2YQ2A

Structure of bvdv1 envelope glycoprotein e2, ph8
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
332
structure length
332
Chain Sequence
b'TGCKPEYYYAIAKNDRIGPLGAEGLTTVWKDYSPEMTLEDTMVIASCRDGKFMYLSRCTRETRYLAILHSRALPTSVVFKKLFEGQKQGDTVEMDDDFEFGLCPCDAKPIVRGKYNTTLLNGPAFQMVCPIGWTGTVSCMLANRDTLDTAVVRTYRRSRPFPYRQGCITQKVLGEDLYDCILGGNWTCVTGDQLQYSGGSIESCKWCGFKFQRSEGLPHYPIGKCRLKNETGYRLVDNTSCNREGVAIVPQGTVKCKIGDTTVQVIALDTKLGPMPCKPYEIISSEGPVEKTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLEVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BVDV1 E2
publication title Structure of a Pestivirus Envelope Glycoprotein E2 Clarifies its Role in Cell Entry.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1
molecule tags Viral protein
total genus 55
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yq2A02
2.60.320.20 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 mini-chromosome maintenance (MCM) complex, domain 2 2yq2A01
2YQ3A 4ILDA 2YQ2A
chains in the Genus database with same CATH superfamily
3EOYG 1QBMH 4GAJH 4TVPE 5IQOA 3QNXB 3BEVA 4H25A 4Y19E 3ARFD 5SV4A 3RY6A 4OCWH 3RVWD 4P2QB 2GVYA 3D18B 5FWRA 5FOBA 4IOSA 1A2YB 3MHZA 3MRFA 3D39B 3WAJA 3ZDZF 4M3HA 2VDMH 4DAGL 4FFVC 5I0XA 4Z3TA 1FG2A 5IVXA 2J56A 2VDPB 5B7EA 3RKDC 3QYNA 4TTDC 1NEPA 3NK3A 4WSGA 1XH3A 5J56B 3MV9E 3OC8A 5CJOL 1S46A 3JV4B 1K2DA 4JKKA 1CLYH 1OHZA 5DJYA 1T1XB 2O6PA 3AMLA 3EJZD 4I0PA 3B3IA 1RVFL 3RI5F 2WLYA 3WIFB 4YQXL 5CZXD 3HS0C 4QTIL 1TTGA 1GL4B 1SF5A 3VWKA 3O6LL 1OCOB 2A74B 2WXFA 1CD0A 3SPCA 3D4CA 3KYOB 3LQAH 2VDOB 3ULUC 5DS2A 5HVHB 4AG4H 1G1CA 3O0RH 2DY2A 1WBXA 2G3MA 3BUDA 3VGAB 2F1EA 4J3BA 2NX5D 1WG3A 5CP3H 3KYMA 5DFWH 4ELKA 2AZAA 2NXYC 3H54A 2V2WA 4NT6B 1VGEL 3NZHH 1CXHA 4M9OA 5DK2A 1OCCB 4DQOH 4DZBA 1FGNL 1KENH 2C1PA 4B53A 5D7JA 1MI5A 1Q4NX 2CBMA 2YQBA 1GC1H 4XOAA 2F58L 1KG0B 2GBTA 5IB3B 2ZZUT 3IFPA 5HHPB 2XV2A 3P4LA 3WKNA 5D71H 5E1HB 3TNNA 1UA6L 4G43B 4C4BA 4PRDA 3MRNA 4H4NA 2EYTA 2WC7A 4OT1L 5GRVK 4AMXA 1KIRA 2BVYA 4BV1A 4JY4A 1WE5A 4AEIL 4UNUA 4GUPB 2YBGA 3L3OB 1JK9A 2HT4D 1S9XB 5AOLA 4Z0BL 4A2EA 4APQA 4H0LC 5KTEL 1S78C 4NIKB 4Q56A 5IQLA 4UTBA 1M3IA 2OA9A 1PD0A 3U36B 5C1MB 3RDTA 5B1KA 2DRUA 4HPOL 3VGDA 4NERA 4UAHA 3U83A 1CDUA 1YZZA 2G4GA 4HLZH 4R7NA 1OTTD 5IK3A 1XCXA 5HI3D 1JVLA 5AOIA 4ZMAT 1PIFA 1NGQL 3DTXA 5ACZA 3ZUNC 5LGJB 4XZ4A 3Q3GB 1DHKA 4KY1H 3TVMD 4OZFH 4FI7A 4MD5B 1U8KA 2NY1D 4NQQA 4WUKL 5MI0B 5FR3A 1VADB 5ISZE 1ID2A 4LOUD 5D7IA 3II2A 3IDUA 3WLWC 2VE6A 4PRHA 4OB5H 4MGXA 3GSOB 5BZXA 4JDEB 4PJHB 4E36A 4Y8DC 1YAZA 5DR5L 1D2PA 1I7ZA 1XB6A 2P5ED 3DO3A 4CC4A 2WLLA 4IK6A 2VSKB 1OAQH 4P23D 3L3KB 2Q3AA 5DSCA 2HT3C 2W9EL 1WD8A 5L2KD 1AXTL 4QKTA 2VW7A 2JFCA 3KVDD 4R0LC 2I9LB 4X4XB 4HGMA 2XTLA 3B7RL 2H6UA 1Z5YD 5CCJA 1JV5A 1T5KA 5H4YA 4PJEA 3S5YA 3B9KD 3SOBH 1XH1A 2DKSA 5J12C 1BJMA 3GLEA 1OAYH 2FECI 3C5ZB 3VH8B 4AYEC 4OF5A 4FTVE 2ARJQ 4ZSOB 5GS1A 1K8DB 4P3DB 1N68A 3WTYA 3NPZB 4MCZB 4AYBA 4P2OB 3QDJE 1CYWA 2JXMB 3TYFB 3FU3A 2XRAL 4R8WH 2BHYA 3PG2A 3V7AE 3GBML 3H55A 4NM4L 3PAZA 5ADPH 3LHPL 1OD9A 4AEFA 5I26A 3ZTJG 3U9UB 5TD4A 3ZMEA 1QUNA 5DYOB 3UDWA 2LU3A 4LIQL 2QQLH 1D2OA 3EYQC 3WV0A 1AGEA 4W9KC 4J1UB 3T8XA 2DAVA 1JD7A 2C9XA 5T33H 3B37A 3DHPA 1BOYA 3G5VA 4N24A 2MIZA 1D9KD 2J88L 3VB9A 2A1WH 3UADA 2HA1A 3S0PA 3TA3B 4MAYC 4WI3A 1D5IL 4N0YH 3K6IA 4KROB 3NCYP 5TFSH 1QRND 3PWUB 5J13C 1XCTA 1Q9OB 4N0CD 5KJ4A 1CURA 5DQJA 2Y7SA 4JMXA 4X42A 5JORB 3PQYA 1U8MB 5L6YH 2DQGH 2FYYA 1M1GA 3BPOC 3LPPA 5IFJA 4H44C 4N2MA 4AQAB 3O3DA 3NSDA 2LAAA 3E6HA 3IETA 2Z93B 1YN6B 2P8MA 5I1KH 1MCSA 1GS8A 3VYOA 1VCAA 3GXUB 2R29H 1P2CA 3L95A 4KKCD 4LLYB 3ZHKA 1A5FL 5K9JH 1IKNC 1VFMA 2IAMA 3JSSA 3T08A 3V52H 3VI3B 1NLBH 4U6YB 4OZGE 1MVUA 2EDNA 3RVVC 5AFAA 4KKLD 4FEMA 2GITB 3QW9A 4MB5A 1AGBB 5FYJE 4EZKA 1A21A 3BO8B 3VGHA 4ELMA 1C9SA 2H9GA 2OTWB 2GCYA 2DWEA 1E8ZA 4WO4A 3FYEB 1ORQB 3AT0A 1FFPB 1XSIA 3UC0H 1LEIB 4W68A 2DWDB 3HPJA 1F58L 3UOAB 2OSYA 1JIBA 4Y2DC 5DZNA 1CXKA 4YH6A 3BX7C 3PGFH 3WKPA 4POUB 4OLUL 4WWKA 4YC2C 1T2XA 4J8RA 1CB4A 3KLAB 5L8JB 3GJEB 1H5BC 1XB8A 1ACZA 1A7NL 1IL1A 3BGFB 4FOMA 5EU6B 3MLSH 3KPSD 3QPXH 2ORBH 1CXLA 1JXGA 3I9IA 3NFPA 1QTSA 3FRPB 2F61A 3B2MA 5CN1A 1AZRA 3B8SA 4F92B 3DECA 4GY4A 4F2MB 4X6CB 3MBEC 3BPNB 1YC7A 1N3NA 2V33A 4NOBA 2X4RA 2R0ZH 5F88B 2H4EA 5T3ZE 1N6VA 2PXYD 2E4FA 3BHBA 1SPDA 4WW2B 1DQQA 3RWHB 2FL5A 1GPOL 1FAIL 1EO8H 4FXLA 1BX2B 3UJJH 1V5JA 1NFDA 5C9JA 4MTMA 4CU7A 5I23A 3DARA 2QL1A 1S7RB 2NUPA 2VN6A 1VACB 4C83A 4F80A 5TF1H 1UOVA 4N90E 4JHZA 1F13A 1EDQA 2R0WH 1NAMB 3CFQA 3EOTL 3ETTA 2NY2B 1XCWA 1OKEA 1DE4B 2FNBA 4GRWB 3FB5B 4OAWA 1S8DA 4X6BB 2C4FT 5AW2B 3BAKA 5IMOA 2BVQA 5JXEC 3INUL 4P3CH 2P47B 4L4VB 4NRYA 1AKJB 1KJMA 5GS3A 3SO3C 2J6EA 2PWGA 2AI0L 4XMPH 3FSAA 2QR0A 4Z7WA 2R2BB 5CEXB 4QHUA 2BNQE 1AG6A 3MLYH 1PKQE 3VXRD 2P4AB 2HYMA 1RSYA 5BV7B 1EBAA 4LLAA 3MO1B 5H4ZA 4HWNA 3IAQA 1UZ8B 3OLIA 4V33A 1GZHC 5KW9L 5JTWA 2XWBA 5E4EB 2OP4H 1D7CA 3FQTA 4F15C 2DH2A 3CCHB 3K1DA 2V17H 4N8VG 1WHPA 4HULB 2CJ3A 5IHUL 4LHJB 3MXWL 1AZZC 1YO4A 4XXCA 4DP8X 2C8NA 5GGQH 4BRJA 2Q1EA 1TR7A 1A7RH 1PMYA 2HWZH 2J3SA 3CZUB 4PLKC 