1NPPA

Crystal structure of aquifex aeolicus nusg in p2(1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 53
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nppA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nppA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nppA01
4ZN1A 1Q81C 3CCLT 4OBIA 2OUGA 3CCRA 1NZ9A 3CPWS 2DO3A 1YJNA 1X6OA 2JUFA 5LL6S 3I56T 1YHQA 3CCMT 1QVGS 1VQLT 3CC2T 3CD6T 3G71T 3CCJT 1KQSA 1EIFA 2JOYA 4QQDA 1VQMT 4CRIA 1K73C 4ESNA 1VQ6T 3A5ZB 1K8AU 1Q7YC 1YI2A 3PIPA 1JJ2S 2CKKA 3KBGA 2LCLA 3CMET 1VQKT 3CMAA 2OTJA 3DB3A 1K9MU 3J7AF 1SSFA 1VQ9T 3I55A 3G4SA 1NJIU 2L3RA 1VQ8T 1XNIA 3PIOA 2E70A 3CXCS 1KHIA 4TVRA 1VQPT 5IAYA 1VQNA 3CCVT 2E6ZA 3OW2S 1VQOT 2OTLT 3CC4A 3CCEA 1QVFA 1S72A 1VQ4T 1M90C 2JVVA 1Q81U 3DLLA 1RL2A 1YITA 1KC8C 2KPPA 1VQ5T 2QEXT 5FLXE 3HKSA 1VQ7T 3CC2A 1YIJT 1KC8U 3CCJA 3CCUT 3CPWA 3TREA 1VQMA 2JNGA 2MI6A 3J80E 1K73U 1IZ6A 3CPFA 3OYYA 1QVGA 1Q7YU 1M1KC 1YJWT 3CC7T 5A2QE 1W2BS 5DM7R 3CMEA 1NPRA 5DLQE 1Q82C 3CCRT 1M1GA 1JJ2A 1YJNT 3CCSA 1YHQT 1VQ8A 2G3RA 3QQCD 1KD1C 5HY6A 3CCQA 3LGFA 3EWGA 2IG0A 1NPPA 3JAME 2EIFA 2OTLA 3CCLA 1YI2T 5IT9E 3CXCA 1N8RC 1M90U 2KDSA 2KVQG 3I56A 2OTJT 3OW2A 3CCMA 3I55T 3P8BB 1VQLA 3CD6A 2QA4T 2MWOA 3LGLA 3G71A 2QEXA 3H7HB 1VQ7A 1Q86C 3G6ET 1VQ6A 2XHCA 1YBYA 4RG2A 1VQNT 1YJ9T 1VQKA 3CC4T 1M1KU 3LD7A 3CC7A 1YJWA 3DB4A 3CCET 2LQ8A 1S72T 1KQSS 1VQ9A 2K06A 1Q82U 5J3BA 1UEBA 3ER0A 2MWPA 1YITT 1W2BA 1VQPA 1KD1U 3CCVA 1NZ8A 2EXUA 1K8AC 1VQOA 1BKBA 1XTDA 1VQ4A 4YTLA 1N8RU 3CMAT 1K9MC 4X34A 2LVMA 3J81E 3LH0A 5J26A 3G4ST 1NJIC 1VQ5A 1YIJA 2QA4A 3CCST 3CCUA 1QVFS 1Q86U 3G6EA 3LPEA 4ZN3A 3CCQT 1M1HA 1YJ9A
chains in the Genus database with same CATH superfamily
3SEOA 2DO3A 1NM2A 4QCLA 3Q2SC 2XTJP 2JFKA 4CRIA 4A8SA 4DV2J 3FEZA 5HP1A 2BJ9A 2LT4A 2DZCA 1HWUA 1KOOA 5LJ3g 1C1BB 3CD6S 1P6TA 2OGUA 4E7LA 4VUBA 1NJXA 3VRZA 2P9CA 2MKHA 4FBTA 1P8GA 1VQ6S 1D3WA 5KFZA 3RBZA 2J9EA 1IR1A 2LNVA 1NHUA 2OTJQ 4DX7A 4IIOA 1UVNA 1N4LA 1K47A 2V34A 3QJPA 3OYFA 2J0QD 3CD5A 2UUCF 3T1AA 1VQ8A 1CC7A 3FZ2A 4ED8A 2ZHOA 4TU9A 1VQ5S 2VKRA 1OYXA 2H9ZA 4Y91A 2YKMA 1ABQA 3Q22A 2GC8A 4Y2CA 2F1FA 4LF9F 5GAMd 1WD6A 1XQHA 3P8DA 3DB4A 2XI3A 4KR0B 3AQOA 2KJWA 4XDCA 3EUNA 1HBNA 2C06A 1U09A 2F5KA 3NWRA 1Q86T 1U8SA 2AJ4A 4JRKA 1RWMB 2IPOB 2MLZA 3M53A 3OR2A 4DS5A 4HTJA 4DEXA 4OZ3A 4KFBA 4MKAA 1PJ5A 3QAUA 1RACB 2M4MA 4M75C 3WC0A 3KLIB 1EP4B 2GW8A 1NSQA 3US5A 3W5ZA 2NLWA 3LQVA 1RYRA 4J37A 1VQ9T 3MR2A 4RU9A 2DR8A 4FYDA 2RS8A 1VIXA 3VF0B 1SF9A 4N8OA 2JMCA 2VFSA 5KFYA 2AYMA 1VQMA 4B3TF 4AFZC 3VAGA 1AZEA 1HD0A 3J7ZT 4Y28E 3ENAA 3HRSA 2IVWA 1EKRA 2QQ9A 1RLPC 3IWXA 3QFHA 1YK9A 5HAOA 4I68A 4C0DC 3EG2A 2OFHX 4HHHA 3W64A 3WHIA 4DV0J 4ZOSA 1WKLA 3DNCA 4JI5F 5J1PA 3X26B 4N77A 1S12A 2NZCA 2XBPA 4W4MA 3QPHA 2QEXA 4B9LA 3TO8A 4ILMA 3O6QA 2RQKA 2RRNA 4WIIA 1TL7B 4YR3A 3DU5A 4QW8A 3NL0A 4OF1A 4IH5A 4CLYA 2GMHA 3G6YA 3WX4A 2EXUA 2E5GA 5LM7E 5IHIA 2J5AA 3CW2C 3JSBA 2O9VA 3A3PB 1REVB 3GG0A 1YJ7A 3QZ8A 2GVZB 5I3UA 5BYSA 1HBUA 4WK1A 1BIAA 3LAMA 3V6JA 1X2KA 1RP5A 1T05A 2DGVA 1UB4A 1WF1A 5J2PB 2KY9A 1VQOQ 2OIHA 2W9AA 1VMBA 4DV4J 4YFUA 4OX9F 4X9DA 4ELYC 4J9IA 5CKFA 3RRGA 1F3FA 4AFQC 1HPZA 4FKXA 3GPLA 3M2UA 2Y4YA 2FPHX 1IJFB 5C25B 2YKNA 4QYZK 4M7DC 1G83A 4QQBA 2ZPEB 2L48A 2HAIA 2FHKA 3R5JB 4XAXB 3NAHA 4FDFA 3JCMX 3OYIA 3NS7B 2JMAA 4E7ZA 2W4PA 3SFGA 2OPSB 4XO0A 4ZIVA 1NSPA 3OVAA 7FD1A 5KG6A 3QJLA 4OYIA 4OMPA 4FVMA 1WOSA 3CXCP 4WF9Q 4F16A 1IGUA 1AWXA 1OZ2A 3LGFA 1YI2T 4O3QA 1A0OB 4DV7J 3P8BB 3MO8A 4HDHA 4XTXA 1FHTA 5J1EB 1VYVA 4TQRA 2GBQA 1L3VA 4IRCA 3I0SA 2EC0A 4UUWA 2RB7A 1FKAF 2EFVA 1R43A 2YWFA 1KQSS 2PDAA 4H4OB 1E6VB 4LJMA 2LDYA 4O3PA 2ZWOA 3CCLQ 3N79A 2KZZA 1IGQA 5CAIA 3IBCB 4L6V3 5AXKA 3SYZA 5GANg 2D41A 3ISNC 2QLWA 1K1ZA 3KLHB 1D3BB 1SVDA 3ZZTA 1VQKQ 1VI7A 2DHSA 1RAJA 4A0TA 1DY3A 3ETMA 3C66A 4I6AA 5GAHU 2QFIA 4LXCA 3EHRA 2YBVA 2QSFA 4DR1F 3QYYA 2WAQD 1M1FA 2XGQA 2A3LA 3GB0A 2LC4A 1G3WA 1S6PA 2CDTA 4CLSA 4OB0B 2HHQA 3VCDA 1KR4A 1S10A 2FC8A 3M8ZA 3G71S 4RW6B 3QWXX 3LUYA 3QUIA 2HVHA 1VC0A 3D0IE 1KVJA 3VALA 4ZTFA 1J3TA 3UFCX 2LCSA 3CC7T 1KN6A 1DHMA 1NEBA 2M3DA 2HMIB 3LP1B 4QR0A 1IM4A 1VK8A 3BJYA 5K20B 3MPWA 2G3RA 3H25A 4DOVA 2GO8A 3CJ0A 3NWGA 5C24B 2GJFA 1JLCB 3NEKA 4CLFA 2JRSA 2M8DB 3BB5A 2DERA 2QGGA 2MPXC 2NXJA 3KJFB 3RW6A 1HHQA 1WUUA 1JQGA 5D0GA 4L72B 4DQIA 5KE2A 3GZ7A 5CABA 2M7SA 4QT7A 3IAS9 4N47A 2K4YA 1QJHA 3GCWP 4XPCA 4O0NA 2HKNA 3L95X 1Q95G 1N27A 4XK8E 3DOMB 1X0FA 1NE8A 5DG8A 3CD6Q 2CAJA 3QT6A 2KT1A 1AUDA 1HNXF 4JI0J 3PZPA 5CR2A 1VQ6Q 4DQRA 1QAIA 2KM8B 3MM5B 5GANh 4DV3J 5E7OB 1AWJA 1NMEB 1RXOB 