA 3KH4A 4LP4A 3HC3H 5E4OA 1IGTA 4APQD 1GZPA 4WI6A 4DPBX 5IF0A 2D7TH 3CVIH 3SOBH 3IJSA 4M7JL 4WWOA 2Y5TB 1JG9A 3G7TA 2IAMC 1H8NA 2AXWA 1QHQA 1UH2A 4Y5YC 3UJTH 3VWKD 1DVTA 1A1MA 3ZK0A 2DDQL 4BQCA 1MNNA 3QGVA 3C5JA 5ESQB 1CQYA 3I6LD 4YBQC 1QWUA 1NGXA 4PLJD 1D7CA 4HC1A 3GXFA 5GRJH 1X5MA 4IRJB 3VSVA 3CVDA 2QQKL 5ILTL 3RIFF 1I9JL 3S4SG 5FDWA 2ZUSA 4PR5A 2QMJA 3QXTA 9PCYA 1Q8MA 4G6KH 2BVOB 1I8KA 1O9VA 1SMAA 5AVVB 4NFDA 2YMOA 4Q14A 2VJ0A 2G2NA 3Q3GA 1BDYA 1HSBB 1CCZA 2UVEA 4P4RA 4OGAD 3MRHA 1GHFH 4DKEH 4WCYL 2RALA 3VXMD 4TOYH 3FOMA 4YSSA 2H32A 4YHPB 2YAQA 5C08E 3QPXH 2G4EA 2G5BA 3NG5A 3NDYE 1A1OA 4YDLB 1RZGA 3N40P 2PTVA 5GGRA 1FNEA 1K8DA 2P45B 1O9ZA 3GTTA 4YDKL 4QKXB 1NBVL 4PJ7A 3SQBB 5JORA 3VI3B 4LLMA 1U41A 4W9EC 4FFWD 4NKOB 1TJIL 4JFFB 1FVDA 4PG2C 5E8PA 6TAAA 4JPVH 4BELD 2X10A 2ZJSL 4H40A 1KIQA 1YDPA 3EUDA 3ZKXC 1I85A 2VLKE 4O9HH 2RJMA 3ABZA 5KVDL 4DP7X 2V5SA 4IRJD 1Q9OA 1IO4C 3BKML 4PJBF 3RIKA 3WE6B 1E8XA 2DEXX 4DQOL 2JB6B 4Y4FC 4JY6A 3HR5B 3T4YB 2XJKA 3OXRB 4N4YB 4M1DL 5IHLB 4NQCE 4M5TA 3SDCD 5FUCE 3AREA 3ZZ1A 1WIUA 4LLAA 5E6IB 3S7GA 1EEZA 2W38A 4HSQA 4WTXA 1J5OH 2B2XH 3QA3A 2R29L 3EJYD 1NQBA 4KHXL 2J7LA 1YMME 3CXDH 1FVEB 4YDJB 5KVFL 1MY7A 5DEGA 5B38A 4X5PA 4P48A 2ADJA 4TLTA 3L17A 3ORJA 3BRFA 2HLAA 4OBSA 5IW3A 3RTQA 1G9NL 3V4PB 1J0JA 3H42L 2O6CA 1Z9LA 3VYPA 4E9YA 2LE9A 2YK1H 4ZNEA 4M1CD 1WITA 4PRAB 4R0LA 4FG4A 4KJYA 3TGXA 3AAZB 1T0MB 3L3GB 1SM3L 1VACB 1JPGA 4FDWA 1GOHA 4X5QA 1ZLWK 5L7XH 1NJ9B 2NYYD 3L8QA 5KZCB 4F9PA 3C08L 2QMKA 3C9NA 4JFFD 1Q0YH 2R0ZL 5J9PA 3LD8B 1QRNB 4JS7A 4R7LA 3OMIB 5TGBB 4CN6A 3VXRB 2AABH 3PAUA 5E6YA 2ZKXA 5AOZA 1SVCP 4NRZA 3NMEA 4Z0BH 3I6KB 3C2SA 5EBLB 2OSXA 