5TF0A 3TO4C 3CDGB 3N41F 3Q13A 1KBPA 3MC0A 4P5TD 1MIEL 3QJUB 1AOZA 3ULVF 3PYCA 4PJ9D 2H2SC 2HTKD 2OQJA 3B1TA 3G5WA 5IUSA 3GM8A 1MZYA 2GTZA 4U1GB 2I9TA 2A6KA 3GKWL 2FJFA 2AXJA 3GUTB 3MJWA 4HKBB 4YFDB 4XGZA 1NWOA 4AW7A 1DFBL 4AEHH 1G9NH 1TEYA 3NFNA 1LE5B 3DXAA 1RV6X 4HPYH 3CMGA 2VUKA 3NQKA 2XQYG 5AW3B 4BFNA 1AKPA 1XH2A 4NN6B 2EDDA 5EPMA 3SDCD 3NK4A 4IM8A 3N42B 4K3JH 1RZ8B 4KXAA 1UB5B 2AJUL 2VM3A 5HHOE 2HMIC 2Z65C 3W9DA 3BE1L 2C7UA 3GMQA 3EDFA 3HMXH 4GP5B 2AQ1A 5E94B 1WTGT 3LH9A 1HQ4A 3UC2A 4MA3B 1ZVHA 2R2CA 4N28A 2X1OA 3ZW3A 4Q97A 3QDGE 5I6MA 5IW1A 3ULVE 4LK4A 2Z35A 1W80A 2A6JB 1LO3L 3VXQB 4AY0A 4KTYA 4LSUH 2V7HB 2X44D 4YR6B 5EU7C 3VXTA 5EEZA 3P0VL 3E3QE 3A4AA 3GHEH 4TOYL 4YDLB 3UEQA 1FP5A 3HB3B 1ZHBA 5FO7A 3TU6A 4Z78A 1YEGL 2PW2B 1ROCA 2CGRH 3E2HC 3MLVL 1JZJA 3GJFK 1E9PA 1KNOA 4X9FA 4CAGA 4YHLH 3U30C 3C6LC 3KWWA 3MBXH 3HI6H 3TESA 3UTPD 1U8HA 2IFGA 2A0LD 2VXSH 1J9CT 1OK8A 4ZD3L 4XB7A 1T6VN 1SOQA 4MJIB 4UQ3B 4F7CB 3FO0L 1NDMB 4Y4FB 3AAZA 1X4YA 3GSNL 3RKPA 5HI5C 2VM4A 3FBQA 3O6ML 3IS1X 3QUYA 2VZ3A 3PUUA 1YN7B 1Z7JA 5L4FA 2BHFA 4G2AA 4XHQA 3QPQD 3C60D 2FB4L 1JXKA 1SLVA 2XFXB 4P0DA 5BPPA 4AQEA 2ZNWA 5EUKB 5AAPA 4KXZH 5A2AA 2H47C 4FLRA 4HZLB 3O41A 4DN3L 2D3NA 1F90H 4OLYH 4I7ZC 3WNJA 4KGLA 3GRWL 4QYAA 2WWOA 1TCRB 1CFBA 3GXDA 3IYLW 2MCAA 1JVKA 2CIIA 1BZEA 3BAJA 2BFVL 1ZY9A 2PR9A 5E1AB 1IM9A 1EFXD 5KYWB 5K93A 1FG9C 1N19A 4C56D 4H8PA 5SWSE 1AAJA 1IC4L 1P7QA 2IO5A 3X3GL 4MXWH 4F3FA 1R0AH 4NLHA 3RGVB 3LZLA 1GGIL 2ODIA 1FZOB 4OJDH 5CUSH 3BQVA 3PHQA 1MCOL 3DJZA 2B59A 2EXYC 3EFDL 2XT1B 1FL6A 1EAPA 2DWSA 4N2LA 5EOTA 4AQ1C 2AJXH 2HP4A 1IQWH 2XJLA 3NDYE 4ZDHB 3SGKC 3KEHA 2GEQA 2XWTB 4PJ8A 1N6QH 1TKWA 3RHWF 3TF4A 2F19H 3RPKA 3RTQD 4GNKB 3BUYA 2XZQH 1X5YA 3FQRB 3CHOA 1TVBA 3LS5L 4G71B 1U3ZA 3TN0B 3D39E 2EEDA 2XUWA 5C0CA 4XT1C 1S9VA 3MREA 4NUMA 2APTA 2E9WA 4KH2A 3OKLA 4FYTA 2FX7L 4K71B 4PJDE 1A1MB 1IE5A 1JNHA 5HSFA 3PJNA 3ESPA 3QULB 2IDTA 2QVKA 4GKNB 2BVPA 3QI9C 1OP5K 3U79A 1GHFH 1YQ2A 3X1FA 4OV5B 4JG1L 3CHSA 1EERB 4L3CA 2ZIDA 3P3UA 4KDTA 1WZAA 4IOSD 4GS7B 2B9BA 5FYJH 3TLRA 4L8SC 4ZBJA 1JPGA 3II1A 1DLHA 1SQ2N 1NUGA 5LQBL 3IPFA 4QR7A 2CJTA 1H8LA 3GSXA 2WXLA 1SJVA 4PBDA 3TIDB 4YXLL 4DGYL 3PGCA 1MWAB 3SGDH 3O3UN 4J27A 4MNQA 5C7ZA 2DI8A 1KDJA 3HUJB 1P4UA 1E43A 2XN9E 1RH8A 4KMLB 4NBXB 5FW7A 1AR1B 4I0PD 1OK0A 3FT9A 3IDIA 4WHCA 3ZSTA 4BK8A 2V2XB 2D7OA 1WPCA 1D3CA 5D6DA 4PGDA 3VWKD 1OAJA 4ANWA 2VXQA 3U9PL 3HBZA 3AGVA 4X7EC 4UQAA 3FCTA 3V7AG 5T3ZH 1RULH 4GRLB 1AIFB 4UIMB 1HKFA 1KBKA 2AQQA 5EORH 5C2BH 2OMTB 5LGYA 4Z76A 4QRTA 3OF6A 1ESOA 1SNRA 1G9NC 4W70A 1R6VA 3QFDA 4E68A 3C9NA 3LRHA 3BSZL 3VXSB 1NUDA 5LWYH 3MKKA 4QDGA 2DLFH 5D7JD 5KVDH 1F6AA 1O7DE 1MI5D 3S34L 1TJIH 4YBLB 3RLSA 2FWOA 2Z0BA 4UQCA 4NO0A 4D0CA 3O8XB 3O2DL 3KCPA 4HXBH 3TZVA 1D6VH 1N26A 4PRBB 3APNA 3HR5B 4JKPH 5EEWA 1X7SA 1ZT1A 1W0YT 5EIIA 5DUPL 3U6XA 3IFOA 1C12B 5ICUA 5I0ZA 2IALA 1QI3A 4TLKA 3O4LB 4RH4A 1XAKA 4G7YL 3MRMB 3LS4L 5AVZB 3ZMRA 5JOPD 1TZOA 4APQD 2XVLA 4XB3A 3SD2A 3EH2A 2BIOA 3RTLA 3UCRA 1Q8MA 3GEWB 2C3VA 1X3DA 4HC1A 1WCQA 1TJHL 2YRPA 1OOWA 3RDTD 1PZSA 4B7IA 1I7UB 2VLKB 4KGJA 3MJ9H 4PWHA 4G1MB 1W15A 1EMTH 4R97B 3QP3A 1ACYH 4JVPA 3ML8A 2EC9U 3GHBH 5KYUB 1HZHL 3OHXC 4MXQC 2GJ6D 2NY6C 3DGDA 4JCMA 4RCAA 1Y18A 4JM4L 5ABAA 3QIWC 1I8KA 3L1FA 4KV5F 4NPYA 3GUFA 1QFOA 2NXZC 2B4CL 5TQ0L 3HC3H 3SDDB 4PGZA 2WQ8A 3MA7B 4JRXB 4W1TA 3P11H 2OK0L 3BOVA 4OCNC 2H6PB 4DW2L 3AT9A 2H1PL 1MUJB 4FXGB 3VMOA 1WCBA 4CADA 4ZSOE 3NEEA 1TLKA 2DI9A 1UQSB 4GP4B 1ACXA 2PYEB 4PRHD 1J5CA 2B2XL 2YZ1A 3ATEA 3CSPA 5H37G 5D9SB 4HKXA 2CDGB 1OM9A 4MSWA 4EBQL 2CDFB 4HIXH 2EIMB 4M6MH 4JFHD 4AT6B 4OJYA 3EYOB 4NGHL 2L7EA 4ZTOL 5JA9A 4FQJH 4HCFA 1B6UA 2OW7A 4IJ3B 5DMKA 4ZUSA 2HRPL 2J2ZA 3Q48A 3UL4A 3HHSB 4JX0A 2RTTA 4K9EC 3SBQA 1DQMH 2BLFA 3QXAA 1VZGA 2W80C 3QZOA 4MAUL 4ZFOA 1KC5L 4UDUB 2YEVB 5I9QB 1L0YA 2WYZA 3EOBB 3GINA 3NZSA 4R84A 1KGUA 5AENA 1QSEA 1ZGLP 3GZQA 1HAUA 3QQDA 5CU5A 2PCPB 5AW0B 4WY7L 2DQJL 3L5XH 5F1KC 1K5WA 1EVUA 3CZEA 1NBYA 2VQ1A 4TRPL 2O6FA 1AI1L 3MA9L 5CIPA 3VFTA 3CDZB 1JDAA 4OI8A 4OGYL 5FHBH 2IQ9H 3KLQA 5CD3A 3MV7A 3L9BA 1KIPA 2ADJA 1OTSD 3WEOA 4RAVB 4PGJA 5D7HA 1OXYA 3Q1SL 4R4NC 1Z9OA 4ZYKA 3D0LB 5D72H 3DTUB 2ENSA 5J8OA 1CXEA 2VLLA 4X6CF 3DA0A 1BXAA 4IRZH 5D7LD 1J10A 5EF1A 1X4XA 1GGUA 4L23A 2WHVA 4WW2F 4FCAA 1RPKA 3DNKA 4G5AA 2OTPA 1RHHB 3ME0B 3PQYD 1D5ZB 5FDWA 5JQIB 1FLTX 1E5AA 2GBAA 2JKNA 3F04A 3CZGA 3LH2H 5AB2A 2F54B 2BOBA 1U93A 1YUHA 4OLWL 4B96A 4ORZC 2YD1A 2WMPB 3HW7A 4FMKA 3GO1H 1PL3A 3J7HA 4M8RA 2EXSA 5TE4L 5JW5B 3KPPA 3IMSA 3HRZA 5ALCH 4NN5C 2X87A 3OKOB 5HGDA 2ENPA 4GRWF 4LB8A 1LQSR 4AM0B 3IVKB 4OJFL 2DIBA 4ODUA 5DUJA 2IAMD 3U4EA 4B97A 5A2IH 5IQ9A 4K23H 2XVKA 1M6UA 1FFRA 1VZIA 4M1DL 3U1SH 4K5MA 5GJTL 3VSTA 3PUCA 5G4OA 4DOHB 1T03L 3VXMA 3OB8A 5DWUL 5E6UB 3Q8FA 1ZHLB 4LLDB 3TEZA 4DKFL 3NIGB 3MODH 4WHDA 3AZUA 2FO4A 4X6CE 3QFJE 4F2ME 5C07A 3AT8A 4LASL 1XF3A 3ZL4H 5IMMA 1MCBA 4KRMB 2HVBA 4WO4D 2RGSA 5GIRA 3BP7B 4XVTH 3OKKA 1KXQA 1WWBX 4Y9FA 3O0LA 4TLSA 2ZUQB 5FCSH 3B2DC 5I30H 1GS7A 4XMKH 4AVKA 3PP4H 5AB0A 1TSRA 5C7XH 4P4KB 1Q0XH 3HAEA 4KQ3L 3NTCL 4WFGE 4DGIL 