4TYBA 5HQMA 4IIMA 2MYSA 1M1HA 4NMXA 3SMZA 3ASKA 4C97A 5F8JA 3FCHA 3R5GA 4I2PB 4J83A 1VRTA 2EW9A 2BE7D 2W10A 1J2VA 3W2VB 1VQ5Q 2C3YA 1IVZA 1ELOA 3VYGA 3PRVA 1EETA 4LF4J 2DGUA 3NTIA 2D0NA 3M1VB 4EBCA 1WKJA 3A8EA 2AGQA 2UUBJ 4C8QE 2EYXA 4TY9A 1I6JA 3GFYA 2FGOA 2HDAA 3NCPA 3V6DA 2DGQA 1IKYB 3DLEB 3UDVA 4ZITA 2W4CA 4GKKJ 3P3DA 1RTZA 1SL1A 4DBFA 3MPUB 4JI4J 2O31A 1Q81T 1EFNA 2J9DE 3RBBB 3JB9H 2P9GA 2HNYA 3X3UA 1FRLA 5DETA 1J5OB 4DL0C 2EIFA 2AYGA 2PVDB 2R2UA 3NPFA 2KVQG 4QPXA 1HNZJ 2MTLA 2Y8YA 2NXCA 4IUTA 1X7VA 3BO4A 1H98A 2G9OA 1TXQA 2BA9A 2AX0A 3BKTA 4S0MA 5D6GA 4ES1A 2P0QA 1IM6A 1M3CA 1KHWA 4M1KA 4M75A 1NK6A 3SFUA 1SPKA 2JT4A 5B7WA 2LP5A 2MKYA 2R2RA 3VGVA 4CO1A 4A53A 3KXDA 4M5LA 5D6XA 4UTGA 4LDUA 3AT1B 1GCQC 1AZSB 2QYCA 1YHQA 1JB0C 1I5OB 2HHWA 1K73C 1S1XA 1JK9B 2VA3A 1LW2B 1DQ8A 1OU8A 2CGHA 2OD6A 4MKBA 2ZM6F 5HATA 2KFYA 4DEYA 4WP3A 5KFDA 1X4AA 3JCMV 3VGSA 1WACA 3CC2S 4HCBA 5EX0A 4RUAA 3HFKA 4JV5J 4N4GA 4E7HA 1KC8R 2V9KA 2AZ3A 3D0GE 3ITHA 3CEYA 3SDEA 2BZ8A 3LP0A 1F0XA 4P72A 2E1MC 2CPIA 3M4GA 3M4XA 3VS3A 2NR0A 4EMKB 1F5BA 2B0GA 4USHA 2F69A 2UXCF 3OMCA 5IT4A 2JEIA 4FF2A 4OZ0A 2DVJA 1MV0B 5DRKA 4DCOB 5B0FA 4DBHA 4K4UA 1GMWD 4DR3J 4NS5A 3PACA 3LGLA 3AD7C 1F6TA 2LCCA 1Y96A 4JJDA 3EDQB 4JZ3A 2RQCA 3JQKA 1WI8A 2LQ8A 4ZTJA 4C3MA 2W01A 4B3OB 4J9BA 3AXKA 2NUUG 2H4WB 1VRQC 3J7YU 3VS1A 3MOJB 1RT2B 1F2HA 2DNMA 2VUBA 4TN2A 4O23A 1W7WA 3QIDA 3V4IB 4P6QA 3JYTB 2QTWA 4MYTA 2WB1D 3A13A 3IR7B 3KFWX 3ET6B 4M7DA 5GAOp 4LSNB 2V50A 3WZ0A 4C92E 4QIGA 5JJBA 4ECYA 4KPYA 3KMQA 2DD5A 2E12A 1MROB 3JCMd 1NJYA 4LFCJ 3J81U 3EJMA 3VS2A 1SV5B 5DZ6A 4ANJA 1AZGB 5DO2A 1X2QA 2K8GA 4MKVA 1H2VZ 5CO7A 5K8PA 2N3OA 1SKUB 4MFBB 4NLGA 5GAMj 5K8MA 5M2UA 2CQGA 1K4US 2M2BA 3A8HB 3UWTA 3AA8A 2DEUA 2ABYA 2HMAA 4C11B 2HHSA 4IFYA 2BQRA 3W1YC 2HCKA 3R7NB 1M1KT 3IBFB 4J9SA 1YJ9T 2KB2A 1UL3A 1W2IA 1JWWA 1MN7A 1VRUA 3Q8VA 4ZPCA 3RBXA 3I5BA 2B4OA 3D68A 3TOQA 4LIWA 1ZQ1A 3G71Q 4WFXA 2QL5B 1LWXA 5A8RB 4G1QA 4PJLA 1S97A 3E01B 4PLIA 3JTNA 3S3MA 4CLLA 1FA0A 3M8PA 3Q23A 3FGVA 2ZHAA 2DF6A 1WC4A 1N36J 2ZZNA 3PFSA 3RIRA 3ZC4A 2PEHA 2KFNA 1VFJA 5KOXA 1FRXA 3VHQA 1OY6A 2KTQA 3H6ZA 5KT4A 2PVOB 2IIMA 2F7VA 4PFPA 3E19A 4QVZA 2RU9A 2HFVA 3S6WA 3OT9A 1WNLA 2DB1A 2FRWA 3DC2A 4UOHA 3MP6A 1WDTA 4RR5A 3C94A 2Y1IA 4LFBF 3MR5A 4ED5A 1B7TA 1OY8A 3CPWP 3DLLA 4IG0A 1N33J 4OZLA 1TS9A 2V1QA 3NY0A 2W7AA 4AFFA 4CC2A 1ZSZB 3JS9A 1I94J 4GVBA 5KFFA 3J80U 3CCSA 3J7A1 2KRRA 1OPKA 1KFSA 4ZVFA 2M0OA 1OU9A 5IC4B 4M78F 1RA7A 3VRYA 4NLWA 4ECUA 1X6BA 2PVGB 3Q8SB 4FF1A 4CC7A 3EPIA 1IO6A 1RB0A 2YWGA 3RESA 3PXGa 5GAOn 2R2SA 2QTVA 1QAXA 2AEMA 2JNJA 4C8QD 2AD9A 4XDDA 2ASYA 1FK9B 1I07A 2GAGC 3B78A 3D1HA 1KG1A 4X34A 3NHNA 3KK2A 1VYTA 2J9CA 2QAZA 1GX6A 3P5BP 4BDZA 4HVVA 1R31A 1UMJA 5LXYA 3QIIA 4J9KA 4KYZA 2AGOA 1CSJA 4B9XA 1JJ2R 3HP6A 3FIFA 2YPYA 1WC0A 4EU0A 4OBIA 1MMDA 5F3TA 4DV1J 2MIOA 1FF2A 2RHXA 3HSGA 2XWYA 3JSMA 1U45A 4NA3A 3DB3A 3NS5A 3ZNJ1 3QJJA 1FKOB 2ASJA 4WTYA 2RI2A 1VQNA 3OL9A 2D9PA 1U02A 3IWLA 2BYCA 3QBCA 2V4RA 5I42B 2CJAA 2DH8A 1HNVA 2XS5A 4X66J 2X3WD 5I22A 2K7KA 1UVLA 1MG7A 3IGNA 3FZBA 2BR0A 3MM6A 5GAOl 1WQ7A 1KFDA 3H0FA 3MAHA 5J2MA 3KLFB 3R6OA 1YHQT 4J9LA 4NI2B 4OB2B 5EGYA 2ED1A 1BI1A 1YJTA 2LT1A 4PFOA 3LGHA 3SSRA 4JLGA 1YJ9S 3H42A 4YY3J 1K76A 1MMGA 1OWXA 1OI1A 5LJ5h 4Y34A 2DNKA 3OYNA 1T95A 3FUYA 4C8MA 3EDRB 1GCQA 2C3UA 2ROEA 1S1UA 3N5FA 2LCWA 3WDOA 2QQRA 3W2WA 4K0KF 2X3GA 2IJFA 5A2QY 2CP5A 2LQ9A 5BYQA 3CC7Q 2ATCB 3OS1A 3VS5A 1K0XA 4HTIA 2AK5A 2GGRA 1N48A 1D1AA 1BHNA 4CNZA 4RW7A 3NGDA 1C6VX 2IFXA 1UGPB 4OQJA 5U47A 2Z2YB 4A4GA 1D0ZA 1QP3A 1ZZFA 4AG2C 1R77A 2E6ZA 2P5VA 2V2QA 3D6MB 2OPRB 4JI2F 5FROA 5SUHA 2XCPA 1N32J 4RL1A 5D6YA 2ECZA 1OMSA 2L9DA 2DAQA 1TL4A 1N6QB 2ZE2A 1S1VA 3MCMA 1GEHA 3IR6B 4N7TA 1XTZA 1S9FA 1NK9A 3GBQA 3UI3A 2R5AA 5HN0A 3W8PA 3EXCX 1VK3A 2FHOB 1FYNA 5HMZA 2VG5B 4PABA 1NK4A 3MD1A 3M58A 4DOWA 4RG2A 2DA9A 1T9XA 3UT1A 1PSEA 3GJRB 2AYEA 4ZVOB 3ZZYA 4QWAA 2HPUA 2BQUA 1Z9QA 1TAQA 3VAMA 5LSLA 3ULRB 4YTLA 3J81E 3IRXB 1HQ2A 1SJQA 2PMZD 4F36A 1HMVA 4L3KA 1R8BA 1SC3B 1UETA 2M5YA 2HSEB 4M77G 2RF0A 3B54A 2EGCA 4DL5A 1RHMB 3AB2B 4IKAA 2Y1JA 3DM2B 1S6QB 1HWKA 1X8DA 2WONB 2Z56B 3JTPA 4ZKAA 4RLEA 2VD3A 2KU7A 3O5TB 5L1JA 1Y00A 3ZO7A 4PG4A 4J5YA 1SBRA 2COLA 4JI1F 2ZVSA 3M6UA 4KO0B 1DLOB 3FBCA 1VBKA 3FRYA 3B4MA 5GADI 4ZCKA 4UUXA 1TU0B 3GV5B 3I5AA 2LQBA 2ZVIA 3AQPA 5FD1A 1Q7YR 2QE5A 2ALZA 1JNZB 5L1KA 3EGDA 1OSDA 2D3UA 2DO4A 2X1GA 1H0HB 4YEAA 4NCAA 1KEKA 1OQ6A 1U1QA 3OS2A 2HFZA 2C0TA 3PDNA 3DOLB 3BQ0A 5GAMe 1VQ7A 3TJ9A 1LFPA 4TU7A 1NDCA 1W26A 1LWEB 2FZGB 1RHRB 2G0JA 2PMWA 3OYHA 4OZ5A 2F3JA 