2ZSVA 3QZWA 4GEJA 1I1FB 4JG1L 2PWDA 3JTSA 5E7BA 4D0BA 1CU4L 1CLYH 2Q3XA 4ODTH 3POCA 4KZEL 1UASA 4K7PX 3B83A 1NLBH 2V7NB 4RZCB 3UPRB 4JRYD 5IMLB 4JPKH 2HT3C 4R4NC 3W9DA 3DK2A 3BZFA 5F3BA 4PTUA 4R2GC 4X6DE 5DRZB 3MLZL 5E2JA 3ZW3A 2VLRA 1FWXA 3SDDA 3NJKA 4GG8B 1HVXA 4OLYL 2Y6SD 1G7IB 4W9JC 4N0YH 2FO1A 3QH3B 4TV3A 5KJRH 3SPHA 2D9CA 3VH8A 5KZCD 4A2FA 2OW6A 2V3DA 3JV4B 2V4LA 1XH3A 3QNZA 2JVUA 2F53A 1NMBH 5T5FL 4BQ9A 1CGYA 4P4KA 1HHHA 5C08B 1MJ8L 3AMLA 5GRXG 3UABA 1FFNA 1TR7A 5F9OL 1RJYA 3F7PC 3F7QA 4K3DH 3ASOB 3QQDA 4DF9A 1U8IA 1OP3K 1I7ZB 5I23A 5JHLH 2E6QA 4MQ7A 3DIFA 1MFEH 4E9RA 4MMYA 3PAVA 4AIOA 3DBXA 3JZ7A 4P5KA 3H0TA 1FBIL 1E6OH 2NNFA 1A6WH 2D2CC 4M93B 4X50A 1E8ZA 3HJEA 5SWZA 1MCPH 3V4VL 1XEUA 2XA8L 4UT7H 1Z7JA 2NCMA 2N7SA 4K5LA 3ML9A 2AV1B 1BD2A 2FJHB 4YXLH 2XG5A 4JQXA 5F9JB 1JPTL 3B9VA 4OCYH 1AY1H 2X3BA 1U8HB 3ARBB 4X6EB 5E2UH 1QI3A 2BFVH 3SE6A 1IJNA 3E2HC 2F19L 1BJ1H 1MFBH 3MV7E 1FIGH 5EUOA 3NFPA 3UEZA 3WE1A 3QWOA 3X13B 5IBLD 1JNJA 2IH3B 2PYEE 3T9WA 4B96A 1X3DA 3B2XA 3E0GA 5C08D 3RVVC 1GAFH 1UVQA 2CJ3A 1V7NH 4JRWA 3BFQG 5B3JF 4R83A 3G5VA 2WNGA 5D1ZI 3SBRA 1INDL 1ZHLB 3UZVB 2X4SB 3W2DL 3DX3A 4P5RA 2I60L 5IP4A 2JCCE 1UB5B 5EZIL 4HGMA 1VZGA 4BFOA 4H8VA 4YHOL 5I8EA 5L6YL 2G9KA 2VLKD 5E24E 4WDIA 4N8CL 5DVOA 1PPIA 4A2MA 3CC5A 3CX5K 2OKMA 3O81A 2ZF9A 3P73B 3O8XC 4N9GA 2P8MB 2SODB 3EO0B 3WYRA 3F2LA 5I1JH 3KWUA 1REIA 3NGBB 1JF5A 1GJIA 3F6JA 1TOXA 5HYQA 2YS4A 1UB6A 4NQCD 5ALBL 3RWHB 3BAIA 3V0AC 3A6OA 1A7BA 3K6FA 3LXCA 3QIWB 2QHLA 1YMMD 1DSWA 2AZAA 1WDAA 2X4UB 2J43A 4NKMA 3ARGB 4QRRB 5TK4A 1FL3B 1KJ2L 1JWUB 3ZKNC 4GMTH 5FECB 2WJ5A 1NCGA 3QRGH 4I1PA 4NNPL 5DMJB 1LEIA 3D39A 2BVPB 5HJ3B 