3C09C 2ZXGA 4UZGA 2JE8A 5DJZB 5E2WH 4DH2A 2P8LA 4WWKD 2OSLA 4ZMZA 4JFYB 2AQ3A 2X6VA 1YMMA 3VFUA 3VFMB 4RMTA 2JB6A 2YPLE 4GRWE 4YEFA 1X5ZA 2PLTA 3MTXA 4LPTA 4OM0L 2WNGA 4NQSA 5F1OB 2IPKB 4BWWA 3S5LG 5IEKB 2VDPH 1PAMA 3MJ6A 4PCTA 1HZLA 4HIHA 4LU5L 3UZVB 2PWHA 3B2VH 2JMRA 1MCQA 1KGJA 3QHFL 2X0VA 5E2JA 5L88H 3ASNB 3QT2A 4KHXL 3QXWA 1F4XL 3T0WA 3VG9B 5K9QG 4R96B 4I9WD 3L1GA 4F27A 1AMXA 4UDTA 3C5JB 1FO0A 4ZX6A 4IIQA 5LGHH 5KG9B 5HI4C 5AAWA 3N42F 1LMIA 1U2HA 1WT5A 3T1WA 3JZYA 1TUPA 3QZBA 5I76B 2XYCA 1R5WB 2VDOH 3VVVA 1X4ZA 1O6VA 3WFCL 5I73B 3QWOB 3QORA 5AOMA 3VMNA 1YEFH 1C08B 3GBLA 2BIPA 2UY7B 2CO6B 4NQUA 5C3LD 1HZKA 1R19A 2YARA 4XH2A 1CGTA 3FN9A 3S36L 1AHWC 1Z1WA 4NKMB 1ZSDB 2E0PA 3TH2T 3FHEA 4W9HC 3PWPD 4UTBL 3RIAK 1KXTB 3NPSC 3IAPA 1O6TA 3IJEA 4LCUB 5FPIA 1I1YB 5ILTH 4TTGA 5DC2A 5E1QA 1BVKA 2XTJD 2EDLA 1GGCH 3OR7A 1DSWA 2IVFC 2IH8A 1I9JL 4PB9L 4X5RA 4JFPA 4K8RD 1IIIA 3MYJB 3VD5A 5F97E 4KNQA 4XMWA 2GSGB 2Q0ZX 2WIIA 3F6IA 2YRLA 1C5DA 2D7TH 2NQCA 3N5AA 2H5UA 1E3FA 5IROC 3R06A 4XOEA 1T1YB 5F0LB 4KXBA 1BF2A 1JWMA 4XC3H 3FF7A 3QUXC 2VTFA 4FABL 1KLGA 1P84J 1RK7A 1LLAA 3JWOL 2K78A 1PZCA 3DXAD 1FNSL 4FHKA 6FABL 3FZUD 1KTRL 5HGAA 2D73A 3WN5B 4N0UB 1SBSH 1JGLH 3KPLB 4YDKL 3I2CH 1L7TL 3D85A 1THAA 3FMGL 4MKMA 2Q87A 2X89A 4XMXA 3G04B 1KTKE 4MQTB 3ULVC 1F1DA 2EDFA 1KGWA 4MHHI 1J1PH 1OZUA 2HJFA 3MLUH 1MFCL 2WLIB 2FGZA 1LWJA 3AU0A 4Q0XL 1P5UB 2IPTH 3AM8A 4QHKJ 1VKXB 3H2WA 3OKMA 4Z7UB 1PEWA 3SE8H 3MLTB 2YD3A 3HVNA 3TYGL 1B4JH 3VXPB 5AG8A 5AVVB 3BKJH 3V6OA 3WEXB 5EFIA 5FXCH 1PU0A 3U6RB 5FYJU 4AMKH 4PBWD 4WI9A 2BP8A 2HFFB 4HH9A 5EZLA 5JZ7C 4AK2A 1NAKL 3IN2A 4Z7OB 3EGDB 2HFEB 1SGKA 2B0SH 4K4KA 4ZS6D 3L4ZA 3OPZL 4IKJA 4K07A 5J7CC 1NMBH 4YX2L 3ZJAA 1UH3A 2Y2YA 2GJZB 3GPSA 2EE0A 1J0HA 2A73A 2COQA 2IFFL 5LGKA 2CCLA 4LL4A 4QNPF 3AG4B 2FX9H 5A2LH 3EYFA 4YUEH 2V8MA 3KYNB 2XZAL 1DUZA 1HWWA 1S2EA 4XBPA 5BZWB 3AXIA 3QUYD 3B83A 4KDVA 2QFPA 3O3BB 1IM3B 4HD9A 5DJXA 3LZQA 2BMKB 4PY8J 1GYCA 3A23A 3K8KA 4OJEH 3DURA 1ZEAH 1M05B 3KJ4C 4FRWA 1ETZA 3UROR 2YSSB 4IGBC 5D93B 3IGKA 3BJLA 2WZ6A 5C71A 1BHGA 2NRDA 3QH3B 5CWSB 3ZQWA 3GMLB 2M1KA 3EZJB 4CVUA 1AGCA 1O7VA 3LQZA 1AXIB 1USZA 4IW4C 3W82A 5I6OA 3SPVB 1VFBA 3FSZA 1IM9D 2E7LA 2VJXA 3MRPB 4JN2B 3L5WA 3US9A 2TSAA 1IO4C 4JKLA 3MLWH 1P7QD 4QNPE 1MDAA 2AF2A 4OCYH 4QJ4B 4ADGA 4ZG1A 2BRQA 2FVNA 2X7LB 4KQ4L 1IBBA 5KVEH 1E5CA 3DJ9A 4PP1C 5DD6A 3HUJF 2APFA 1SM3L 2JB5H 3AY4A 3FO9B 4LCIL 4DN4H 5IJDC 3M6DA 3CFKB 3LEVL 3CSTA 1GYVA 2WQWA 1ETB1 1G7LA 2J73A 2DQIH 2OI9B 5FA4A 4D3CH 1NGWA 4WGVB 3WEMA 4DGWC 1I85C 1J11A 1IZKA 1KOAA 2VDNB 4PJ8D 2BY2A 1FV1B 4PLJC 2EDRA 5TDPB 3NJNA 4ODWA 4TYUA 4LVNB 5DI8A 4WJKB 3GWJA 3UGEA 1Z9MA 4K7PL 5B21A 3O9WB 1O0VA 5EH1A 3U6XS 1XSKA 4F9PA 4JPKH 3WFBL 5C0CD 4LHUB 4Z5RA 2D7NA 4NWTH 2ZCLH 3R7RA 3GJFA 3N0PB 4I48A 1CFSB 2ADGA 2M26A 3S8WA 2Y2TA 2E6PA 3N9GL 2VMCA 3AQZA 2OJZH 3P9MB 4PW3A 5CGBA 1T66D 1F56A 4AYDC 1CGXA 5KZCD 1D7BA 3EBHA 4U49A 3MV11 5CNHA 3FQUA 2EVGA 4U33A 3FCSB 5FO9B 3CQFA 3F6LA 5DLML 4JDVA 3V0JA 5C6TH 4Z7VA 4G6JL 5I1IL 5LLIC 3PWVA 2Y06H 1RQ5A 3B6SB 3DGGB 3QIBB 5JIPA 3VFRB 2UX7A 2YOCA 3FUKA 1XMWA 3HN5A 2VO8A 5HJ3A 1QFUH 3CHRA 2EKSA 3FONA 4NQEE 4U1SB 1HH6A 2FGWL 1KYFA 4H8WC 3DPDA 5BQDA 2J6EL 1CPUA 4MNQD 1C5BH 3O3AA 3VX0A 3QXDB 4TSCH 3LPOA 2W65B 3IJYA 1EJOL 1NPJA 3L81A 3VXSE 1JRHH 2X4OB 3CC5B 4PTUA 5LN4A 4K2UH 3QRGH 3S48A 2YEZB 3QO1A 1G94A 1AFVL 3RL1B 4GRWH 2YWZA 3A0OA 5I1GH 3I6GB 3NAAL 5D1ZB 4KMTL 1MCHA 2CBTA 1TMQA 4I3RH 3ATDA 1KYDA 4Y2NA 2WSPA 2XQBH 2FJGA 5ID1B 4GW1B 5MEPA 1O7DC 5T1JA 3QJRB 4K8RL 1F3DH 3SHSA 3HZKA 5DD5L 1RSFA 1P6FA 3IDMA 4MBRA 3OF6D 3JTSB 5I0WA 2AEPH 2P24B 4K7FA 4YIQA 4KJPD 3T4AA 1C7SA 1BXXA 1VSCA 2Y5TA 1QRKA 3ALWA 4MMYA 1F86A 4WLCA 2GK0A 4DP1X 3G6DL 2XVBA 4NO0D 4ZAKA 4NQCB 2CXGA 4Z95L 3ZDXB 3TZVD 1AZCA 1ZE3C 5DRNB 2R1YB 4EJ1C 2H8PA 5AVRB 3AU1B 5AVTB 2QLYA 5C0RH 3WNLA 4PJBB 3FO1A 4TUOB 4M8QB 5LNEA 5T1KA 4GMTH 3PE9A 2X4SA 3WO3B 1MRCL 1KELL 1XGZA 3ULAB 1RL1A 5F8RC 3DJSA 3FUDA 4BEIA 4LSTL 2QTEA 4ONGL 1XR9A 3HI5L 3NN8A 3UAJD 3ZTNH 3K6DA 2ERJB 3WJJC 1EDHA 4GFTB 2XV6B 4UMSA 5GJSL 4AYSA 4LKXA 3W57A 4YNYA 4RZCB 4E2OA 2BSSB 3GT6A 3ILDA 3QQ4B 4B9ZA 3L13A 3CX2A 3QUGA 1JK8A 3QWQB 5GRYA 1TZAA 4HSAC 4LSPH 5HHVH 3NGBB 4D0BA 1OLZA 5FUOL 1L9QA 1IAKA 5CILH 4DK5A 4HHGA 3QR1A 3ARGA 3RI5K 1GGBL 3H3KA 3IT8D 1JZ6A 2IANA 5IVZB 1I1FB 3DHMA 5CEYB 4NPKA 1MF2L 3PXHA 2O5ZL 4TVSa 1SVBA 2H0EA 1WVZA 1QD0A 2PETA 5KYNA 4JN1H 5EZOL 4RFNB 3JWDH 4ZI8A 2R9HD 1J5OL 3DVGA 4XPBH 1DBAL 5HDBE 4PJFA 2YAMA 1LXMA 5KVMC 2DTSA 2ZF8A 4UINH 5JHMA 4WK4B 1VFAA 5T3XD 2DMKA 3UYRH 5FUZH 2FWLB 5F7EL 5BQ7A 1HL5A 4PJAA 1HL4A 3LIUA 4RGND 4P2RE 4BFGA 5CLXA 2PPCA 1OSEA 2ZONA 2RALA 1LJMA 1TFHA 4XO4A 5CHNA 4KO6A 1NC2A 2JKLA 4N1CA 4JVWA 4PRPB 1Q9KA 1OAZH 4RAUB 3TA3C 5BNXD 4BA8A 4M6AA 1E30A 3NABH 4M03A 5KVGL 3ZKMC 2AITA 4JLRB 3MXVH 4PRAA 1JF6A 4AGMA 3OJDB 5K39A 1FH5H 4E5XB 3WS6C 1QSED 3U0TA 5KSAB 3FUIA 1YNKH 3GMNB 3NIGF 4HK0B 3L16A 4MNGB 4JG0L 4JPQA 2FRGP 2IOOA 5DVLA 5TDOB 4YSQA 3CN1A 4MA1B 4N4YB 4AEEA 3FQWA 3HS0A 4JZJB 1R46A 3RX9A 1XTLA 2EDYA 2UZXB 3B7UX 4OGXL 4RFEB 5F9JB 3FB6A 2AERT 2BJMH 3FU5A 