4Y92A 2R9LA 4CI0B 2QX0A 1I8FA 2B9XA 4A46A 1K8AC 3RKWA 4U96A 1N34J 2F4VJ 2MYFA 1YJRA 3HLUA 1NRKA 2QA4A 5KOWA 1XJWB 3CCST 4BE1A 2BACA 2XM3A 1RISA 5ETTA 4TNOA 3JCMP 3MR6A 3C15A 1KBRA 2ZPGB 2BABA 2DXCA 3WX8A 2LMJA 4CLKA 3MM7A 4QWBA 1IXKA 2WSCC 2IM0A 4NZ6A 1WG1A 4BDPA 1OJ4A 3D6TB 1TOVA 2CZ0B 2DETA 2AQ4A 1IBKJ 3T5JA 5KT7A 1YZ6A 1E6HA 1FNOA 2AJ0A 4FNIA 4WP9A 1U8RA 2SEMA 2E5LJ 4PUOA 3L2QA 5F9NA 3JB9G 1S49A 1TKZB 1Q0NA 3K17A 2LECA 2ZBCA 3QZ5B 2YRCA 4DSKA 4ANCA 2OTLA 4FYVB 1A9NB 1M90R 4K50A 1X4HA 2C2DA 4U6PA 2DRDA 3C3LA 1X5OA 3MUMP 2MCNA 5LXRA 4CCHA 1AB8A 1VQNT 3IP0A 1OIAA 4RW8A 2CZ1B 1N5SA 1XK8A 1FI4A 1SC6A 3PX6A 2CQ1A 2KE9A 3FQLA 1M3BA 4KH1B 2HFUA 1ZS6A 2P6SA 2KVIA 4LF8J 5D3GA 2V8IA 2YNIB 4ZVGA 3VR1A 1Y4ZB 1T94A 2COYA 1Y3KA 4ZN1A 2J7WA 1IKXA 2XO7A 3MP1A 2HKEA 2HZAA 5HI7A 2FC9A 1EKSA 4N76A 2P9EA 2DILA 3CCJT 3CJRA 1JXOA 1TMJA 1UWBB 2LCLA 2ZH1A 1Q4RA 3FQKA 1B07A 2XHWA 2QFJA 1UHCA 1YJ9Q 1RT3A 2BKNA 4NCBA 2ZKUA 1K73T 2HK3A 3CE8A 2J7IA 2LA4A 2XDDA 2XZDB 1HNIB 3MZIA 1LWCB 1PRMC 4LUEA 1SXLA 3EGUA 1U3OA 3MM8B 1G7CB 3SWNC 4M7DE 3UWNA 4DQPA 3M9QA 2HHTA 2BM1A 2KROA 2EI5A 4F50A 2XMUA 1BQNB 1XMOF 4M7AF 1R8CA 5CYQB 2JLFA 5ETMA 1B7FA 3W7BA 4DL3A 2PZ1A 3G6XA 2CT4A 2UZAA 4KHPJ 2FIUA 4E7SA 4C48A 1S1NA 4R5PA 4LUBA 1IKYA 3QSYB 3MXHP 4USWA 1HYSA 5GAN8 5K8OA 4HHUA 3Q0AA 4IURA 4M77B 4FKYA 1YFNA 2XZWA 4LR9A 1N88A 1U25A 2GJIA 5A0YB 2H1YA 1HA1A 2KYXA 3OY9A 1QVFS 4P52A 4K4SA 3G6EA 4P2FA 1J5OA 2JTMA 2HK2A 3LO3A 3M2RB 4DUZF 3F44A 3G82B 2DVEA 3GOXA 2Z0GA 2KKHA 4U7UD 4L73A 1N5YA 3HHLB 2UUAJ 4OGEA 3A5ZB 1NJWA 1WJQA 1BLUA 3RU0A 2R8HA 2CZ6B 5DM7Q 4LBIA 4GY5A 3M6WA 3PIOA 1BWVA 3MPVA 2C2ZB 5IAYA 1J27A 1NZAA 3H0HA 5BXIA 2JVVA 3OUYB 3JXOA 5BR8F 4OFZA 2MY8A 4R0EA 2JJ4D 2ZBPA 2O67A 2AZSA 2E9ZA 1W2BS 3K0JA 3CJKB 2NCKL 3BH7B 2MF2A 1RT1B 1VQ4S 1J5EF 5FW9A 2I9SA 3EWGA 5KYUB 2SXLA 1H74A 3AD8C 2N7YA 4FSSA 4C8LA 3ZTRA 2ZUAA 4JI3F 3C6UA 2L08A 2UV8G 2R4FA 2ZBRA 3PR4A 3RG6A 5AT1B 1FNMA 4X62F 3OW2P 5DGAA 2ZBQA 4J9UE 3TA0A 1XNRF 3OLAA 1N8RR 2YUOA 4EMKA 4RNNA 3A8GB 4J9OA 4LVOP 4X2BA 3THTA 2VPXB 1U6ZA 2QA1A 4TXSA 5H9EK 3DLGB 1WZOA 2JUFA 1RCOB 5GAHI 1M8VA 2DMOA 5HSPA 2X9HA 5KG7A 4V19X 4FXVA 4OMQA 1XMQJ 2I38A 3OXFA 4Q0BA 2J06A 5KFPA 3N6MA 5A8KA 2MKCA 2JH3A 3F73A 2V2KA 2DL3A 2C42A 5J2QB 4DHVA 1RT2A 2FPFA 3RMSA 3CJ4A 3CMQA 4IG3B 1VOMA 2CS7A 4LDWA 2ZH9A 2EYQA 3GTYX 3V81B 2RHYA 5J39A 2VQEJ 1FXLA 1NDLA 4HYKA 3A12A 2KQWA 4ANDA 3BEGB 3TQEA 3EFOB 3H98A 1LFWA 3CCQA 2DXUA 4RG8A 1FKPB 2QYGA 2CPDA 4YR2A 4WYWA 3DGPB 1ZLMA 3OS0A 3OW2A 3CCMA 2RHSB 1KWMA 4CLUA 1SPBP 2HNZA 4JI6J 2XO6A 1ACMB 3ZZUA 2EEYA 1RAOA 1RYSA 4KBMB 2YXLA 4PG7A 2KZMA 1RTHA 3KLGA 1SB6A 4YS2A 3L7OA 3GV7B 2CIMA 2BMBA 1VLOA 2IVYA 2RQMA 1W6XA 4ATNA 1TTHB 3SZ2A 3UNGC 1TMMA 3IR5B 4JOUA 4XTZA 4IUQA 5D7UA 1IB8A 4QW2A 4JS4A 3BQ1A 1RAFB 3JSRA 2M9UA 5IV3A 4FT2A 4C92G 3ILLA 4DZ6A 3PW2A 3ZL7C 2VV5A 3MPDA 3M54A 1RTDB 1M2VB 3L7UA 2R57A 4USVA 3UPFA 2V5HG 2WOMA 5CD4A 4ELTA 1JB0E 2FJEB 2RQ4A 1CKBA 2CSIA 2HURA 3BREA 2JEGA 2HBRB 4AUKA 3EGWB 1JJ2P 2CQ2A 3GF5A 1DRZA 2BRKA 2YWWA 1Y5IB 3S01A 4HH1A 3OQ2A 4LBPA 3CB4A 1UJ0A 2KRNA 5D77A 2ZEJA 3U02A 4FBUA 1NEGA 2CP7A 4DR7J 4U7UK 4PJOD 1KLMA 1YJWS 4TU8A 2F5GA 2L8DA 2DNGA 4N4IA 3EGZA 3BM7A 4RZRA 2FGCA 4ZLJA 1BWEA 3QT5A 3GV8B 2COWA 1CKAA 3OL7A 2WSFC 3PRBA 4KSEB 1U1NA 5AXLA 1L5UA 1M30A 1MGQA 1RTIB 4WTOB 2V68A 1Q86R 2IA6A 2R42A 3UO0A 2QLFB 3NOCA 3OFFA 3IN5A 1TWBA 1AW0A 1TUGB 2QYZA 2UXBF 4YDXA 3G8QA 3JCMJ 2KGTA 4CDIA 1O51A 4M7DD 3TP2A 2CQPA 1T3OA 2OSRA 4C0BA 1T7PA 3JCMe 3J7AF 2LU1A 2FVCA 1FX4A 1JLEA 3QWPA 4KB7A 4NLOA 3SWNA 3RR7A 3QIPA 1S1WB 2OJ3A 4WKYA 3SFMA 3I31A 3CIMA 2RJDA 2VKNA 3NMRA 3CULA 1KC8U 4HI1A 4M78C 1D8YA 3GIRA 4DG1A 3CSKA 1VQ8S 4OMOA 2OELA 1TK5A 1NPRA 2KT2A 4ENOA 4AQYF 3X28B 2JEJA 2XG8A 4IR9A 4DR6F 3HM9A 1ZSGA 5GAN4 3N5BB 2IAJB 1HWJA 4OLPA 4F0MA 1G3SA 3M05A 1FKOA 1C4AA 3HHTB 2ESWA 3KDNA 4K2XA 2ACMA 3NGPA 3VVTA 4Z7CA 5KFAA 3HZEA 2HRUA 4YQWA 3EZ5A 1PAUB 5BJRA 1DTTB 1X4CA 1LVKA 3C19A 3L42A 3M0QA 2WRMA 4X1VA 4URQU 4NXMJ 3HZGA 5K5MA 3AOAA 4PKDB 1WHLA 2KXFA 2MKSA 4X4SA 4DUYF 3FLGA 1HLWA 4E7JA 2RVJA 5HANA 2JC1A 4FZVA 3GQCA 3J7YI 5K8NA 2L0AA 1FEEA 1DFDA 1OV3A 1RT4B 1S76D 3U7JA 5B08A 1WHWA 1FMVA 1VQ4Q 2ZFHA 2BRLA 1WXUA 1VUBA 1MWQA 3KOAA 2YKPA 5FU7B 1V3ZA 4FS1A 5KFTA 4C4WA 2IVFB 4ZPTR 3H0PA 2JOQA 1TUWA 3ZTSA 2JM8A 4PXCA 1P1TA 5ETQA 5GMEA 1WHJA 4RW4B 3MD3A 5FDLA 3DKMA 1L3UA 1OPZA 2DL7A 2JNGA 3CJTA 4N0AC 2B9EA 1VQPS 4IYQA 1HBOA 1A0NB 1DARA 2Z8QA 4YOEA 2MXYA 3IS9B 2LFVA 4JI8F 1KQKA 2CG8A 1M5VC 1Q79A 2BW2A 1S79A 2QEXS 4ME7A 4B6MA 3CCJQ 1HQUA 2DYIA 5GJWB 1D09B 2J6TA 3HKZD 2CQBA 2OPRA 1X4FA 