3BWZA 3RUGA 1ZEAH 2N1KA 5FKAA 3PGCB 2DN7A 3L81A 3AADB 5GGVL 5ITFA 2CLRA 4E41A 5I28A 3LRHA 1MW3A 4RQQB 3DSNA 1O6SA 3CG8A 2WLNA 3CUPA 2NR6A 3F05A 4PIRF 1G7LB 3AMKA 1AYOA 4H26B 1KDIA 2R7EA 2VH5L 5EPMA 4KKZA 2AGJH 4QRQB 1AC6A 3S8WA 4KV5F 3C75A 2XFGB 1IGFH 3QUML 4QHLB 5EBWB 2BX5A 3DV4A 4HUWB 3TVMA 2DQHH 3ZQ9A 1KWKA 4E0RA 1D9KA 2AJXL 1NFDF 2EE2A 3EO1A 3KPLA 4MAYC 4X0KB 5F89B 3NA9H 1KCKA 5JIPA 3NSCA 4ZOCA 1L6ZA 3HN5A 1CR9H 1HXYB 2J88L 1NGPL 1J1OH 1RZIA 1TVBB 5D1ZB 3B34A 2NNXA 3RVXC 3EBGA 4NO0A 1BHGA 3U7WL 3C8DA 4J3TA 4QYOA 4RWYH 5EOCH 2GTZB 5CU9A 1OAYL 1T2JA 2J4WL 3SYAA 1SY6H 1VCBC 1NC4A 2GSGB 3DRQA 3JVGC 2COVD 1CDYA 2VABB 3MV7B 5HDWA 5GJTL 5DS2A 1WS8A 5JLZA 2X5PA 1BQRA 1YECL 4NQDA 1L3WA 3T6QC 2PYEB 1DLFH 2QGEA 2VDQL 2Z4TA 3UAFA 1I82A 3G6AB 2H2PD 1IGYA 4AGMA 1HKLH 2F58L 3REWA 3GK8H 5DYOA 1VPOH 3AS1A 4XCEB 2WBJA 5I1CL 1C08B 1FVCB 4OQ1A 32C2A 3QUYC 4XMKL 5E2VH 3ZHKA 1Q94B 3X11B 1OCWL 2XQYA 1CYWA 2I7OA 1H3XA 1IQWL 4D7PA 4GIAA 2CRZA 4ZBJA 1W6WA 2CJSA 4ABWA 3RWDB 1USQA 4LPWA 4D8OA 2BIHA 2APFA 5DGQA 1MI5A 4PWIA 5D1ZD 1QTSA 2W0LA 5EIIG 2Y7SA 1CFMA 3X17A 1ZSDB 4LDCA 2QV4A 3PIQB 2GITB 4YSCA 4HCGA 1TFHA 2VQUA 4YC2B 2BY2A 2Y2WA 3T0BA 3RU8L 3CHOA 3EFDL 3MV7D 2KUTA 1ZT1B 4MLSA 1TU2A 4NJ9H 4Y2DC 1CXHA 2PYED 2EDYA 3RGVB 5GZOC 4NYLB 1IGJB 3QUXA 1F4AA 5EU7C 1KCSL 4NRYB 2FL5A 5ADPL 5BUAA 3FSVA 5ERWB 4FLSA 4OUOA 4XNZB 3IGAB 5KN5A 1J9QA 1BIHA 3RFZC 1ND0A 2H2SC 3VXQB 1L7IH 3ZO0A 3T0EB 5IROD 2WUBH 4X9FA 4KJQD 3WEBA 1XQ4A 3AS2A 5GGQH 3H1ZA 3T4AC 3CPUA 2PCFB 3A6CL 1G7JB 1XV8A 3LQZB 2QDWA 2CU9A 3D25A 1YEDA 3LOWA 3QORA 2WXKA 1WF5A 1M1SA 1A9EA 4URTB 1SHMA 3RI5F 5B4MD 2MCPL 4O02B 5DC9B 2ITEA 3P4NA 3SE4C 1HINL 