4P46B 3VGGA 1HNYA 4N8CH 4BE5A 3MV7D 2VSCA 4GKOA 4OTXL 5LN8A 3H53A 1U2YA 4PG9B 2YKKA 2MOQA 3U0PA 3R1GH 3PJLA 1U4FA 2AXGA 3SGDI 3P0YL 3F5WA 3DO7A 2AEIT 4NAMA 2OR7A 2JKXA 4LEEA 3H9SA 3JQOB 1T80A 1UWGL 5I18L 4FA8A 1EQWA 2W91A 3ROLA 1UD6A 2ZWYA 3BVDB 2ZXEB 3GSRB 5E95B 5BRZB 2FQEA 4GO6B 3L54A 3WTXA 2O26U 5K5YA 1OTUD 3VG0L 4ODBD 4D9LH 5EOCJ 3NP3A 3FTGB 1NEZB 1J0YA 2LABA 4K5LA 3OD3A 3NT0A 1QWUA 5AKRA 4ADJA 2ICEB 3OKEB 4KVNL 4X6FA 3GXTA 3IJHB 4HDIB 3V0DA 1EHXA 5CF3A 1RURL 4A6YH 3PXJA 1DFXA 4NWUL 3G5XB 3K6SA 2JK5B 1RLBA 3FB7A 3DROB 5CGYD 1UASA 3BP4A 3AS0A 1QRNE 3IKCB 3VXMD 4NBZB 4BE6A 2QVIA 3QIUB 2GAZA 2F5BL 3QZNA 1AYRA 5GZOC 5C07D 1DUYB 2DIJA 1SN5A 1EAJA 4WHYH 2AABH 4GSRA 3K4DA 1ZLDA 4H0HB 2Y23A 3B9EA 3QAZB 2NY2C 1TZ8A 2ZCHL 2BSDA 5EZIL 3L5IA 2KLTA 2GHZA 5FFOA 3PU7A 4OD2B 2J1KA 3VYPA 2RQ8A 3GHPA 3SY0A 4IKLA 4EDXA 1YMMD 1Z9LA 1T0MA 1P4IL 2HT2C 1V7NH 5F1IB 2OZ4H 1ZSHA 1DN2A 1RUMH 1CDBA 4WV1B 4Y5YB 3EOAA 4LVOB 2DQHL 5CP7B 2VXQL 4MJ5B 3G5ZB 2F74B 5FEBA 1L5GA 2DBLL 1KIUA 3A3YB 4G9DB 5BV7C 1QLRB 3WKYA 2ED8A 1MWAH 3V6FA 4Z77A 1OAKH 1URIA 4XPGH 1GY2A 3THMH 4ONHB 2FATH 4AYGA 1I8IB 5C09A 5CKAA 4R0LA 1I7RB 2C9RA 1WC7B 2VITB 4X8GA 5IUCA 4Q9QH 4TQ8A 5JPMB 5J57B 1XIWB 5C0BB 5J3HC 3X12B 3H0TA 5ANMA 1KB9J 1W0WA 3REWB 4ZX3A 4XTRC 1E27B 4J8QA 3DLQR 5JHDA 4BSWA 1PQZA 3ARZA 3EO0B 2F8IA 1AS6A 4OUUB 3MOBL 3MUZ1 4JFSA 3US1A 4YSDA 2LFEA 1W72B 3NUKA 1A3RL 2XX0A 3QORD 2X5PA 1NCIA 1OGAA 1YEJL 2XY1A 1S6NA 4UUJA 3L4WA 3SJVB 4AUJA 4CRPA 4CSPA 4WFFE 1QR4A 1A6UH 2NY5H 1RIVH 4WUUB 1MFBL 2YMOA 3GMPB 4F24A 2J5LB 1OEZW 1EEUA 4HC1L 4NN6C 4G9FB 5GPRA 4YHNA 4EZMA 3K2UL 1E5YA 5CJQH 1LE9A 3C2AL 4Z7OF 4N6RA 1SJHA 3JWDC 1MFAH 3QZWB 1B2YA 1MHHB 3HI1B 1HI6A 2W0FB 1I9IL 3APDA 1DVXA 1LD9A 3P69A 1ZVSB 4MAYA 4OSUL 1DQKA 3PAUA 2PR4H 1BGXL 3X14A 4GSQA 1E9QB 5FK9A 2F7QA 4P5MA 4AGOA 4NS0A 3RWGB 1OARL 4NUGL 2CJSA 4WHYG 2P49B 3TXAA 4YDLC 5K9QI 2BVTA 4C47A 4NUQA 4GAGH 5T3XL 5E00A 1CD8A 2CLZB 3BP5A 2CA4A 1RJZB 5GGSB 3U1QA 1RPUA 4OD3H 4HJUA 2UXVA 4Z7QB 1G0YR 3L3GB 1UWXH 4LSRL 4ZTPL 3UYOD 2E27H 3KGSA 5JW3H 1IKNA 3QZPA 4NHUB 4B9IA 2VM9A 2XCMC 1B2WH 1VPOH 3D85D 4FKEA 3LKNB 4HUMB 4XCFH 4ZFZB 2X89D 4CC1A 4QRRE 1PX8A 2X4NA 1N0XH 4OKVA 4Y4FC 3NG5A 4QT5A 5CBEA 5CLYA 5JDSA 1GKEA 1OWRM 4H0IA 1HQRA 4PIBA 5CCGE 3TASA 1RIHL 3RNQA 3VXOB 4YAQB 4ZFOL 3IKKA 2RJMA 5D96C 3E7JA 3VA2C 4ZO9A 4S0SD 4Y9GA 2JNZA 3WLBA 2BS71 1AS7A 4N0FA 4NRXB 2YA1A 6TAAA 3GSVB 1DVFC 4Y2DA 3EHBC 4N2NA 4JZNB 5DD1H 3Q9QA 5GRVL 1H5BA 2FQFA 3R19A 7PCYA 1A9BA 4IS6A 4PJGE 2D03H 4GAAA 3RL2B 5K33A 2IDFA 2PTVA 4M93C 4LP5A 5D70L 4IRSB 3NA4A 3MBEA 1KF9B 3ILQC 4FNQA 2JSFA 2PKDA 3OJVC 1IC7H 5K9KA 5FGSA 5IJVB 4PGBB 3MGTA 3CHQA 1SVZA 5DD3H 5SWZB 4QO1B 1G6VK 4AENB 1DEEB 1WIOA 4PP2B 4Y1AB 4JFFA 2ZQKA 4ZS7H 2D7MA 5HGHB 3FUHA 5I5MA 1PYWB 5F7WC 2DM7A 4YPGA 3FU9A 4TN9A 4JG5A 2IADB 1RU9L 4ISVB 1DBBH 1DQJB 5EA0H 2C9AA 3DBXB 3KPMA 5JXEA 2WGNB 1EFQA 3I6KB 4BK5C 1KBGL 3KPNB 1HDMA 1X9RA 2AV1B 4NZFA 5GS0H 5AWNH 2BRRH 2VDQB 2WZ0A 3BFWA 1J8HB 2XA8H 2YD5A 4JL2A 1ZMYA 4XCNA 4ZXBB 4IEFB 4A39A 1AC0A 1FGVL 3VFSA 4DVRL 3D2UA 2WQAA 3L1OH 4K71C 3F8UB 4PRIB 3U7AA 2QSCH 3VXUA 4E0RB 1TZIB 2K9FB 4R26L 5E8NB 3EO1A 1KCVH 5HDWA 5TE7L 2ZOLA 4EI6A 1YHPA 3GXFA 2WZPA 1KCSL 2W07B 4JFEA 2QHRH 4JANA 1GZHA 3L7EA 4R5XA 1RZJL 1MFEL 2WXPA 3MX0A 4LLWA 3BZFA 4JO4L 4ABUA 3D12B 3GMRA 4KKBC 3ZGIA 1H3XA 3JWNE 3JTBA 4OFDA 4KAQL 3OTTA 4Q9RL 2CRYA 3WFHA 1WBZB 2G9HB 3TO4A 1FZKB 4WQOA 4XHJC 5F0PB 3UABA 2B08A 4PI2A 5ID0A 1E28B 1XGUA 3IJSB 3TM6A 4HUVB 2WJ5A 3ZE1E 5GS2H 4PY7A 2XWXA 2AJVL 2KYIA 2ITDA 1D5XB 2DEYX 3QO0B 1MVFA 1M71B 1TOXA 2F5AH 2IH1B 2B77A 3AS2A 3T6WA 4AL8L 4YXHL 4AIXA 2ZOKB 4NKOB 2NY0D 3OXSB 3LAFA 2OJ1A 1NM4A 2NY3D 3EZ8A 4M56A 5B1CA 5GRUH 2QGDA 5JXAL 5F7BA 1T1WB 1UH2A 1S5IH 3ZDXF 1JV2B 1BBDL 3BWAA 1M6OA 3QXUA 4QTHB 5DEGB 3U4BL 4UU9B 2FR4A 3RIKA 4BZ2H 4MS6A 4MQXC 5JYLA 1ZTXH 1PFOA 3O45A 4OI7A 4HF5L 1FO0L 5GGUA 1FF5A 3WKQA 1JZIA 2OLDA 5J6SA 5DYFA 1NGXA 2DMGA 3NQIA 2RCSH 1EANA 3RJQB 3MNVB 4TUJB 3DX9A 2OMYA 2A9DA 1I1RA 2NY5C 4JM2B 1KLFA 4L9LB 4I2XE 4KY2A 3BLPX 2A9NL 3U7YL 1OB0A 5INDB 4M1CC 2A9CA 1NANI 4Q2ZA 1VFOA 3O8XC 2YGNA 2Z91A 1AHMA 3HC0B 2KPPA 2BIHA 4DHLA 4F9LC 1OO2A 3VD1A 4HUKB 5KS9E 4ETQB 2WXGA 5FS5A 4MZ2A 2A6DB 3LXAA 1ZA3A 2B5IB 3I3DA 5KBNC 2YD2A 4ALAL 3C6LA 3JUZA 3S88L 3ZDXE 3WIHH 1RUPH 1XZWA 1CLVA 1Z0NA 5I1DA 2ZG2A 1BD2B 2XKNB 2HVKA 1G7MA 5DJ0A 2BP3A 2C3WA 3FDWA 4IOFC 3RHWK 1H6TA 3A47A 3AXLA 3QEGL 5JUEH 1FPTH 2FECL 1UURA 4TNGA 2P5WA 4RAHA 5CZXC 3SE9H 4NEHB 1YJDL 4GKZB 5JA8B 1HCVA 4GIAA 5ETUA 3HN8A 3FQ2A 1CLCA 5JHBA 4N86A 5IKCB 1PNDA 4JFXB 2CIKB 4M43H 3UJIL 3FO2A 4LLQA 1XGPB 3ULSA 5JPNB 4Q9BA 4N8VA 4ZAKD 1WFJA 4XMTA 3CXHJ 4Q8BA 1NCAH 2CUIA 2VXUL 4KTDL 1G7PA 2EUWA 5IB4A 2FJUB 5E2UH 5T1KD 4Y0GA 2I69A 5TE6L 3VD9A 2VR4A 3T4YB 2FZ3B 5AZEH 4YDNA 5DFAA 4MXVE 1S3KL 4F7MA 1CO1A 1G6RH 3BUIA 4A04A 3DRTB 2XPGB 2UXFA 2IOMA 4HJ0C 4OBIA 1N59A 4HAGA 3IXAA 5E8DL 5C0IB 2ALAA 3L4YA 4XO5A 1JSYA 2XQYA 5T1MB 2F0CA 3CLFH 3R8BB 5JQ6H 4DVBB 1HJCA 2QGEA 3SGKA 3FU7B 3GMOA 1BVLA 2VISA 3ARGD 3GBNL 2HT4C 4I88A 4LSSH 4F8OA 2IAND 2X0UA 4GBXC 3A6BH 4NUJB 3ALPA 3BPCB 5I9QC 