2EFQA 3EVMA 2ZJQQ 5LMNF 3E2UA 1LW0B 3M32B 4QIFA 1N6QA 3K89A 3F70A 4M63A 3BKUA 2EAYA 2XMAA 4MK7A 4LT6A 1IR0A 4ORZA 1TVRB 4RO0A 4V2SA 2B7BB 4EYIB 3AB4B 1QWEA 2D0QB 3MKDA 3CCQT 1OEBA 2GTJA 2Q43A 4C92B 1I51B 5KG1A 1K8AT 3CCMT 3OR1A 1KQ2A 4A8MP 3CBMA 4NEZA 3PFEA 5KFEA 3D6FB 4K11A 4BB7A 2OTJA 1VQSA 1UPPA 1BUXA 1HIYA 4GLMA 2O5DA 1M4ZA 2C2EA 5HK4A 2DL4A 2X1AA 2E66A 5I2MA 3HT3A 2XY6A 3RBDA 2KT3A 1RT6A 4ECSA 1CLFA 3O8VA 4ZP8A 4C6AA 4XQ3A 1SRMA 4NX9A 2W8LA 4JB8B 5KT5A 5HP1B 3GJQB 3N0VA 1UGQB 1RWUA 4OMMA 4DR4F 3QWYA 1H3DA 1AROP 5AE2A 4DQ2A 1YJNS 3M0PA 2M02A 4AYBD 2E65A 1UTAA 1ZUYA 2KJVA 4N41A 2EFGA 4WF2A 2BUDA 2RHZA 1H7WA 1GFCA 4PPZA 2QG9B 2YKMB 3ILOA 2H5EA 1UHFA 3Q8YA 1N0UA 2LEAA 5ETOA 4OVAA 3VZIA 2CYZB 3I9QA 4P74A 4X4OA 5KFJA 2ZH7A 3SHWA 2VASA 2BE9B 3NLCA 3MMCA 1Q78A 1R8OB 3OTOF 3BBFA 1NHVA 3DU6A 1HBNB 1LWEA 3RBEA 1R8PA 3SCIE 4P2MA 3FMBA 4R0JA 2IBKA 3CXCS 4DFPA 4C5IA 5L23A 2HS3A 5GAN5 4ZVHA 5DLGA 2QDYB 3OR2B 5LMUF 3QGHA 3SSQA 3NMZC 2FJBB 4KFBB 4C8YA 2GS8A 4IUPA 3M8WA 2BEFA 5C0MA 2YUQA 3RDVA 3MDFA 4HCCA 2CQ0A 2RI5A 3KG0A 4KE5A 4LNPA 1QTNB 1FDAA 5BYRA 3ZTPA 4IH6A 1U0SA 5GAEU 2J6FA 5CK9A 3R97A 3GFHA 1NUEA 5L39A 4ER8A 2F5TX 1BK2A 1V5VA 1ZUKA 1FVQA 2V6AA 1SEMA 2Z57B 3KUEA 4ATOA 3LAKA 4F7VA 2XIDA 1S77D 1WJSA 1VQOA 3I9V9 3VAFA 4K4YA 2KK4A 1F60B 1TKZA 3HMJG 1GMVA 2H3EB 4HVUA 1C2PA 2UU9F 3R5DA 4DX5A 3EVOA 1EHWA 1FWLA 5AE1A 1QVGS 3RKXA 5DG9A 1FTRA 5CCLA 3QSUA 2V9WA 2V2ZA 3M0RA 5I11A 4E6RA 2X51A 4M78A 3MEEB 4DF8A 2EKHA 1WHYA 3K2YA 4CRJA 5DDRC 3QGIA 2YVSA 4C0FA 3RGIA 3CD0A 4PJMA 5I3UB 4OB3B 5GANd 1HBUB 5DY9A 4C3KA 3EG9A 3GIIA 2DM1A 4M75G 2GQQA 4NOHA 1T05B 1LOUA 2VIHA 1X5TA 4YMEA 1KC8C 2I6WA 1N0VC 4C8KA 2QGFB 1WHGA 3M8RA 3R6LB 4HKEA 3JCMW 3HHDA 2CREA 1M5PC 1JXMA 4H4MA 1HPZB 1MW7A 3M2UB 4EK2A 1GBRA 1U4BA 3TYTA 2JN0A 3CCLA 3VAKA 4OMLA 3J81Y 1RKJA 2YKNB 2M1HA 1X4BA 2EG2A 2CNKB 4DV2F 2ZAEA 2PO4A 1T03A 2GZOA 2R8KA 1VQKA 4LFAJ 2YQ1A 3U1MA 3DLHA 3NGSA 4LR8A 3DRPB 1SHFA 3G8TA 4WPAA 3N6NA 1RA6A 2W7OA 1BCOA 3HJFA 5B0AA 4MIAA 2W4DA 4ETXA 2H48B 5HK0A 2E9RX 1HK9A 2NUZA 2YHTA 2HVIA 4M5DA 3M30A 3L2VA 4XTVA 4JDSA 4DU7A 3I0SB 1B3QA 5LJ5Y 1UFFA 1VQPQ 1BQNA 3LGNA 2OPQA 1PAEX 2AGPA 1AVZC 2RK1A 1OY9A 2HEKA 2RJCA 4CT9A 4MDXA 4CIOA 2KHDA 1LNXA 3SCKE 1XERA 2F8HA 3A8LB 1SIWB 3GPAA 4M77A 2HBYB 1T02A 2HYIB 8RUCA 1FE4A 5A0YA 4AXJA 2D8HA 4M7AC 2LZ6B 1TG0A 2WSCE 4UT4A 1Q7YU 2GJ2A 3G82A 3DRSA 1SH0A 1B7YB 3C14A 2MOXA 4R55A 2GV1A 1S6PB 4M7DG 1KD1C 2FY1A 1SH3A 5FIIA 4RW9A 5B0DA 1U48A 1YIJS 2OI2A 4FXWA 2OTJT 1GXIE 2LEPA 4HLBA 3UN2A 2VQFJ 2XK0A 3CD6A 1VHIA 5F0UA 2W24A 1VQ6A 3L9ZA 3TEGA 3QXEB 4WU2A 1M1KR 3TAMA 4DV5J 1Z2ZA 2BX6A 4EWTA 3PGGA 2MWPA 3DLMA 3TSZA 3DFEA 3ICLA 3J80Y 2CJXB 4LRBA 1NJIC 1VQ5A 3BYRA 3PVLA 1PBUA 3CC4S 1S0OA 1R0AB 1S72S 5IQ6A 1HI1A 4J5OA 4Q5WA 2GFAA 2B8QA 2APOA 3SQGA 4XTWA 2FJVA 4NXNJ 5FU6B 4DF4A 5IXBA 4HHJA 4DV0F 3PJ9A 4P9SA 2VF3A 4DPWA 2DCUB 4BS2A 3BR9A 5KYWA 3QBYA 3PRDA 1GFDA 3KLEA 3CJ8A 2AJ1A 2ASLA 2F2XA 1PD1A 1YJNQ 2M70A 1QUVA 2V4QA 1GQEA 2B3TB 1IWGA 2KPPA 1XNQJ 5CCAA 1Q8LA 2CNLB 1BYMA 4AD6A 3TCJA 1UKUA 5KFCA 3KUGA 3MHYA 4DS4A 3TAQA 2B8AA 5GMKi 1D0YA 3TZYA 4ED1A 2OI3A 4OHXA 4PWWA 3EM1A 4NLQA 3Q8PB 2VA2A 3I5SA 1I5LA 4C8QF 2GCXA 1M90U 4DV4F 2KBTA 1ZUUA 3V6DB 1X0PA 4DCJB 2IHR1 2XICA 2EQIA 3OMGA 5LOQA 5J2QA 1PD0A 2HVEA 4PJJA 2A37A 1E6GA 4Z89A 5H9FK 1XTDA 2HNYB 3C12A 1Q8KA 2CQDA 2HHXA 1SKWA 2D3OR 1FKPA 3W5YA 3O5ZA 4C0HA 4P7TA 4ZCLA 2RU3A 3DGPA 1X6GA 2Z4PA 2HQHA 2L9NA 3BGLA 2GFFA 5KFNA 4B3MJ 3A3NB 4DV7F 4DR5J 1VJWA 5DDQC 4M75B 1K44A 1SSHA 3VAJA 1VQOT 3B82A 2ALYB 1WTBA 2ZD1A 1CJKB 4UW2A 4QU7A 2V8VA 3AAWB 2E1RA 4JI7J 5A76A 3PIPQ 2DTOA 1ZAXA 1U1SA 3L2UA 1HI0P 3QKJA 4B9MA 1S1XB 4K4ZA 2WTFA 4ECWA 2FHJD 5KFBA 5DLOA 4J9QA 2DXBA 3JAME 4DSIA 4UOGA 1NK8A 2AHJB 4C0DB 2AEFA 2COZA 1W4SA 2XMWA 2HBQB 1WGSA 2R7RA 1BI3A 3EX7B 2JLEA 1FJ7A 1JLAA 1EX8A 3MMBA 2GMJA 3ITHB 3SDEB 2WACA 3LP0B 1M0SA 3DN9A 4O3RA 2XMFA 1EQMA 4XU3A 3V7RA 1KQFB 2DRAA 3A8MB 5HBMA 3I55S 4FU6A 3OYLA 3L09A 5DJBA 5L9NA 3CMAT 1Q5YA 5I3QA 3QDRB 2AT1B 2BW7A 2N7CA 2P0PA 3V7SA 1FMWA 1H3ZA 1UA1A 4X9CA 3BGUA 4PAAA 5DS7A 2DH9A 4J9RA 1Y96B 1Q81C 3CCLT 2DNOA 3CPWS 5IZHA 1P92A 1S9EA 1Y57A 1ARKA 1KQSA 1YN8A 4JRIA 3MCAB 1TL1B 3FC3A 4AL7A 2HZYA 1UCNA 1VQKT 2K3BA 3E51A 5IHKA 2ILZA 1VHFA 2ZBIA 3A8KA 3UPUA 3QPIA 3TU4K 2CFXA 4ECQA 2FO0A 3GP9A 2VBZA 1KSWA 4EMDA 2XEXA 2FTRA 1RTIA 4K4XA 1QKXA 4JI0F 1T11A 1SQEA 4M7DB 2CQHA 3PYFA 2ADCA 2KFZA 5HVFA 1RT5A 4DV3F 2DY9A 3IBWA 1RBLA 3AXMA 3M59A 4F2RA 1FDBA 1CS4A 3DRYA 4DR2J 1YG0A 4ZS6A 4PYAA 1FE0A 1HARA 2BJEA 3REAB 3IM9A 3NCQA 3HSZA 1G6BA 1CQMA 5CKDA 3G71A 2Y3YA 