1QUNB 3OKNA 5AYTA 4PJFB 1MVFA 4N0FB 1RJLA 2H8PB 1F8TL 5I1IH 4U33A 5L4IA 3AQYA 3LZOA 3BUQA 4M62L 5EBMB 1NANI 2ZCHL 3P3YA 1WC7A 2VDKL 3NA4A 4LQFL 1DE4A 2BOCB 2F8IA 2WCPA 5FYKE 3G6DH 4EO5A 4XPHL 1DVUA 1G6RL 5DHVH 4Y88A 3GSXA 5JXEC 3QZPA 4FHKA 1QBML 1NCWL 1OB1A 1MIEH 1H19A 3C60B 3MNWA 4Q4IA 4AVKA 5FFOA 2ZOLB 3FOLB 1JXFA 1LMKA 1OP4A 1TMCB 4BFBD 3C5SB 1QYGL 6PAZA 1Q1PA 3CXHK 2X70B 4LASH 5GSVA 3K2IA 3VFWA 4MMXC 1T7VA 4KXDA 4PB9L 4XAWH 3V0JA 2GSIA 2WWMD 2BMKB 4EIUA 5KSVB 2LAGB 3MJWA 1WHOA 1QFUL 4P3DB 3TBVA 3FB6A 1BSIA 2HCZX 2BSCA 1GH7A 3H3BC 3RHWF 5LQBH 3TFKD 4JFQA 3VGDA 1PX4A 2DQJH 4A7UA 1H15A 2ZUXA 4P2QB 5I75B 1AZCA 3ULVF 3VFTA 3GI9H 3A22A 4A6YB 1Z3GL 2Z7UA 3PJSA 1FF5A 1LO4H 4ADIA 1UJTA 1YN7A 2Q86A 3WIHA 4AY0A 4Z76A 3RKDC 2X3AA 1CGTA 2DQDL 2ZNXA 5EWIH 4KRPB 3IU4H 3HAEA 1X9RA 5TDPA 3QJHB 4A7GA 2YAFA 5F97E 5I74C 1A2YB 3K8MA 4JZJA 1NA8A 4FJZA 4O2CA 4R7NA 4BKLA 3C60D 3TF7C 4HAKA 3CPLA 4LCCB 2F1AA 2B15A 4OH2A 4PB0H 2WZPA 2NY7H 1QFWI 2VOTA 3AABA 4K94C 3G3LA 5IB3A 1WBXA 2WGXA 5E99L 4JO4H 1SPDA 3N1MC 5MEPA 2Y24A 1UUNA 1X6NA 4NQQA 5AUMA 4F7EA 2XWJA 5I1GH 4IOFD 3UJIH 1GMEA 2Z31A 3GMRB 4Q7DA 3H9SA 4D8PB 1FE8H 1GCYA 3NCEB 3EBIA 1KB3A 3ASWA 2OMYB 1PYWA 1DEEA 1KNOB 1UA6L 2O6EA 3II3A 1A7RL 4XPAH 4BD4A 5JQHC 4U1HA 5CMAB 1U8OB 1CYXA 3MX0B 4K5MA 4OLXH 4TNEA 2WWOA 1YNKH 4O02H 3PV7A 5ID1B 4EUPA 4YE4L 4XE5B 4K7PL 2AQRA 1ZANH 1CD9B 1ZHBA 1TEYA 3GDBA 3WY2A 2X6CA 2BRRH 4KRPD 5D93C 1UEMA 4F57L 1IAKB 2BVYA 1YRKA 2AQPA 2AJUL 5LXGL 3K8LA 3ULSA 4W1TA 1D5IL 3L08A 1I1AC 1M05B 3MLUL 3M86A 5KBMA 4KKPA 3VWJB 2X6MA 3MGOB 4LQ1A 5IQMA 2BJML 4MSWB 2GG1A 2HRPL 2PCPA 2GAZA 4UAHA 1SQ2N 1WICA 1KCLA 3GDCA 2X1XR 5EZJA 1JJUA 