1V3KA 1S4IA 4PJ7A 1U8OB 4BFJA 3DHJA 1A7QH 1IEAA 4FULA 3U7WH 4CA4A 3D3VB 1B0RA 4PRPE 3ZT6A 5TH2A 4UMGA 3BWUF 4XPFL 5JMRA 3U2SB 3GQFA 4XVJL 4UOZA 1M7IB 4Y19A 3UERA 2YPVH 1RMFL 3UTSB 2VJ0A 2ZP8A 3RB7A 2ZOOA 2ZXCA 4GW5B 5CLTA 1KB5B 3WXVH 3J07A 3QI9A 1MREL 2BNRE 4WKXA 3VI4B 1TXKA 2AZUA 2GJ6E 2ITCB 4R90H 4Z7IA 4XR8C 5GS0C 4LOUC 4G8EB 2DOCA 3SKJL 5AOKA 1DLFH 1L0QA 1NC2D 1S7SA 3MV9A 3NACH 5A40E 2QSVA 3FSOA 5I1LB 4L8SA 4IKKA 3IWVA 1MQKL 2AP2A 4QLRA 1S9WB 4FFVD 1FA4A 4J23A 1GMIA 3WXWH 1OP4A 3W11C 5A2BA 1MNUH 3QWNA 3RKDD 4KPHH 1B9KA 4TTDD 4F2EA 1KCRH 1SDDA 4G11A 2X70B 4ZMYA 3QEHA 5DURD 5C08B 2MCMA 1SYSB 4GAYB 4JHBA 4KOCA 3UYPB 3NSCA 1ADQA 4MDIB 4G8AC 2HXAA 4LAJH 3PDOB 4JO1H 4A55A 1QFWH 4U6TA 4KNSA 2YHGA 3WO4B 1NGZA 4J6IA 3GIZH 2IIJA 3OSVA 3A6CH 1IGYB 4Z8FH 1C16A 2OXGB 3ULUD 1YYLH 4JFZH 2BNUA 5AW5B 3UBHA 4KRLB 5EC2B 4QOKB 3CXFA 1BJ1H 1SJEA 1QYGH 2W5PA 3F83A 2IBZX 4O2FA 2NXYD 3MFGB 1U6AH 3BZDA 2MFNA 2NYYC 1PLCA 3PL6B 4F7TA 1U91B 1PY4A 1ASPA 5B4MC 2OAAA 1A6VH 1I9RL 2OMXA 4M6NH 4BSVA 4JJOA 4NHCL 1UH4A 3TTYA 3CH1B 1QNZH 1O5DT 5CSBA 2R15A 2CXKA 4FQLH 4M61A 1FL5B 1JTPA 1ZT7A 4WHTB 2GKIA 4LCVA 4UILL 5EEUA 3BRFA 1P0SE 3HMXA 1QNIA 5I1AA 3HNSL 2G75A 2YAEA 2VDNH 4JPWH 4MQ7A 1PZ2A 2VLJB 4HWEL 4UOJA 1UM4L 1A02N 4B27A 4FG0A 1S78D 3NSXA 4X8CA 3MROA 1O6SA 5D7LE 1M7DB 3IMRA 4WKZA 1BM7A 2Q20A 4IOIB 1NL0H 2J1YA 4OQ1A 2P8PB 4XPTL 5CR8A 4AV0A 3TEWA 4AZUA 3KDPB 3OHXA 4LOEA 1RK0A 2DJMA 2W9DL 3KXFB 5ICYA 1JFQH 1Z3GL 3QIWA 1F2QA 4OFYA 5DC4B 1S7QB 2CGYA 1CQYA 2WCGA 3FQNB 4HMDA 3K91A 4LCWE 1F4AA 1LM8V 1XL4A 2XVGA 4JM0A 2YPKA 3CSFA 5C0BE 1E7UA 2JJWA 2P44B 2J8UB 3RA7L 4MX7B 1UWFA 5AUMA 3VVWA 3QCTL 4GMSH 5FM4A 4HFUH 4XWGL 4R2GB 1FZJB 4EI5B 1OM3H 1ZWIA 5FYLE 3WLWD 4GQ9H 1PY9A 3FTUA 4JB9H 2ZSVB 3RY5A 3S35L 3DUUB 4QXUH 1M2VA 1S7XB 5EHFA 1WUNT 3HTLX 1MKFA 5BJTB 1IAIM 2V7NA 4FTVA 1M1HA 2NUTB 3T8MA 1UM5L 2HT3D 4KBPA 5J6GB 5D7KD 5C09D 1D5MA 3BEWA 4HV8A 1DVUA 3QDJA 1HOCB 3M1BA 2IDQA 3GXMA 1A3LH 3DX7B 2AXFA 5CEZE 3DMMB 2AQRA 3S2AA 4NIYE 5JHDD 3GTTA 1A7BA 1HEZA 32C2B 4EXPX 5F7NC 4LBEB 3WL9B 4HJGB 4UZUA 1TQSA 4XNZB 2GJRA 3S3PA 3BZ4A 4UQEA 2EVIA 2ZPKH 2QVMA 4FNLL 4QHKI 3D9AH 1OGAD 4APXB 1WFTA 4Y2LA 3PV7A 4YHOL 1DJHA 4UT7H 4AKPA 1CE6A 1YPZB 5KVFH 1F1AA 3B34A 4HCRH 4J6RL 1LMKA 4D0DA 5B1AB 5CBAB 4KJYA 4C55A 4F20A 3KYKH 3ARFB 3VCLB 4BGLA 4WU5B 3I6LE 2AEWA 2W8CA 1A14H 3EYQD 4XNXH 4PD4J 3B9AA 3MCG1 3OJMB 2BSRB 1RFDL 1JN6B 2Y7LA 3VW3H 4XZUA 4TQIA 4DCQB 4XN1A 1OF2B 3TO2B 1MCPL 2QV2A 1NGYB 4JKNA 5HHXL 3WMSA 4I5BB 2N0MA 1WO2A 2Y07L 5C9KA 4NZTH 5EO9A 1H3PL 1BP3B 2J6WA 1E67A 4WI6A 2OMZA 3IF1B 1KJVA 2BO0A 4XXDB 1UCBL 4OIFA 3JWNG 4G7QB 2GTWB 2NCMA 2UUDH 4Z3HA 4PY8I 3PWPE 1SDAB 3QG7H 4PJ5B 1AJ7L 4RNRA 4OZGA 4Q6IC 1J05B 1OPOA 3JT0A 4S0TD 4J12A 4S1RH 3WSQL 1Y6MR 2AJ3A 2XTJE 3TTSA 3ROOB 2NX5B 1NBZB 2YSTA 2J43A 5A3ID 1DBKL 1O75A 2G5BA 3RVVD 1P84K 2NYKA 4KKAC 4HOMA 1BXVA 3KBEA 5BVJB 1G1KA 4L8BB 1G5GA 1XD1A 2FWSA 4ZMLA 3TJPA 4ZMPA 1MOEA 5D7SH 3D25A 4MB1A 3K6NA 4TQEH 2ZXWB 3DUHA 3EJYC 4AVJA 5A7BA 4XRCA 1ND0B 1I3GL 1QACA 5E5MA 1U0QA 3L5JA 1SXSA 5D93C 5SWZE 3UTZB 3STLA 1ET5A 4Y1AE 2PTTA 4Y2DD 2ZAGA 3QCUL 2JCCF 2KS0A 1BQUA 3BESR 3RAJH 3TX4A 3DXAE 4ANUA 4ZFFB 4JHWL 3S97C 2P52A 2F53E 2HTLC 2M8XA 4XPHL 3WDIA 3LXBA 4HS3B 2WNWA 3B3BA 5KBMA 4P5KA 4CBZA 3MJ8A 3MBED 1DBJL 2XXGA 3HG1B 3ULUL 1KTDA 3TT3H 3LIZA 1E6JL 2G2PA 2CK0L 5IF0A 1IILE 1KT2B 5GGRB 3BVUA 2AJZB 1WA2X 2WO3B 2DWXA 4P9HC 5MP6L 1XGTB 2VIRA 1AO7B 2FSEA 3IE4A 4JFFD 4OM1H 3BH8B 4TULH 1RZFL 1IC1A 2Z92A 2BXYA 4U1NA 3P30L 1MCIA 4Z3GA 3FOMB 3TVMB 2A4CA 2GSIB 3QXTA 2NY1B 2BNQA 1E4JA 1U8QB 1A66A 4YE4L 4HKZB 1UUSA 1PKQA 2JCCE 5JXED 1U58A 1BECA 3X3FL 1I9EA 5FHAH 3CFBB 1X6LA 2AANA 2IH3B 4L1TA 3V6ZA 1RZIA 2VDRL 3EGXB 2P5EB 3KHQA 1T4KA 3UBXB 3D2UD 2LTQC 3NCMA 2VRQA 1MLBA 3RYMA 2YAPA 5HJDA 5EWIL 4P23B 3OQ3B 3VXUD 4G8FA 1AHWA 4JJ5B 5D5MB 2WN2A 4M4PA 3JWNC 4PVLA 1OV8A 5T1DL 3C5SB 1HJBC 1HNGA 2IBBA 2HH0L 2EE2A 2WZPD 4Y2OA 3OAZH 2R27A 1YUKB 5F7UA 3ORJA 2I60L 5LCVH 4U1HB 4RVBA 2O93L 3QIBC 1VF5C 3LN5A 3T2OA 2D2OA 2FJHA 3T0ED 3DOSA 2XOTA 5H35B 2ZX5A 1PZDA 3P54A 4OR1A 2G9KA 4PLKD 4NQDD 5IESL 3TO4D 1U8IB 2E86A 3LH8A 5T5FA 3TBVA 3WAKA 2EH8H 1MJUH 4NB7A 3OMAB 2H2SD 5IROA 1Z5HA 5AVQB 2DI7A 4JZOA 2UVFA 5D2NB 3VO0A 5EMYA 3E9TA 3LTVA 3N55A 4P06A 2YC1A 5KN5B 3BUTA 5LXVA 4R4BA 1HHKA 3DSNA 3QUXA 3UIYA 3V0WH 3LKSB 3TT1H 1HSAB 3QG6A 4PIRF 3WFDL 5HHOA 1ZGLB 2C9PA 1QO3A 3S4SB 1BIIB 1KJ3L 1EA9C 3VE0B 5FW6A 3T77B 3N85L 4XNQA 1A6AB 3GSNB 4KJWC 4W9DC 2JKSA 3MLZH 1BCIA 1KZQA 1GJUA 1FDLH 2HMID 1NIBA 4QHLA 4ODXA 1AANA 3H9YA 5D8JH 5K1NA 2EP6A 3RWIA 1NQBA 4OIBA 5E8OA 3S5LA 3V5DA 3X17A 1U8PA 2PUQT 4FJ6A 2AK1L 4PHZA 3T2PA 1Y1DA 1NDGA 4TUKH 4WW1B 5JIKA 1K4CB 3WD5L 3WIIH 3EO9H 3OKDA 3ZKXC 5DRZB 1SY6H 3V4VH 1CFNB 3VFNB 5I75B 1FNGA 2JJSC 2C9VA 1ICTA 3D4GA 3UACA 4K73A 2NSMA 2NTFA 1LEGA 2EUXA 3RWFB 1ANUA 2AV7A 3PV6A 4EPSA 3FH5A 3GTVA 3U0WH 3FN0L 4KDWA 3K5RA 5BO1H 1AACA 1FVCB 2K4WA 3RWJB 2VH5L 1SEBB 2XZCH 3C6LD 3I74A 4IRZA 5GRWA 5IW6A 1RXLA 1IQDA 3BXNA 5IB2A 1AQKH 4X5LA 2V3EA 4AZ8A 1W72H 2X3BA 5FWQA 2WTRA 1DL7L 5HI5D 4AXWA 4TV3A 2SEBB 4HMCA 1OE2A 4A37A 