1PYTA 1MNEA 2LQ5A 4LF4F 3OYCA 3I4PA 3T1HJ 2UUBF 3ZNUA 5KYXB 1QCNA 2FB7A 2ZOMA 1EB0A 2WW4A 2QXFA 2P4TA 5DQHA 1WA7A 4PYDA 4ILRA 3THVA 1N8RU 1YQHA 2JHEA 5GAOm 2YT6A 4CH7A 4IFYB 4NZ0A 4Z88A 3I96A 4GKKF 2RSQA 2DIVA 2UV8A 1WC5A 3FRZA 4HL9A 4PRFA 4JI4F 5LJ5d 2D9TA 3D0HE 1UECA 4DMZA 3CD6T 1QUPA 4ZVPB 4IDKA 1VQ6T 1HNZF 2A18A 4M7AA 4DSLA 1YIJQ 4U9RA 3PNWC 1UUEA 1DTTA 2DNNA 4QR1A 4G1QB 2F63A 3QG1A 1APSA 2JS0A 4UY85 1G5VA 3R6GB 4Q45A 3CDBA 3M8PB 3VQTA 2R5MA 2MSTA 3POTA 1VQ5T 3ZZ0A 3M9OB 3OYAA 3CPFA 4A0UA 5KFWA 2MGZA 2MHNA 1R7IA 1DQ9A 1EX4A 3CO0P 3SQOP 3CC4Q 2IIHA 3TVZA 1S72Q 5KYYA 2V8GA 3EZOA 2DT9A 1R8AA 2ABLA 3A4TA 2VKZG 2BKPA 2CUBA 4CO4A 2MLXA 1BB9A 4IG0B 2BXJA 3KUFA 1YTYA 3HFZB 4X4VA 1UG1A 4K59A 2L3PA 2D1CA 5C7PA 3LGMA 3EFSA 2VC0A 2Y0BB 2FPDA 2VXEA 4I0WA 4W92B 3CMAS 4RJVA 4JV5F 3UF4A 1KDNA 2N3LA 3BDPA 2A36A 4FM4B 1OULA 2MEWA 2XYGB 5L8RC 1MN9A 1RU1A 4O4GB 5GANj 3CTRA 2WB4A 4CYUA 1Z9ZA 4RPFA 1DURA 4J6WA 1TSFA 1VYAA 2HIQA 1L3KA 3LX7A 2DNPA 3DRXA 4CO5A 4DL7A 2R7XA 1R27B 1UZHA 2DGXA 1I4K1 2G1HA 3VUBA 2HG4A 4DR3F 2FJAB 2QC3A 5B09A 5HQLA 4MH8A 4GMKA 3EG0A 2QQAA 3M32A 1S99A 2KI7A 3K57A 2E70A 5FWCA 4ITSA 2CSQA 1UEUA 3I56S 2FL7A 2KH9A 5HMXA 2FVPA 4DQQA 1TVRA 2C3PA 2QA4G 3LW5C 4PQUA 3LOUA 5DQGA 1Q82C 2ERRA 3DOKA 3JSMB 2F65A 1H7XA 5KG4A 2YNGB 3OTBA 1ZTWA 4F25A 1X69A 2QSWA 2LLZA 4OJGA 1VQ7S 2EVZA 4M78E 4L6V5 1XBWA 3NBPA 1ZZNA 1GK8A 2RILA 2MWOA 1HNVB 4UQGA 2O66A 4F7UF 3RB0A 1BMQB 3P96A 1WFWA 5DZ7A 3CC7A 3W9JA 4LFCF 3MM6B 2OMOA 5A6PA 2FVUA 2KN4A 5J2MB 3W9HA 3O2IA 1VC6A 3TSWA 3PX0A 2QA4S 3L2ZA 5GMKm 2RHQB 1K9MC 5F8NA 4OX8A 1HBMA 4LF6J 1QE1A 3RW7A 3OL8A 1Q86U 2B9WA 4W98A 4ANEA 3JB9J 1LPLA 3AJDA 2JXBA 4QQDA 5EX3A 4ESNA 3I87A 3BSNA 4NOYA 1S1UB 1FX2A 2L5QA 2GQ2A 3OSPA 3W2WB 1XR7A 3H4BA 2OP5A 4Z02A 5F0WA 2EJGA 1CJUA 2BE2A 1W70A 1YBUA 3UCGA 2ZH3A 3EXYA 1VBZA 2GIRA 4DBRA 1NB2A 1AEYA 4RW7B 5RUBA 2A6OA 4LDVA 4HH0A 2CZ7B 3I55Q 2GTOA 1K73R 1X9SA 1O8BA 2DKGA 1MMAA 2POKA 2EQUA 3FSIA 3T6JA 1WF0A 2A3JA 2YSQA 4O3SA 2ZZMA 1N36F 5T7LA 3JCMc 2PA3A 1KC8T 1O5JA 2DXEA 3BPDA 2XDPA 3GNFB 4DPUA 3M0UA 3VVUA 2X35A 2E44A 4M77E 1SQFA 2FVQA 2L3QA 2ZE2B 1S1VB 2X4WA 4GKJJ 3G8SA 4MTPA 3VTIA 2YUPA 3CJ3A 2EBPA 1RJJA 2O1PA 4V19J 4KGVB 1N33F 2D74B 4RBTA 1BKBA 2DXDA 2XNQA 2XC9A 4BE0A 1C4CA 3UCZP 1FFWB 1ZYQA 3LTOA 1I94F 2FZCB 3KHLA 2BJ8A 1U1KA 4J7CA 4OI4A 3VS0A 2HSPA 2EBEA 5LJ3h 4U8VA 3G71T 2KHCA 2BBEA 3ZFVA 1WHMA 2H65B 2KNBB 1C1CB 3IG1A 1RLDA 4CNYA 1RAEB 1ZA2B 1KTVA 4DPTA 1X75C 1FRIA 1HMVB 1U7LA 2J0WA 2DD4A 2MY7A 2ENMA 4JRPA 3MCNA 5HQ8A 4NPOA 2EKYA 1O9SA 4ID5A 1BQMA 3O44A 1JJCB 1WYXA 1DJ7B 3V4MA 2EC2A 1IR2A 2K79A 4L3NA 4OZJA 3EVWA 4Y28C 3K58A 2KDOA 3FKBA 5FRMA 1KP6A 4DV1F 3W66A 3PO4A 3MEEA 2ROGA 4BUGA 1X60A 2IDLA 2DNHA 4RNOA 3VGUA 2EYZA 4PXBA 3AJ1A 1C0TB 2ED0A 2XSJB 4RKUC 2K06A 1KD1T 4A54A 1FXXA 3EGXA 3CT9A 1M9SA 1U1LA 3HRUA 3BSAA 2VONA 3SIPB 4TLQA 3EGDB 4AFSC 4X66F 4ZLLA 1KVIA 4EZ6A 5I2SA 3G6ES 1B3TA 3JSCA 4FS2A 3PJXA 3PE0A 2BZXA 2F9DA 5EWEA 4A8YA 3CBPA 4ICLB 2HGMA 4NL2A 5E41A 2GCFA 4TYAA 3L1AA 1XWLA 4G3IA 2HQGA 4LD9K 3N28A 2LJ0A 1NJIT 2J76E 4M5NA 5KCOA 4YY3F 4WCEQ 1TL3A 2EK6A 3BDEA 1WG5A 3DRPA 3W5XA 4M5KA 4DN0A 3PKMA 4LRCA 3GIKA 3WC2A 1ABOA 1D9FA 1R8HA 3UD3P 2PI4A 2PQWA 2VB6A 3HVTA 4KGKA 5GAN7 3HHNB 3R1HA 2RI3A 3CMAQ 3C15B 3TREA 1G2BA 4WFYA 1GXTA 5IQQA 3MM7B 2NXNA 2R8IA 4CC3A 2EQKA 3PVXA 2VWFA 5LL6d 1VA7A 2DYBA 3OHAA 3MECA 2HNIA 4MZTA 1RK8A 2PNIA 3UN5A 3A98A 2RF2A 3NS6A 5HVHA 2HVZA 4ZVQB 1LK7A 2P2CB 3OS5A 2B6AA 4YR0A 4PUOB 4FW1A 1WJRA 3GP8A 3I82A 4OJ1A 1RWWB 5G0RB 2KR3A 1N32F 3I56Q 6FD1A 4BI8B 1AYEA 2VDHA 2PMHA 2JX2A 4KTQA 4OYZA 3MPYA 2ZH6A 3QHSA 2ZJRQ 2V8PA 2F8EX 3W62A 2Y90A 3MP8A 1YJ9A 3MFHA 4RW8B 3P6YC 3HO1A 1HD3A 3V8JA 3CC2T 1HQEA 4IKFA 1F5CA 1LEOA 3MEGA 2V26A 1YCSB 1MUZA 3ADAC 1UGRB 2QZ8A 4M78D 2V8JA 2B43A 4KUIA 1TH7A 3OYDA 3KFVA 2BVZA 5GANe 2GHPA 5JUMA 3KMSA 3H2LA 2IMWP 2GFUA 2YRVA 5I4MA 5D3GB 1VBYA 1R89A 4X64J 1VQLS 3J81j 1LXJA 1IKWA 1NSAA 1IKXB 2MAMA 4CTAA 3LANA 4WFZA 2JC0A 1R0AA 4PJOF 2EFNA 2I2YA 3QFWA 4USUA 3UDEA 2DZ9A 3E9GA 4YUDA 1NJZA 1T0JA 4J7IA 4OI0A 2CPJA 1N5TA 3MURP 1UW9A 4CH1A 1RT3B 2BKOA 2BIVA 2Q6CA 3U27A 2MKIA 1Q16B 1YVFA 5GAEI 1YJUA 5CHCB 5LJ5j 3V2UC 3R5AA 1H38A 4P73A 4URGA 3C16A 1UVKA 2HFOA 1BIBA 2VBXA 5EN1A 1WF2A 4NLPA 4QOTA 1XMBA 2LDIA 3QLHB 4ID8A 1ZX6A 2AJ2A 2DR6A 1JO8A 5A8WB 4IH7A 4JLIA 1CC8A 1X6OA 1RAAB 4R5PB 3SV4A 4D8KA 2MQPA 4LF7J 1WXBA 2F1LA 1HYSB 2FYXA 2YNFB 4ZPWR 5CCMA 3M6VA 4J90A 1JXVA 2KXNB 4F4XA 3PHTA 4C8QC 1X43A 4M77D 4HKQA 3JCMQ 4M4ZA 1RWXB 2LVWA 4C0OC 1B34A 1GH8A 2RH3A 4C5EA 1N34F 2F4VF 4GRSA 1N5YB 4M5GA 1WNEA 