1RQ5A 3MBED 1CL7I 1BV8A 2G60H 5H35A 2I9TB 2WOBA 1GC1L 4IRZA 3Q6GL 3MRMA 2DKSA 3D69A 5FIEA 4DCQB 3U9PH 3L9RA 5D1QA 5H2BA 1TJHH 4Q9QH 3GZQA 4BINA 2ZWZA 1JFQH 1X5ZA 1Z5LA 2XV6B 3BUYA 4HULB 4G8FA 2A0LD 4KJPC 4ZSOE 4XXDB 2DQIH 3QUGA 1TQWA 1KTLA 2VDML 3GPEA 4KI5C 4YDMA 5DZVA 3V0VB 1NCHA 5IQLA 3BKYH 3VXPB 2VAAB 4EQ3A 4X6BA 5T8IA 4ADGA 2O4EA 2ARWA 2GC7C 3ESNA 1U0QA 3ET9F 3NJMA 1O7DC 2A6IA 3OAUH 3KPSE 1MF2H 4P2RA 5BO1L 5JOEA 5JO5B 2XZQL 4PRHE 3SKNB 3C5ZB 3H9YA 2Q5BA 3VRLE 1I7RA 1YN6B 3CFNA 3AACA 2BSRA 3N0PB 3QCTH 3RVWC 4YSTA 5FYKD 3BT0A 1RVFL 4OIIL 3TIEB 1CPUA 4RGOH 3O6FA 5D5MF 3L5JA 5GISH 4B97A 4XNYL 2E7MA 4MD5B 2YPVA 3P3TA 1BZ9B 4ZUSB 5B1CA 2MQGA 4QEGA 4KKNA 5F9AC 1M71B 3QQ3B 4AL8H 4U1IA 3K72B 4PD4K 3L5XH 3QXDB 1FFTB 3MGTA 4G8GA 4OM0H 1G94A 3MRQA 2FBRA 4KTDL 4U1MB 2QPEB 3QWQB 4FQ2L 2OX5B 1TEFA 5JW5A 5KVFE 2RFXA 5F6IC 3LN5A 3S36X 2BNUA 2N1TE 3RGBA 1AANA 1RIVH 2FO4A 5D7IA 3ZMEA 1BFOA 1JHTB 5E9DB 3ISRA 2XRAH 1E5BA 2WIIA 2FBJH 1ACXA 4P2OC 3EOYG 1II4E 3RWJB 4TTDD 5C0FB 6FABH 4G7RB 3C5ZD 4X4ME 2EIKB 5HHNA 2BOBA 2FECI 5CIPA 1DVFA 4I18B 3FONA 3MV9A 4FN0A 2HXAA 2P8PA 5HHXL 4X9HA 4BK8A 1UD3A 3ZZQA 1J5CA 3NJXA 4LCWA 5ANHA 2HJLB 4BXVA 5DJCA 1FZJB 2ADIB 1A6VH 4ES8A 1DBKH 4HV8A 3HE7B 4DO5A 1ZA3A 4YHKL 5F0MB 4QJ3B 1JXGA 1T5XB 5FB8A 5J1TC 1U8JA 3OKEA 3WTSA 1IKNA 2VL4A 2G3XA 1FP5A 1SHSA 3PWUB 5AVTB 4ABUA 1FH5H 3FU7A 3F01A 3SGDH 2A9BA 4TQHA 2WOYA 3BVNA 3V95A 2Z93B 4YK4B 2PW1A 1I8MA 3I50L 1ZA6A 3I6SA 4HCRA 5F72S 5I6MA 2XKUA 2QQNL 3I2CH 4G6AC 3KPNB 1WFTA 4HOMA 2V2WA 1BBJA 2UY6B 3AG3B 4LAJH 5IB1A 2ENSA 2G9HB 2OP4H 5E9DD 5IB5B 1AO7A 1T1XB 3PP3K 1PG7H 1A3RH 2RCSH 1OGTA 4K5OA 1IKOP 1QLFA 5C7ZA 2Q7YB 1T1ZA