5I16B 3MJ7B 4NNPH 3MR9A 1BFOB 3PWLB 2IGFH 1P6AB 4WNQB 1NBQA 1U41A 4FQQB 2L0DA 1SDYA 3NRQA 3Q6FB 4PS4H 1NEZG 4IGBA 4XNMB 3CFUA 3ML9A 3UTQA 3VI4F 3KPSB 5CEZH 2P46B 5EU3B 2WQRA 1VGKB 3LNIA 2MNJB 4GAJL 5SWSA 4L8CB 1CL7H 2HUEA 2P28B 4RFNC 1GS6X 2UZYB 4RGOL 1LO5B 4YDJB 3LXCA 4JQXC 1QPKA 2PXYB 2JTDA 2VDML 1G0XA 5IOPB 3VJ6A 3GS7A 3C8KB 3TV3L 3DHUA 2I85A 4HVBA 3D3VE 5JHAA 3OL2A 3NCFB 2HFGL 3EJQA 4HFWB 1MPAH 4GKSB 1CLYL 3OJ2C 2H32A 5IJCC 2EXYD 3Q5YA 4UV4H 4X0KB 4YBHA 4JKWA 1R3KB 2FBOJ 3AQYA 4KVCH 3T1FA 4PJCB 2BHZA 1I85A 1RUKH 2PYFA 3D39A 3QNYA 2G30A 4DSYA 4MMZB 3KPRB 3MACH 4FZ8H 4PJDA 1UWXK 4NXKA 1U92B 4JO8A 4WTZG 5GSRB 4KZDH 4GG6E 3VXRB 5KSAC 3RDTC 4G7RB 3BSGA 4A2GA 4E9SA 2MPAH 2Q86B 1AZVA 5C0GB 4PVMA 2NNXA 4NP4H 2WNKA 3HNTL 1G1YA 3VDCA 5DJ8A 4DQOL 3WIFA 4Y19D 1SHMA 4J3OG 4ERSH 3HC4L 1KENL 2CGZA 3EJCA 1RZKH 3VGFA 1CTNA 1ZK5A 5C08E 4V11A 1IARB 1E7VA 4LP8A 3QI9D 4Y5VC 3D0VB 1V3MA 4RMVA 4A67A 4PV8B 3LOWA 1D5BB 3GMMA 5E2VH 4PJ9B 1I3RB 3MV9D 4NT6A 1HCFX 1BZOA 4J3VA 4FHJA 2XN9A 1QTPA 1RUQL 5GRJL 4ZX5A 4HGWB 1EWHA 1INDH 4QOKE 4MCMA 1T2JA 5JHLH 2QKSA 4HXAL 1KG0A 5EUOB 2WKOF 2VZSA 3ASWA 2ZWKA 2CCVA 5ABZA 4M5ZH 3KGUA 4NAQA 4G43A 3I75B 3AG1B 1CYGA 4LSVL 3L9EA 2VAAA 3DVNB 2G3XA 2ICEC 5ERWA 4I8DA 4NI6A 1I3UA 5J1SC 1K3ZA 4LSQH 3IDGA 2ZJSH 2GHWB 1A0QL 1S9XA 2OMWB 2X4UA 2NLJB 4R3SB 2J8UF 3TJHC 3FL7A 2VDQH 5E8EB 2HSIA 4DIXA 1KY6A 2VLJE 4WEBH 1G9MC 1FFOB 3BYTA 3QIUC 4HT1L 4KHTH 4IBTA 3EJSA 2CNZA 2E7DA 4ONFH 4RRPA 3QAZC 3VAEA 3K80A 3MRJB 2EYSB 5I8OH 4MB3A 1HCYA 2WXMA 3BKML 3OGCA 5FGBC 1OTSC 4QHMB 1OGTB 2XZZA 2NT0A 5EBWA 5LGJA 1G87A 3Q3GA 3HZVB 3N1PC 1SMAA 5B39B 3UPRB 1GGYA 3LZPA 4QAWA 1OT4A 1VADA 3MV7E 1OAYL 4Y5YC 4CVWA 4N8UA 5GGTA 1NIDA 3NCJL 4HAKA 2FBJH 1PG7X 3GSOA 3LRSA 3PF2A 3T3MF 8FABB 4JDEA 4HEME 1QHQA 3QVAA 1O9ZA 2J8UE 2MNWA 1DJXA 3N44B 3BVNB 3WJJA 1MH5B 4R8WL 5EIQA 3C60B 4D8PB 1LL1A 3OQRA 3L3KA 1N9PA 2A83B 4BKTC 5KYYB 4J3OC 4X50A 4JDTH 3WY2A 1YPZF 4XAWH 1XV8A 2NDGA 4MZ3A 3NBNA 3L4XA 3DYOA 4M7LL 1ZRUA 5F7YC 4WGKA 5EDSA 25C8H 3BGAA 3CWGA 3GF8A 2NY6D 4GINA 5DJAB 1RCYA 3QIWD 4ZSOA 2YEQA 1K8DA 4I4WB 4OFYD 2GC4C 2NXZD 1EFXB 3II3A 3H6JA 3GSUA 2X4QA 3R4DA 3UBFA 5F0MB 3TYFA 3POHA 5GGVY 2J8HA 3RWCA 4U1IA 4LRIC 4FL4B 5DZVA 1RP8A 2AGJH 1LO2H 3T3ME 4XCYB 4GI8A 5I66B 2DQGL 3UH8A 2R23A 2J12B 5I24A 3MGOB 5EO0A 3W0WE 2QGBA 1Z3RA 2OJEB 1YPZE 2IDCA 4U1KB 1U42A 1MFDH 3KS0H 4WI0A 1P69B 4G8IB 3RTQB 3QDJD 3K8LA 3QEQE 5BS0D 3QZMA 3TA3A 2G2RA 2GT9A 4KITB 3TBYB 4GQZA 1NIEA 4N2DA 3E38A 3PWUA 5ELIA 4E42B 5ALBL 4O2EB 1KEMH 1Q9OA 3SQOH 5IFHH 1YMME 2EECA 3MN8A 1NLBL 1IT9H 2ZXBA 1IGTA 4YLBA 2B14A 5JORA 1U8MA 1UXWA 3LEYL 1B0WA 2NY4B 3C75A 3WS6A 2YBRB 1B0GB 3D0AA 3CVCA 1F18A 4AQAA 1PCSA 1WUZA 2I07B 2VKWA 3NJFA 4DP7X 2JJUA 3TCLB 2BCKA 2Z93A 4RZKA 4E9LA 3JV0A 4OVUA 3CUPB 4WI7A 3GIVA 4H25B 3MRBA 4LLYA 2ESVB 4RFOL 4NNYB 1BQLH 3QUMA 1GCYA 1Q94A 4YS4A 4J7RA 2X1XR 1PD1A 4C54A 3MRFB 4PJ5E 5EULV 1QHOA 2PPEA 4L3AA 3VFGH 2GITA 1AGBA 3J2PA 1FG2B 5IVXB 2ORBL 4Q52A 4GEIA 5E99L 2ADIB 3TBSA 4H1LB 4M5YL 1GA2A 3OLDA 5HVWA 1X5MA 3NCWA 2N7SA 4WEMB 2MPVA 3G6JF 2EZ0C 3FFDA 3SKNB 2CM6A 5DJYB 1Z66A 1EO8L 1QFWI 3B3IB 4WI8A 2EILB 4L5FE 1CXIA 2EDXA 2VGLM 2XTJC 3HBGA 2HRHA 5E6IC 4TVPL 4DAGH 4HAFA 3OX8A 2DDQH 2R0WL 2IQAA 2VAJA 3BPLB 3MU3A 5MERA 5FYJD 1N7ML 2J20A 3IPBA 1WBXB 2QKIB 4NC1E 2RFXA 4M4RB 4X6CA 4F2MA 3QFJA 5KJRL 5CJOH 4X98A 4ELKB 2OL3B 1EZVY 1U3JA 2VL4A 1FYHB 4P3CL 2V2WB 4YDIL 2OV0A 4NUPA 5IQNA 5BRQA 1XDTT 2WXNA 3W38A 5I71C 4EN3B 1E2ZA 5DK2B 5HTSA 1RVFH 3RPIB 3KM1A 4YQXH 1EHAA 5FF6A 1ZV2A 5D7JB 2EVHA 3BVVA 1AIZA 1MI5B 1S7RA 5GZOA 1EO5A 3HG1E 4G6KL 1NLDL 1BYNA 2VLRE 3IFPB 5D5MF 3WUZA 1TYJA 4YWGH 3SZKC 1NAMA 4OCLC 2FEDC 2RD0A 3G6JE 3TNNB 4PRDB 5C3TA 3MRNB 1KB5H 2YPLA 3FB5A 5EF3A 1Z32X 2EYTB 4G83A 1OZTG 5DVKA 5E5LA 3REVA 5H8DA 5D55A 1ADQL 4P05A 4JY4B 2Q10A 2JTYA 5T3ZD 5F7DA 4HJEA 2NSQA 1JK9B 4APQB 3PXLA 1JZ4A 5CEXA 4CVZB 5KANG 2Y7OA 1A7RL 2HWZL 4K3EL 3TH4T 5LXGL 2F58H 5E1IA 3P2BA 1PVHA 3OZLA 4DGVH 2QT6A 4KK6C 5I6XB 3VRJA 3F84A 5C0EA 4N90D 1UA6H 3DX3A 4M5TA 2J4WH 3EJTA 4R7NB 5IK3B 4CJ0A 4ZS6C 1G9NL 3DTXB 4AEIH 5ACZB 3WDHA 4XP9L 4YHKL 3HHMA 4Z0BH 5KTEH 4PEEA 4PJ6A 2C7FA 2EH7L 4OLZL 2VABA 1U8KB 5HI4D 3CVHA 2BNQD 3CDGA 4NFDA 5FV2A 3OC5A 2MJWA 3UO1L 4KRNA 4XN2A 1WAAF 5D7IB 4HPOH 2A77L 4HS6A 2VE6B 1NCNA 3BKYL 4L1LA 3H3PL 4X8JB 3TEUA 3WUWB 3HMXL 3GUTA 3K6OA 4HKBA 2R0KL 4X7DC 1I7ZB 4CSTA 1YY8A 2E9IA 4ICXA 3KCWA 4MQSB 4YSAA 2ZKWA 4K15A 2B3RA 3CN4A 4D9QE 5HGBA 1LE5A 3BFQG 5DSCB 1FC1A 4HALA 2EJ1A 4HZ1A 3CFCH 5D2NE 4XVSH 3F58L 3RG1C 4RETB 4WUKH 2CR0A 3OAUL 5MEQB 3ZGHA 4YVUA 3X11B 4FHBD 5D1ZI 3VNZA 3W5MA 1AZUA 1J1OL 1SVCP 4R7DB 3BH9B 4HUNB 4NQVA 5GS1B 1DZBA 1ETA1 5E94A 3R8QA 3RZWA 2BZCA 3R0MA 3CFDB 4MA3A 1V7ML 1PZUB 3NESA 2VXSL 4JBSA 1WAAE 2FQGA 4L9LC 3VXQA 2W9EH 1CN4A 5HYSG 1K8IA 1AXTH 1BAFH 3CMOH 2V7HA 3BVXA 4FNRA 5C0JA 5DMYA 3LPGA 5IROD 3N2JA 2WXQA 4YR6A 4JCLA 4L3EE 4QF1A 5DUMH 3DI3B 3SOTA 3QUXD 3ESNA 4OJAA 3FUFA 1AGEB 2VC2L 4GQRA 3WE6B 1FVEA 2EEXA 3T8XB 2B5IC 3T65B 5SV3A 3G5VB 1WITA 1UTDA 1EXHA 5C0AE 4HD5A 4WJ5B 1JP5A 2XRAH 1F90L 3O6FC 1CGYA 1T0NA 4I87A 3ULVD 