2DNUA 3IRWP 4RNFA 3ZTQA 1FD2A 3K8VA 1WSVA 3HHLD 2J7UA 3KJVA 3DDNA 4M7AE 2YY3A 3TZXA 2KMTA 3CCUS 4N56A 2VGNA 2XYHB 2FJWA 3REBB 4IQXA 2HEQA 1W25A 3META 3CJ2A 4ED6A 1CJKA 4IOBA 4NMLA 2DGTA 3IQLA 4YB1P 2HQIA 4X4TA 1IBKF 5GANf 2JDJA 1BQXA 1BE4A 1LV5A 2C2NA 1UJYA 2CZ4A 2Z30B 2QIFA 1LWFA 5IT9U 2E5LF 1NK7A 4PLLA 2PFDA 3C6UB 1WHHA 4UQTA 1YITS 2ATLA 3SSSA 2E29A 4HXJA 5J1NA 1QTMA 5AYFA 2LMIA 1JJHA 2ZH2A 5HJXA 2NSCA 1JJ2S 2NSBA 3ILJA 2D3ZA 3QATA 1WI6A 3OHBA 5IOLA 3AHPA 2M0YA 3DDKA 1BI0A 2FLPA 5F8GA 4ZVUB 2DY1A 3TI0A 4DLGA 2QDLA 3MEVA 2JVOA 3ZZOA 4ZVTB 2AU0A 3HFNA 2CYYA 3IXQA 1C0UB 1JJ4A 2PTKA 1Y5LB 4GC7A 2VZ9A 2E3HA 3UNYA 5GJVB 3TEEA 1YRUA 4Q44A 4LF8F 2K57A 3HSDA 5H9EJ 2RQTA 4CT8A 2Y8WA 4Q0BB 5KG2A 2YTCA 1TL1A 4ERDA 2FG0A 5A8KB 2KG0A 2K7JA 4KV8A 3CDAA 4A4KA 2EFOA 2R7VA 5EWFA 1FJEB 4EMHA 4USMA 5JXSA 3TWZA 3B4DA 4UF4A 1AD5A 1M1KU 5ADZA 1QQJA 5F8MA 2AIRB 2MMYA 2JZ2A 2H54B 5GAN3 5J3BA 1F9HA 2F40A 3UVJA 3JB9D 1RLQC 2YDLA 4II1A 3K7RA 1GMWA 3OYGA 3W9IA 2ZPHB 4FF4A 1ZBXA 3HSBA 4KRWA 4PG5A 2PC6A 1FVSA 2HNZB 5KG0A 4B9TA 4MKYA 2Z2LA 1RTJA 4PQAA 5KH6A 3EYZA 4KQZA 4CO2A 1RTHB 2VPWB 4DZDA 3KLGB 3OW2R 2CVEA 2RHUA 3KK3A 5KYXA 3UD5A 1CBKA 1M5Q1 2B5JB 1WC1A 2EKNA 2UVVA 2UXDJ 2KRSA 1IQZA 2AYBA 3ISZA 3RAMA 2E7XA 2FD2A 2RPNA 1G3YA 1GAOA 3KK1B 1KTQA 3BDLA 4B9NA 3CCVS 4BWMA 2O9SA 4EBEA 2CJYB 4ZPBA 2YWHA 2JVRA 5ETNA 1AOJA 3SDZA 2WOMB 4MMLA 2XULA 1RHQB 3M2VB 2UUAF 2E5QA 1G3OA 3VS6A 2XU8A 1HNWJ 2JSXA 1Q82T 1M5HA 1YDLA 1UVIA 2QMUB 1XR5A 2M9KA 3NGUA 4CP5A 1VQLQ 2F2WA 1Q5VA 4Y65A 5HL7Q 2ZCFB 2RUSA 3TW0A 2NREA 2I5JA 4DA4A 1BU1A 2QJ3A 1KLMB 2LU2A 2ZNYA 4ZN3A 1W2BP 3LALA 3BSOA 4CC4B 2K5FA 2VGMA 4IUVA 1K9MT 4A4EA 5CYMA 4BWJA 2RJEA 1OPIA 2K2VA 3CMET 2RDDA 1YLXA 5DDOC 2WVDA 1RHJB 2ZC4A 2CZ9A 2K7AA 3EE3A 5KG5A 1QVFA 1PYSB 1JLFA 2WSEE 4FW2A 2KEAA 1V29B 5G4DA 4O4GA 1BXNA 3HVRA 3T5KA 2BTTA 4RTXA 5KYNA 2RQVA 3OYJA 2FLLA 4IFVA 4OHVA 2F9JA 2P4RA 1H2UX 2EJ9A 2H4YB 4E7IA 4JP8A 2OD4A 5JVGQ 3DYAB 2Z2ZA 2HW3A 3BN7A 1JLEB 4MYUA 1UAWA 1PILA 5GAGU 1L3TA 1T3SA 3OSVA 3SWNB 2CNNB 3QIPB 3H41A 1URRA 2DKOB 1XMQF 4PNOA 3DI6A 1JLGA 2A2CA 4EYHB 2UUWA 3HDSA 4L74A 4DG1B 4L59A 3ZZPA 4E47A 1Z1ZA 2VJUA 4JJNK 4HDGA 3KJQB 2RKIA 4Y00A 1W2BA 4XTYA 1VGYA 2YX7A 4FXDA 3H5UA 1VQ4A 3OFEA 4G6VB 1JKHA 2LVMA 5K9FA 2W2PP 1JIHA 2YH0A 2YNGA 2VQEF 1B0VA 5LJ5e 2FJDB 4F3MA 2QQBA 1X9WA 1FRMA 3EG1A 2HHPA 1UJ6A 2RN8A 3P5TL 4C8QA 2K3IA 2JOYA 3HRTA 1BCMA 3OTCA 3CCUQ 4M7AD 3URGA 4JI6F 1ROFA 2EGEA 2DCLA 1B4SA 4OMNA 4OB1B 2XSFA 5AJ3J 3M57A 1Z2LA 1SG5A 4OYPA 1WDXA 3R27A 2XYPB 3JRZA 3OYEA 3GYNA 2DK3A 2J9DA 3G87A 4YDDB 1S7HA 2LRQA 3CCJA 2J7KA 1LNQA 1NSKL 3TAPA 4ED4A 1VS3A 5A2QE 2C3OA 3OBYA 1PKSA 5I21A 3JQMA 3GWCA 3CDWA 2NPFA 1YITQ 2GVDA 1TK8A 5IT9E 3CC2Q 4M78G 2GNCA 2M0GB 3OL6A 3GU0A 3I4HX 3EG3A 4ZLPA 2ZPFB 5FDLB 3N9UC 3CCRS 3TQ7P 3S8SA 3G96A 4KKOB 3LWHA 3R5CA 3GLXA 1HBOB 2ZZDA 1JX4A 1YWPA 1G4CA 4JYAJ 2MZTA 4USKA 3D1OA 4KT0C 4RUCA 3HXMA 3G4ST 4BY6C 1HQUB 2V4JA 3OFGA 4XIUA 3QJYA 1JLBA 3PG9A 1TAUA 4OV6A 2CPXA 4P2SA 2OUGA 3U23A 2H8HA 3MEUA 1EIYB 3CMES 3QRPA 4DR7F 3MCOA 1ZM9A 1ZA1B 1VISA 2E1PA 2PU9B 4LE9A 2DNZA 1WC3A 3QT7A 1GXLA 1Z4UA 2XCAA 1WLPB 2IMOA 4BCAA 2HZCA 4BE2A 2YX1A 2KXDA 1NHKL 1TP7A 2WVFA 2CRLA 4IOCQ 3OR1B 5DGBA 2RT3A 1I1GA 3MMAA 4C92D 4EEYA 3TZWA 2XLKA 5GADU 3DCAA 1VCTA 3I9ZA 3ZXWA 2E7VA 4BC7A 1C1CA 3R2DJ 4PKCC 4OL8A 5LJ5f 3JB9I 2IRXA 3FNNA 2DIGA 2CQCA 3HI9A 4OP0A 5KE3A 1RT6B 5GMKh 2FZKB 3R8YA 1P9QC 2WCXA 3K5MA 1B70B 5M9OA 2N4CA 1EAYC 2W2QP 2B56A 4XAKA 3PR5B 2ZOFA 1WXTA 4Z8AA 3PMTA 4MZMA 2Q3PA 1TELA 1U1RA 1GFWB 2ADBA 4K4VA 2HBPA 5HLFA 3CCES 2Z2MA 2CT3A 2R58A 4BD3A 4ED0A 3DMJA 2JS2A 1HW8A 2CWKA 3NNCA 2EW3A 4MT1A 3EGNA 3CCVQ 3BKFA 4OHWA 4DFKA 5IWAJ 4CO0A 5GMKl 1C0TA 3Q8RB 1YWOA 2XSJA 2K3KA 3PW4A 3LLRA 4FN5A 1D0EA 1QSYA 4TVAB 1QSLA 1OOTA 4TVRA 2RQWA 2OPPA 4B02A 1OSCA 1ITPA 1AFIA 4JUZA 2IM3A 4NXMF 4KHRA 4ZK7M 1WHVA 3NMAA 2NLUA 4ICLA 2B8PA 5M2RA 3MMCB 1U24A 3HD2A 2CJKA 4PL6A 3GONA 1ZTTA 4U8YA 3FDSA 2V2VA 3TVKA 1KQ1A 3GR0A 4Q5VA 3JQJA 1SUQB 1YNZA 4HVWA 2FUG9 4F26A 2GGPB 4EO8A 2YLCA 1TK0A 3RERA 1UGVA 4DV6J 3WIVA 4JV1A 2W0ZA 2XS2A 3QWUA 3G4SS 4ZPDA 2LNHB 3DDIA 2GF7A 2FLOA 1OX9A 4TY8A 4F4KA 3RAXA 1GXUA 2RK2A 2B9YA 4DSJA 3TEHB 2Y1LB 2EFIA 4XU2A 1K0SA 2P6TA 4M75E 4RU2A 5IC6B 1BC6A 1YSJA 2DIQA 2Y0SD 2WVBA 1IKVA 4J9GA 4RNHA 1ICEB 2ASDA 2E9TA 4RNMA 2J6SA 3VS7A 5G0RA 2CJ9A 1JNRB 4E8UA 4G1IA 1NKEA 1VQ4T 2HKQB 3H2UB 4GO5X 1RL2A 2RAQA 2DRMA 3MTKA 4K8RA 2CP0A 1BY9A 3QGPA 4X65J 3RNJA 1K73U 3MEDB 4PJNA 3RRHA 1YCYA 1U6FA 3D54A 3FCWA 4QQGA 1RZMA 3FJ2A 5KFGA 3S3NA 3FFIA 1M1GA 4M78B 3NP5A 2X3DA 3CCTA 4KIAA 5HY6A 