1NDMA 4Y4FA 2QGCA 4O02A 3K6FA 5DEFA 4B9KC 3QNZA 3FPXA 3LHPH 5K1JA 5DQJB 4K9EL 3L6FA 1YN7A 3D4YA 4LIQH 3OLEA 4FS0A 5E9DE 5IQ7H 3BIKB 1E90A 5IFJB 1ZA6A 1J9SA 1T6BX 3CTTA 4MXWL 4N26A 1N2RB 3O3DB 1R0AL 4Z0XA 3E6HB 4XNDA 1Y07A 3BGMB 2COVD 5JW4R 5JPNC 2NNCA 2DJUA 1NC4A 2P8MB 1DVFA 2Q7AA 5CUSL 1IAIL 4TKWA 5JZ7D 4AMKL 2AXHA 4H26B 1D5IH 1P2CB 3LPWA 5TDNB 3L95B 3S37X 5B38G 2B7DT 4PJCF 5DRXA 2IAMB 1JZ2A 2J7LA 5D1QB 3MNWA 3DOIA 1WIUA 4LPXA 3VD2A 5E1AA 1MVUB 1NSNL 4Z7VE 5DVPA 2XG5B 5DS1A 3MAWA 3QJOA 4P49A 1TPXC 3T2NH 4ELMB 2GCYB 2W60A 2DWEB 3HZMA 1IVLA 1UZGA 1IJ9A 3GNML 4PRNB 4WO4B 3VFWA 2YN3A 2ED9A 3GB7A 2X10A 3HPJB 3FFCD 5AQ0A 2BY0A 4AVHA 4H5SB 2B15A 4OCXH 4ZDHA 4NJ9L 4WWKB 2GY7B 4IGBD 2Q7YA 1SXNA 4P59H 5SX4I 4YVNA 5SWSD 2G60H 3FQRA 4LFHG 4BK5A 2CPCA 2BSBA 4U6XA 4YSSA 3K0WA 2FD6L 3KR3L 4YSRA 5FYJL 1JPSH 1PF3A 3KPRE 1DEDA 5CAYB 1NKGA 1KWGA 1A1MA 4EMZA 2FL5B 4EUPG 2X4TB 1F58H 1NFDB 5AOZA 4OLUH 5IB1A 3RY4A 3P3RA 2KI6A 2ZTBA 1X7QB 2QADC 1A7NH 3N1QC 4FEIA 3SYQA 1W16A 3WIAA 2JKRM 5CLZA 2D2CC 4L48A 1WZMA 5EG6C 4DETA 2UUDK 4OAWB 1S8DB 5IMOB 1KFAL 3MCKB 3EUDA 1WICA 2OZ4A 3D39D 1JVOA 1N5AB 2ZAHA 4NRYB 2QZQA 1EGJH 2ITFA 1I1AC 2WAHA 3RJDA 2Z34A 4PLJD 2EEFA 4AJYV 1KEGL 1GPOH 1FAIH 1GZPB 4QRQA 3UAJC 1XZ0B 2J71A 1NPPA 2OSWA 2D31A 2QR0B 4Z7WB 2R2HA 4QHUB 5HYQB 5T3ZL 1RULL 5J1AB 1NH6A 1CFTA 1J0JA 1MWAA 3MV8E 3NH7H 2WKLA 4RA3A 5LB1A 1XF2A 5IGXL 3EOTH 1EXGA 3L3JB 2ODHA 1VIWA 5I5JA 2R56H 1L9OA 4MWFA 1ROWA 3SKMB 5LWYL 5I1CL 3LIZL 4GQPH 3INUH 1OY3B 1AQDB 2Q8BL 2IBGA 2AI0H 2ICWB 4NQEA 3VRIA 1Q1PA 3N40P 4JKPL 1BPLB 3ZUCA 4LVHB 1AIFA 4UIMA 3MBWA 1KV7A 1NWPA 2IANE 3BUBA 2FEJA 4Q14A 2OMTA 3LD7A 2K6ZA 3QPKA 2OQJB 2FIKA 2CUHA 3BFOA 2WGXA 1EUTA 2Z31B 3ZDWA 2GTZB 2I9TB 2XN9D 3AW5A 2FJFB 1JZHA 3VXSA 4H2AA 5EF0A 3RP1A 5KW9H 4DGUA 1OD7A 4IDJL 3BUQA 4XGZB 3FSWA 3JBG7 4AWJC 4N87A 5JLZA 5IFAH 1E42A 1NUNB 3NFNB 5CZKA 4DQAA 1LGVA 3O8XA 5IHUH 4PRBA 1D5RA 4F9LA 3QJVB 2V6HA 3LVEA 4PJAE 5EPMB 1TJMA 1ACYL 2DW5A 3GHBL 1EEZA 3CD4A 3Q0HA 4QRSB 5EN2A 3ZHLA 4DFHA 1C12A 3BJ91 1QSZA 3DO4A 1A7PL 2C7UB 3O4LA 3GMQB 1CLOH 3GKWH 3F00A 3MRMA 2ZOWA 1UWEL 4Y4KB 1CIDA 3GZOA 2WXKA 1SOKA 4UIKL 3LB6C 5TGBB 3WTSA 1IFGA 2TRYA 5IW1B 4NZJA 4YHML 3CK0L 2RMNA 1FFNA 3SKOA 1I7UA 2VLKA 2X6BA 3LMJH 5T5FL 3VXTB 1R3HB 3SCMB 4HIXL 5KYUA 2UZIH 2AJUH 1ZHBB 1RJCA 2CHZA 2AQNA 1CU4L 4KUCF 2R83A 1E9PB 2PPAA 1G7IA 1INEL 1CR9H 1NJ9A 3MA7A 4JRXA 1D6EB 3OAZK 3LXUX 1BZ8A 1IGIL 4MD4A 3H9ZA 2ATKB 2K3HA 3ARDB 2JI3A 4R2GC 4EI5C 1UQSA 4K3DL 3AAZB 5E7FA 3P0VH 4LQFH 2IPUK 4TOYH 2G4EA 1USQA 2CDFA 1O7SA 3LRKA 3ULVL 1W91A 4UNIA 3SE3C 3MRCA 4MCYA 4NZUH 3KPQA 3KGRA 1YEGH 2O6CA 3NFSH 3KBFA 4AT6A 5HPOA 1E5BA 3O4OB 3EYOA 3JYCA 3P2DA 4AQEB 1E2WA 1WSST 3DX1A 1CL7I 1HOEA 1BWWA 5J6HA 2E7HA 1HHIA 2PW1A 4ZD3H 1XQ4A 3HHSA 1JNJA 3FU8A 2WD0A 3ETBF 5DJ6A 3FO0H 1UENA 3DMMC 3GSNH 4GBXA 3KDMA 3SBRA 1OL0A 4PWIA 2CIIB 4N9OB 2BERA 1GH7A 3EOBA 1IM9B 1H3UA 3EYUL 4X4ZA 4UQ9A 1RJYB 2CQVA 5IVXF 4G82A 4OZIB 1XX9C 4YL4A 3SDXF 1P7QB 4P2RA 3SDYL 3ZL2A 5AW8B 3HVDA 4OF8A 4IRZL 3S3SA 4YO0B 4CVXB 3CFTA 3IDNA 2NW3A 1C7TA 4ORGA 4DN3H 2B59B 1FL6B 1EAPB 5EOTB 1TQCC 3GRWH 3WTVA 4Y89A 1UOKA 4U1JB 2BFVH 3NJMA 1SOSA 4PJ8B 2W0LA 4X2UA 3HFML 3WEAA 3W1ZA 1ZAGA 2DMHA 3BUYB 3TA3D 2ZE0A 3D0LA 5MEOA 2ESVE 2NNAA 4KROD 4NENA 4JK0D 3ZKMD 1J8RA 1S9VB 3UBXG 5FCUH 3U1SL 2Q2LA 1JGUL 1MCOH 3EFDH 4JY5L 5D4HA 1RHHA 3ME0A 1D5ZA 3CU7A 3IGAA 3SDXE 2F54A 4RX4A 2BOCB 2CSPA 3OAWA 3MODL 1HWHB 2WMPA 3ETBJ 2BVPB 2CJUH 3W9EB 3DGCR 1BFVH 2VUOA 4XVTL 3DRQA 1V3LA 3OKOA 4AM0A 4BWUA 3BP6A 1HWGB 4L3CB 1G9EA 4P4RB 3E6FB 4HMEA 1CD1A 1Q9WB 2FTAA 5E2WL 3UZQA 4AH2A 1SRDA 2MH4A 4H8QA 4Z1PA 1JPGB 3KBPA 1DLHB 5DXWA 3UFIA 2YKLL 4X6DB 4HHAA 3UJTH 2CR3A 2R4RL 4LLDA 5E5UB 3VXNA 1WWCA 4QJ3B 3S37H 4MNQB 4LLMA 2MCPL 4TNVF 3QQ9C 1V05A 3T8VA 5E6SB 3D48R 1TZGH 5F3FA 3IDIB 2BP0B 4XN7A 4NC1C 4F1ZA 3MRKB 4TSAL 3HLAA 4BZ2A 5C0DA 4PGDB 4G8GB 2DPKA 1HS6A 1J9QA 1LWRA 5LQBH 1S9YA 3VFMA 1E4KC 1QRNA 5EEXA 2TSBA 3FCTB 1OT1A 5LGHL 5HY9A 4RWYH 4X80L 3MRHA 4JAMB 2IPKA 4DGYH 3BRGC 3QFJD 3STZA 5IEKA 2EIKB 3ISWA 4Z76B 4QRTB 5DQ9A 2D4FA 3N6YA 3CDCA 1LEKB 5KOVC 3QFDB 2RH0A 1YEFL 3C9NB 2C3HA 3PFUA 3G7TA 3X13A 4TL5A 4RISH 2DWTA 5KBPA 1F6AB 4WFGD 5GZOD 2OFQA 4OBRA 4H8WL 4NO0B 4RA0C 2MKWA 2H0JA 3TZVB 2X0WA 3U2JA 2BY1A 2NY2D 2YPLD 3OVUB 5EIIB 5I76A 5ILTL 3FRUB 3WIHA 1YYML 1R5WA 1W8NA 2GSMB 3IFOB 4LAQL 4L4VD 2ZYRA 1JGEB 2VRKA 1C08A 2ARJB 3BSZH 2HT2D 2X9YA 3DUSB 5KSUA 1SXZA 1IRAY 2AVGA 1ILSA 2C3VB 3T9WA 1V3JA 2D7TL 1R17A 4BFIB 3DWTA 5IBLC 5AW1B 1KXTA 4KKNA 2YXVA 1OWWA 2DYPB 3FT0A 4XP1H 2JQAA 4LCUA 1T7ZA 5DUPH 5AG9A 4CKQA 1MCNA 4S11A 1P4BH 1I8KB 1WH0A 4NPYB 4G7YH 4X5XA 3S7GA 3LS4H 1A7OH 5J3HD 4EIZC 4XTRD 4RDQG 1SBSL 1JGLL 2HLEB 2GSGA 1IGML 3IFNH 5BUAA 4QRBA 3RILA 4OLXL 1WCBB 2IWFA 4CADB 5FA3B 4DP4X 1J1PL 4E9XA 4L29A 4M6OL 5D2NC 3S96B 3S6CA 4HKXB 4MSWB 4H7VA 4KI1A 1HZHH 5GGTL 2E9JA 1PDKB 1RHFA 3QJHA 3V5HB 3NIDE 4JM4H 4JFQA 4S1QH 4KH9A 3WNIA 4N22A 5DZJA 5TQ0H 2ATPA 3RJOA 1A4KA 2BXZA 2OK0H 4DW2H 4JQVC 5DMKB 1YLBB 2H1PH 5I6NA 4N1EA 3G04A 1WZ1L 4JHUA 3QXAB 2R69H 2ZWNA 2B0SL 4G7VH 2B2XH 5KANI 4ZFOB 3DJTA 3TEXA 1IBZA 1UUNA 2WLIA 3L08A 4EBQH 1A1OB 4E9QA 1MHCA 4YLQT 4AYFA 1VKXA 1ECZA 3P3TA 2YPVA 3BZ5A 3IRCA 3WG7B 3F7PC 3SKUD 1JFHA 3U6RA 3DBSA 3WEXA 4ZTOH 1NOLA 4K5NA 2IBZY 2R1XA 2VQ1B 3T0BA 3U2IA 5I2IB 2HFFA 1SLUA 1Z9SA 5CGMA 1WGVA 3VFTB 1EEQA 1HSBB 3EGDA 2HFEA 5CD3B 4Q6IA 4QRRA 3MOAH 1H6EA 2PABA 3TJEL 1IBHA 1KC5H 2ADJB 3ET9F 4FFYA 3TPUA 1OGSA 2E7BA 3OPUA 5CINL 4Z23A 3D50A 4ZYKB 4WY7H 3T0EE 1P7KA 2DQJH 4ZUWA 4MJID 1TJXA 3H42H 5D1QE 3SIKA 3KYNA 4Y4FD 1U8NA 3RURA 4OF6A 3ESUF 4TRPH 2DQCL 4NXSA 1AI1H 4NQDE 4F8PA 1JUFA 4K7PX 3QZLA 3MA9H 1RI8A 1YEEH 2VCOA 4JGUA 4GO9A 4JRYB 1IMHC 1NFDF 4OGYH 4WWNA 4ZJ9A 1EHLL 1P9MC 4RWHA 2G3NA 1HINL 3QS3A 4FG2A 1U93B 3MRQA 1RD6A 3CFMA 3LVTA 2VQUA 4PPTA 1A6ZA 5E4AA 4PJGA 1CT8B 3FHAA 1QA9B 1NC4D 1XL6A 3HRZB 3K72B 1U3HB 2JB5L 3EHBD 4MRBA 5DZAA 2R4SH 3SYOA 4F58L 3ARBC 3QH3A 5CWSA 5HGDB 3GMLA 2HG0A 2W88A 3WNNA 2F8VA 4G6AC 4H8UA 5IQ9B 3QJFB 4OV6F 4S0HA 3QUML 4JN2A 3TBBA 3VXMB 4QRPB 5I15L 3ILQD 4OLWH 4DUVA 3OKNB 5C07B 2FH8A 5IMMB 4GFXA 3FO9A 1NUFA 4P9ML 2NYZA 3CFKA 1CICC 1IEBA 4JY6B 4OJFH 3HAEB 3IJ9A 1WJ3A 2OJZL 3RX7A 3BRDA 4WTQA 1U4EA 4HSCX 4MZIA 2P8LB 4QHPA 4MMZC 5GJTH 3O6KL 3VFUB 5DWUH 2EDEA 2JB6B 4V1DE 3B9VA 4DKFH 1R24A 4HZAA 1UHVA 4NQSB 1V8HA 2ZUUA 4LASH 3ZPDA 3DX8A 1A6WH 3VQ1C 4TSBL 4YDVB 2V8LA 4LF3B 2CKBA 5I8EB 2WANA 4OGAC 4ELDA 4FQPA 4H1LH 12E8L 1KFGA 4CSZA 3IJ7A 4XN9A 4HJTA 4FNPA 1MSPA 1KBBA 3S3BB 1TTFA 2QPSA 1CZ8L 4JUSA 2CK2A 1SJXA 4HJIA 2CKNA 4EAEA 4YSEA 1YA5A 5IY5B 1DQVA 2W1NA 2ZICA 4PJIB 4UDTB 5EZJA 3P3YA 3T0AA 1FO0B 1MY5A 4QAMB 3QQXA 3VWJB 4IIQB 4OM0H 2KZWA 4PGCB 3TBWA 2WWMC 1C8QA 3QIBA 4A2LA 4HPHA 4KKBD 4HA1A 2OR9L 1NAML 2ZWLT 5DMIL 4LU5H 1K4DB 2H3NB 4M1GL 3QORB 5I1GL 3LV3A 4U05A 4YDMA 3V0GA 2OL3H 4XHJD 1UXSB 4L8DB 1QR1B 3GSWA 4ZFGH 2NTSP 3DIFA 4ZOAA 4JUTA 2Z8VC 2ZWZA 3BT0A 5EOQL 2I7OA 1CG9B 4AIEA 3T6XA 1U95B 1A4JB 2ED7A 2EEBA 2W65A 3RE0A 2ZKHL 2AEPL 2ICWJ 2QPUA 5D1XB 3ZE2F 2WB7A 3V0FA 5BV7L 5IQMA 4UV7L 1BVKB 4XVUC 3OR7B 3ABKB 4FYSA 5DJDA 1FJ1A 3WFCH 4AQZA 1X5FA 4UTCA 1WS8A 4G72B 3AUVA 4XBEH 5T5NF 4ATTA 1G0DA 2L7UA 2W9LA 2ATAA 1M7XA 1HXYA 2QPEB 3K2KA 2WQVA 3Q5OA 4I2XA 4MQXD 4NCC2 5A2CA 5C0RL 2WIIB 1TJGL 3S36H 1C5DB 5BO0D 1R3JB 4F2FA 3CVHL 3JTSA 1C8PA 1JWMB 1NCUA 3QJTB 3VXSD 3VDBA 3NJLA 5KS9A 3PIQB 2OXHA 1JI1A 1LNUB 3PNWB 4MJ6A 3ZTNL 4FJYA 2E5EA 4OD1L 4I18B 1KLGB 4N5EC 4M1CD 2JJSA 5CZVH 4B3EA 4UB0L 1EK3A 2YOAA 3P4OA 3O8XD 1I9JH 1H15A 2JI2A 4PB9H 3L9RA 15C8L 4QRFA 5DRNA 2R1YA 5HGAB 4DZ8B 3ZE2E 1JYVA 3D85B 3ECBA 1AY1L 1QLFA 2F2HA 3NEXA 4JO3L 1R47A 3O4LD 3ZZLA 3AREC 1T22A 4H1LG 3M17B 3ZQXA 4GSDL 4JN1L 4OZIF 3JWDL 4WJG3 3A4FA 4IOFD 3K4ZA 2Q2EB 1BVNP 3OKMB 4I3SH 4DEPB 3S8FB 4IBUA 3T04D 5PCYA 2BSSA 3JWOH 3QQ4A 1FNSH 6FABH 2QZ5A 5EFIB 4UINL 4QY8B 2VLKD 2YXFA 3D07A 2BP8B 4HH9B 5EZLB 4YDKH 4E9WA 4RBPH 1L7TH 3FMGH 5FKPB 1W6LA 2IC2A 4ZZKA 2PPDA 3TWCH 1J1XH 1TQBB 4FKKA 1Z5LB 3DX6B 5CEYA 1I1FA 1GYUA 2EICA 2HN7B 4ANXA 5FGCE 5KSBF 4BZYA 5D4IA 2NT1A 2HJKA 4JRXD 3UEZA 5IHLB 5A16A 3PJSA 2X2HA 4A7QA 1DJZA 2GJJA 3EFOA 1FORL 3ZDZE 1X5AA 1OAZL 3FB8A 3QR2A 4JQXA 4GPVA 3TYGH 5L9DL 1VENA 1KCLA 3GK8L 4XE0A 2EIZB 1DUZB 4FL4C 3QDMB 4XBPB 3G08A 2UXTA 2LW3A 4OZIE 4M7ZB 4O02L 3E1F1 3UTTE 3NJIA 3LNGA 4HJSA 3CBJB 1AE6H 1JZEA 3DURB 3GFUA 3OPZH 4ES8A 4HQQL 4HJ0D 4YDZA 4ZO8A 3WELA 4YX2H 1A3QA 4MA8H 2P45B 2VQTA 2WXIA 2XA3A 4NO3A 1MZZA 3LNFA 2DM3A 4PRPA 3BDBA 3MGAA 1J5DA 5DQDL 3A67L 2ENJA 4I85A 4AJWA 2X2YA 4QTFA 3S2CA 2BJML 2VSDA 1AGCB 3LQZB 2XZAH 4GBXD 4HS8L 2X40A 5KSBE 1N8ZA 3R1GL 2RACA 4X6DF 4DO4A 4E5XA 5KSAA 1BBJB 3L5WB 5I19L 3MNZA 4POYA 4WU7A 4F1SA 1JPFA 4P2RD 5ENWA 1BQHG 2BNRA 1YDPB 1QOKA 1UA7A 1S7WA 3O2VL 1ORSA 5T8IA 4CC0A 5DD6B 1EDYA 2V5MA 2LT9A 5TDOA 2B1AL 2GJ6A 5TK2A 4JQIA 4NN7C 3F85A 1JHKL 4K3GA 1KV3A 4JR9L 3F12A 1HK6A 3N1MC 4HH8A 3EW3B 1G7LB 4N2GA 5F7MC 5FA4B 2QVTA 4Y5VA 4KTGA 1BV8A 5CMAA 5F1NB 2GB2A 1JGVH 1QEWA 1NINA 5GS0D 1S7TA 2WWKT 2EIBA 4U6VL 1K6QL 3WUWG 1BSIA 1EJ6A 2K9UA 1CFQB 1ZCRA 4QI3A 3BT2L 3M45A 5CXPA 1PSKL 4LCIH 1DQDH 2NR6C 3MRDB 3QJXA 3W11D 3B9DA 1OANA 4Z5RB 4PS7A 3LEVH 4X6DE 4I48B 5M95B 3GSRA 4Y9BA 2F54D 2NY0B 3QFGA 2E56A 4LRNH 4RX4D 5C97A 3NA9H 2EVJA 3CV5A 1UKSA 3FTGA 3MUGA 1NEZA 3FQUB 3P4MA 2AABL 2K8MA 1JXDA 1U8CA 3BPLC 2VR9A 4JDVB 4K7PH 2ICEA 3EYVB 3OKEA 3QDAA 4OF7A 3KWVA 2QKIC 2XKUA 3CDYA 3IJHA 4HDIA 3ZYZA 3WFBH 5A6LA 5BS0E 4G8GE 5HJ3B 3G5XA 2EKSB 3FONB 4RDBA 4EN3C 1BG9A 5MENB 1DSFL 3IKCA 3MRIB 4OQTA 2OZ4L 3N9GH 3FN3A 3QIUA 1RUML 4F5CE 4I77H 2XNAB 1L0XA 2NYYD 2FWUA 2CBPA 2YLHA 1MCWM 2EE6A 2H7WA 3LRLA 5B4MD 5DLMH 2OPCA 1LP9F 4G6JH 3IJYB 5GGVL 2GFBA 1MWAL 1XGYL 2WWKO 4B6ZA 4PTUB 3I9GH 1OAKL 2VDLL 5FGBA 4FMFA 2FATL 4OD2A 3UAFA 3RZCC 3QO1B 5F0JB 1T83C 1UVQA 4PGEA 2XBZA 1HL8A 4X5PA 5F1IA 3DKHA 1XGQB 2FGWH 2Z4TA 4UT9H 4U0RB 4XX1E 5D7LA 1IEHA 2FJGB 5MEPB 4Y5YA 2Y6SC 4N2EA 3UBXI 4WTZA 5CP7A 2J6EH 1HKLL 2Z7WA 1JPTL 3HZKB 4A7VA 1ES0A 4G9DA 5I6XC 4HLZG 2J57A 2R7EA 2DTMH 1EJOH 4O00A 1YEHL 4K7FB 4UYQA 3T4AB 1JGIA 4MMYB 1I8IA 3TS8A 3WU1A 4LCWA 4ANKA 1AFVH 3D52A 3QARA 2GK0B 3VFVB 4OZFG 2NY5L 1RIVL 5C0BA 3UPCA 3X12A 4AYMC 3V0EA 1LP9E 4YK4C 1RUAL 5DMJB 3V0HA 5HYEA 3ABGA 2Y36L