1ZPVA 2DL8A 1UEVA 1OZ3A 5CYJA 2K2MA 4G65A 3EG9B 2HWHA 4FF3A 3FCVA 2AHOB 2LX7A 1LQ9A 1MU2A 3TANA 4WZMA 4P2XA 1V3RA 2WW8A 3IO1A 2WVCA 4AL6A 1KJWA 4ZGJB 4EPCA 3HT0A 2DR7A 2OSQA 2MLYA 2E1AA 1CVJA 1T9TA 1FJGJ 1VQPA 1GBQA 5D4NA 2P84A 4H4MB 4F04B 2YX4A 3K5NA 4J9EA 4E0DA 5CVIA 1QMCA 4RKUE 1S6OA 4YP3A 4Q8EA 5GAMf 3MMJA 1T03B 5KFOA 2BV3A 3A8JA 2HHVA 2P0KA 3RMQA 1PJ6A 2QI2A 2YXYA 3ULHA 3Q86A 4PJOC 3DLKB 2J8SA 3GIMA 2OAWA 2CDQA 3DKDA 1V6HA 3KBGA 2MB0B 3E9FA 3P49B 4WIQA 4F7UA 3C8YA 3E8OA 5D6WA 3MAQA 2NQPA 1KFZA 2LYVA 4MAKA 3X20B 3CCRQ 2K1RA 4I67A 5EHHA 3HJVA 4M5DB 3M30B 3QLHA 3FEOA 2IC3A 2EBGA 5ECAA 1T9WA 4PG8A 2VG6A 1RHUB 5E33A 2OPQB 3T1YJ 1IWAA 3EICA 1YRTA 1URNA 5F8IA 3H2VE 3EMTA 5A8WA 2C3MA 2KXHA 4F0HA 3S7RA 2KT8A 4KULA 3P8HA 1UEKA 1Q1KA 3NRBA 2PFFB 3VKIA 3EH1A 3BGFA 1L3SA 3MOZA 4FYWB 2YNFA 2RH2A 1RWVB 2FLNA 1RI7A 3PTAA 4WJBA 3CMEQ 2FEIA 2Y4XA 3FJPA 4MMOA 3MTJA 3UCUP 1K0TA 4C9DA 4OZ2A 2GAHC 3DRSB 4Y6IA 3RYLA 3C14B 2ILYA 2RDIA 2BANA 2A7YA 2E1HA 2NUPA 2GMLA 2RRBA 4RW9B 3R9LA 4IRDA 1C0MA 2WHOA 2J8AA 2AX1A 4UOFA 1NLOC 1IBLJ 2E6NA 3AOBA 2CQ4A 3TAMB 1YJNA 4RX6A 1S5ZA 2RQRA 3H8ZA 3L4BC 2JLGA 1D1UA 3UN3A 2OJ2A 3HL8A 3OXLA 1MMLA 1JQQA 2W9BA 3SI8A 3G6VA 1HWLA 4M8LA 2VICA 3HKWA 4A8WA 4LN2A 4CLTA 2YLBA 4RTYA 4O44B 2E41A 3SQGB 2FPEA 3CD7A 4LDXA 3VJPA 4DFMA 1JBMA 1KKHA 1RADB 4EBDA 5LJ3Y 1VQ9S 4P10A 1YJWT 1WEZA 4TLRA 4ZHRB 3BV8A 2IA0A 3D5MA 2WBRA 3A1YG 5KYWB 3CCEQ 5A0GA 3KLEB 1PIEA 4RCBA 4I1TA 1NPKA 2LJ1A 7FDRA 3D3BJ 4M7AG 3CXCA 1CJTA 1U2RA 2GQCA 3GE9A 4LSZB 3BF4A 2KDSA 1QVGP 5DDPC 2VH7A 2LQKA 4YN3B 3GJTB 1AT1B 3QMQA 2FYKA 4QIWD 5ETLA 2CA9A 1TR0A 1U6BA 5KCHA 4WE1A 3IGVA 1ZAWA 1RT7A 1C0UA 5GAN2 4YHHJ 1F2GA 1O75A 1GMUA 3VQSA 4J9DA 4OGCA 1Y9OA 2V67A 5T14A 3KHRA 1DBDA 3GJSB 5CZVA 3UQSA 1NYFA 2X4XA 3VUZA 4TKTA 2OLWA 4AT1B 3O8WA 1FO1A 3UDCA 3ILIA 3FEXB 3BQ2A 1QAYA 2AZ1A 2MZRA 3PIPA 1U1MA 3CGIA 4F67A 4X4RA 2CQ3A 2XNRA 1UDLA 1VQ8T 4NLRA 4LFAF 2IJNA 3FBBA 1HR0J 5H9FJ 1JXLA 4I2QA 4KAIA 2MMPA 4QKUA 2XLJA 1ZBJA 1RE1B 2G1DA 3G4SQ 1QVGA 4IOAQ 9ATCB 3IFEA 4ECXA 3EFRA 3X1LB 4X4UA 1NPPA 3TZZA 1HJDA 1RKIA 2Z0WA 2ZD1B 4M75D 1V76A 1WQWA 2B5JA 2X4JA 4B3SJ 5HROA 1E6YA 2CPHA 2RO0A 4B3RJ 2EYYA 4E2FB 2D9OA 4Q7AA 3R7BB 3PT9A 2HIYA 3QO9A 4HACA 1MNDA 1YI2S 2WVEA 2HHHJ 3UDLA 1NB7A 1VR6A 1NZ8A 3KK1A 2FHDA 4DWIA 2C2MB 4ED3A 2IM1A 1P27B 4PXDA 5E3CA 2AF6A 1WEYA 3EHQA 4MK9A 3TJAA 2AP6A 1N56A 3OBWA 1SC4B 1JLAB 3MMBB 2I0NA 3M2VA 1VQMT 1U0HB 2R3VA 1V5IB 2HWIA 2VQFF 1P1LA 5HBMB 1RI9A 2DHAA 2LQNA 4Y2IA 4NLXA 1S0NA 5ETKA 4DV5F 3RB6A 4QPTA 1VQPT 2RQUA 5H1SV 3NNAA 3C6TA 1X5PA 1QVPA 1QM9A 2HQDA 2QEXT 3SCLE 1PRLC 2ZZTA 1PBAA 1S9EB 3MUTP 1RCXB 2EKOA 5A0LA 3T9NA 2J6UA 2W25A 4J8OA 5F8LA 2DITA 3PYDA 2IJRA 2V8HA 4Y0FA 3BFMA 4NXNF 2DJQA 4NLYA 1HW9A 2HNDA 1KQSR 5B0BA 2C1EB 3L2WA 2G0IA 4RUBA 3CC7S 2GIFA 2XMKA 4GO7X 4I7FA 3VAHA 4WKRA 2XHCA 1U1TA 1ZM3A 2PD1A 2CXEA 4DBQA 5EWGA 4FVCA 3PY8A 1AA1B 3CEDA 2R7TA 1CULA 2HS4A 1RT5B 1YRXA 2PUOB 3PJWA 2JW4A 4RWXA 1CS4B 4LF5J 2O4XA 4F4YA 1XNQF 4ILLA 1BGXT 2K9GA 4PJOA 1D1BA 1NBEB 5AXMA 2G0CA 2OFGX 3LWIA 1YIJA 3DYAA 1HHSA 1DJ0A 3I35A 4I64A 4LUDA 3OVBA 1NZ9A 2DRBA 2H5IB 2VHGA 2CPYA 3TJ8A 3H40A 4XU1A 1MMNA 3T5HA 1WWHA 4JJCA 5D4LA 2D1XA 2UVRA 4HT9A 3SB2A 1YGYA 3MJXA 4AFUC 2DD8S 2J6OA 3OYBA 2DNLA 4EDUA 2M88A 2GQIA 3CC4A 1TV6A 3PNIA 1S72A 1IBMJ 5KG3A 3EH2A 3ETOA 4KBIA 2JZ5A 4I56A 3JCMb 3QSIA 3CVKA 3KDOA 4JV0A 2MKJA 2C0OA 3ISND 1OS5A 2LX9A 3X25B 1H72C 4IDKB 4M7AB 5HVGA 1PCXA 4BC9A 4EUVA 5ETRA 3M9MB 3A8OB 1YJNT 2KT5A 2RNEA 4A4FA 1SCJB 3AD9C 1WC6A 2VG7A 2EGAA 5I3PA 2U1AA 2YWEA 4I6YA 4B3MF 2RS2A 3POTB 5GAN6 4DR5F 2Y1RI 4MJKA 1QAJA 4IR1A 3PW0A 2MGZB 4QU6A 1PJ7A 2MJNA 2JTEA 3QDFA 1U47A 1KVKA 2J05A 1PWTA 1KD1R 3K5PA 4X4PA 1OQ3A 5E3RA 5KYYB 2EQMA 4JI7F 3HP9A 3T9ZA 1CJVB 2VODA 1M27C 5SZTA 4E98A 3FDRA 5IM0A 1VQ9Q 5CH7B 2A2DA 2KRBA 2UUCJ 4KY3A 2B7CB 3S6EA 4BI3A 1REGX 2DO0A 2E7WA 1KSPA 5ITHA 1LKZA 1VQMS 2GIQA 2YKAA 3CIZA 1YJVA 5CZXA 3WIUA 1S9GA 1SQGA 1K8AU 2OEKA 4KKOA 4I69A 4LF9J 1NJIR 1QDUB 2N82B 2QLJB 1S48A 1KS2A 4OI3A 5GVQA 1MV3A 4CYUB 2PN6A 4R0KA 4P75A 4QIEA 2O2OA 2YNHA 2DYAA 4R8UA 2R7WA 5DG7A 5LJ3d 3ENVA 3I32A 1AFJA 3W65A 3HPWA 3DRRB 3JCMf 1Y7XA 3K5LA 2RDJA 3C2PA 3QT8A 2M8HA 4OYAA 5DLFA 1TKXA 4PWDA 2BOAA 3NGTA 5E0OA 3TARA 1N5ZA 2CH4A 2DH7A 4J9CA 4PQUB 3ER0A 4DX8H 5E3PA 1JLQB 1SIZA 2B51A 2HQ3A 1M8MA 1TUVA 3DOKB 4I6WA 1DTQB 3PW5A 4BDYA 3J7Z5 4A47A 5LJ5g 4OI2A 4B3TJ 3M5AA 2R7UA 3H5SA 3NBPB 3PX4A 2QN6B 4LF1A 4CLWA 4DR2F 4BBYA 1Y3JA 1SJ1A 4ZCMA 4JI5J 3QYGB 3HK2A 3RR8A 2NYSA 4F4ZA 2GNKA 1D9AA 3I55A 5D0RA 2QT7A 3T1HF 3SBMA 2IDEA 1HBMB 1PO6A 4WWSA 1QE1B 3NGRA 1NCLA 2DPIA 2HQEA 1RHKB 1FWPA 1TUDA 4ZVSB 5CAAA 1YI2Q 3CPWA 2RJFA 4C8OA 1SJ3P 1CG2A 4N5SA 1T3NA 4FPIA 1MLAA 3M8QA 3SEMA 4ESRA 1MHNA 1RLCL 1XN9A 2JWNA 2HBZB 1CJUB 2BE2B 5K14B 2VFTA 2VOOA 4OX9J 2DBMA 4F7UE 2MHEA 5F3ZA 4NCGB 1I3OB 5GAGI 3RKYA 3VGTA 4OIXA 3DGVA 5ETPA 1FERA 1DAXA 5FLXU 1UFKA 2BJDA 2OKQA 4HT7A 3NCRA 2QO3A 4N8NA 4KHMA 4AG1C 1UEBA 2KG1A 3MUVP 3C46A 1GT8A 4FPRA 5CXTA 2KM8C 4UY8T 2G13A 1JU5C 4PPDA 5T7LB 3UATA 4UZCA 4Z2XA 3I0RB 1RDRA 1YJWQ 1C1BA 3OV7A 1M5KC 3V5RA 1X4GA 4CH0S 1MSWD 1SUQA 2PIIA 4M77F 1EZZB 3M7VA 3M4YA 2RD5C 4DU8A 1LCKA 4F14A 3H5YA 4A8KA 3Q89A 2MJUA 1FWZA 4KT0E 2GGPA 3RUXA 4C7QA 4OX7A 2DK2A 3Q24A 4ECZA 3A3OB 2X3XD 2DTJA 2GQVA 4FYXB 4D3HA 1SHGA 1UGSB 2QTXA 1ZOTA 3W63A 5IT9Y 1Q81R 2OAUA 3EAEA 4BACA 3PTWA 1C1AA 1YIJT 2DGOA 1PNJA 2OEMA 2ZJPQ 2MK5A 2AZVA 1XIQA 3IG1B 4NYZA 4WXWA 1F9EB 2EWHA 4NL5A 4NA1A 2VFRA 2LQJA 1NAQA 4DR1J 1PC4A 1FTCA 4IUUA 3H90A 3H59A 1R3NA 4ELZC 1WX6A 4ZLNA 3JAMU 2OEJA 4ID5B 4ZVEA 2XY5A 1BQMB 3TNVA 1X01A 3CC4T 1VQ8Q 1S72T 4NASA 3VZHA 2R2TA 3KLIA 1EP4A 4FL6A 1CQNA 3MEDA 1FRHA 1WPYA 3L2RA 4PCQA 4RTUA 2V94A 2XDBA 4H4KC 4ETZA 4LQ3A 5MAOA 3BGRB 2QMXA 4B9VA 4QWCA 3Q1JA 3EGXB 1OO0B 3UW1A 1OX8A 3H4DA 3KG4A 1B64A 1NKCA 5CQYA 1Y7PA 3QRRA 4ZP9A 3CMAA 2E5JA 3INZA 2L3RA 4A8QA 2D3O1 4NA2A 5KFQA 4NLTA 2E5HA 5GAMg 4FP9A 4GC6A 3W3SA 1X4EA 3FBEA 3QYHB 4MK8A 1FDNA 4NE9C 2V8KA 4WP8A 1UTIA 2AV5A 4NL3A 2FJXA 4EMKC 1HNXJ 1TL7A 2C2OB 2RA2A 1X5SA 1M5OC 4LF6F 3GIBA 1VIEA 3AOCA 1QW1A 2XI9A 2DEJA 1TL3B 3DLKA 2ZUGA 3JB9F 3QRQA 1EARA 1REVA 5L46A 2GVZA 3OVSA 2K3XA 4OMFG 2E10A 3I56A 1VQMQ 2NUTB 2DR5A 2DJWA 4LBHA 3HVTB 4HEA9 2HL5C 2DXFA 2VL1A 2GA7A 1YHQS 5J2PA 3PV8A 4F2SA 3TQ1A 3L7PA 1HKAA 5IT0A 1KLNA 2NXUA 1S1TB 3QO3A 3CDEA 2MZJA 2HRYA 3VV0A 1S57A 2OO4A 2QEXQ 2NPIA 1WTFA 1Y71A 3MECB 1WOPA 5C25A 4N0AA 2VC8A 2RF2B 2H5JB 1D8ZA 4A48A 1KQGB 4LMZA 3HHKA 1UZDA 1K1SA 1ZAVA 3LWMA 2B6AB 4BLGA 2OPSA 3PEHA 1YP5A 1YWXA 1XNIA 2RNAA 4AE5A 2XD0A 4GKJF 2A0FB 2XI2A 2R8GA 1NH7A 2QK0A 2W9CB 3EPGA 5J1EA 3M8YA 5GAMh 2G2OA 4BHQA 4LSLB 1HQEB 3J80E 3IWNC 4H4OA 1EQ0A 1E6VA 2RMLA 2PEBA 2Q1LA 3MEGB 1SI9A 3RRKA 4FT4A 4KPCA 2YQ3A 3KLHA 4Y2KA 3KG1A 6FDRA 1D3BA 3D2WA 3I55T 1IKWB 2QQSA 3PO5A 3H7HB 1ZPWX 2MZSA 4CTAB 2HD0A 4OYWA 2V1RA 3DLJA 4JJBA 2ZM6J 3HVAA 1IREB 3D1QA 4O44A 1Q82R 2K3YA 5GAOr 2ZH8A 3UR0A 3HULA 2NUHA 3D7SB 5KFLA 2NS1B 2RB6A 3FEYB 4ZHRA 3FMWA 4WFNQ 4UZBA 2N4DA 4ZJLA 4LVNP 2LXIA 2A28A 3BW1A 1R6VA 4HA8A 4RW6A 3V6HA 2UXCJ 2DFUA 1H2TZ 1NM7A 1UVMA 3IM8A 1RBAA 3KYLA 3C16B 2ZC3A 1SL0A 3I5RA 1QCOA 4LR7A 5HKCA 2HMIA 3LP1A 1K9MR 1AXQA 4LIRA 1HSQA 2EPDA 3GG1A 2D7SA 3FVYA 4MIWA 3U1LA 5C24A 1JLCA 1A7GE 3V6KA 2LQWA 3GFZA 1RQ0A 1ZSZC 4PJOE 5FLXE 3HKSA 1KHVA 3D4JA 5LSRA 4YB7A 1FDDA 4K5SA 5DM7R 4J9PA 1WORA 3DOMA 3WVDB 3F56A 3M55A 2O01C 1NU4A 4ZJOA 3MM5A 2ZGWA 2E5KA 3BZQA 1TFWA 3ELHA 1B34B 2I1RA 3HSJA 2XMVA 4ED2A 4I2PA 3AY0A 2DHHA 2CDRB 3BR8A 3W2VA 1SJFA 1KK7A 2ZOGA 3M1VA 3KJVB 4ZP6A 2FQQB 4B9UA 3BO2A 2IVMA 4EGLA 1FEHA 3GCXP 1KQSP 4J9FA 4J9MA 1WJ9A 3DLEA 2RE1A 2Q6BA 3MM9B 5LJ3j 1F3VA 2MQQA 4MDWA 1GTEA 2CUDA 2D8JA 1X27A 2FHMA 4WXOA 3CCSS 3KNGA 2LDMA 2HWTA 2A10A 2J0XA 1LWFB 4RWWA 5KFKA 1Y07A 2DIUA 4GBQA 4AXIA 1UW4A 1M3AA 3GLJA 3T5LA 4A8OA 4R56A 3FK4A 5ETVA 1LJOA 4ZGEB 2VBWA 3Q8QB 1GCPA 4R25A 3RAQA 4DCPB 1RWPB 4OMFB 2VC1A 1N52B 3BDUA 4C8QG 4AL5A 5DQIA 1FMKA 1U0HA 1QCFA 4PXEA 2ZDPA 2IG0A 1B0TA 4RMOA 3PFOA 5KFRA 1SKRA 4KGXB 4OJ3A 3KUHA 2B4PA 5L1IA 3BH6B 1AZSA 9RUBA 3PVQA 3NTHA 1IJEB 2FHJA 4H4KA 4LFBJ 1H73A 3WVEB 4X64F 1WKKA 3FSYA 1XC9A 1LW2A 3DLBA 4M5MA 1GL5A 2PT0A 1CPZA 1UJ4A 4JS5A 1T9YA 2ZPIB 1VQNS 4KV8B 1R0CB 4WFAQ 1Q53A 1PC0A 2RJZA 2GHVC 3M0SA 2BZ2A 2CP6A 3CWJA 1FFSB 3OSNA 1H6KX 2VBYA 1F9FA 5LL6S 3I56T 4GVLA 4CM0A 2AEJA 3R5BA 4USJC 2HLUA 4OV1A 3KKFA 3UVJB 4K2JA 2IRYA 1RAGB 4ZNXA 4DXLA 4WU3A 4C92F 5KAKA 1RAIB 1WOOA 1YHQQ 3R1LA 1IHWA 2EWNA 1Q8IA 3RJMB 3CCJS 3BY7A 4RTVA 1H641 1RTJB 3JTOA 2DE0X 3IMQJ 1VQ7T 3IA0A 1GNKA 4DUTA 3LP2B 3UA6A 3FBFA 3TUPA 2DNYA 3KK3B 3AA9A 4QW9A 4B3OA 3C0CA 2LEBA 1WIEA 2C2KB 2H51B 1QY7A 2XLIA 3D9BA 1N5VA 3NXZA 3H9NA 4HI2A 4ECRA 2DVIA 1VQLA 4LF7F 2QA4T 2J6KA 2KRMA 3RZAA 3V4IA 2LKZA 4DX6A 1UJ5A 3THKA 5A6WA 3JYTA 2HAFA 3EZUA 1G2EA 4C8ZA 4LRAA 4F3QA 3ET6A 2MZQA 1LXNA 1TKTB 3Q83A 3FJ5A 4LSNA 5THWA 5FJ4A 1RUSA 2BDPA 2D6FA 2CJBA 1H3HA 3FC9A 4DL6A 3U1NA 3OJUA 1MROA 5HJYA 3RUBL 1PYOB 5J26A 1V1CA 1S0MA 2ZNZA 3G86A 4DDFA 7AT1B 2DR9A 1SV5A 2GO9A 1TUCA 3NKYA 2C2RA 3ENQA 2M52A 3QJ6A 5D4OA 4D3GA 1U06A 4JPBW 4MFBA 4OYOA 3T3FA 1ZETA 1PM3A 2C0IA 3LYIA 4F8RA 1TKDA 4ZDNA 1Q7YC 3N4WA 4MMKA 2DHGA 4OI1A 2DPPB 3M6XA 2HS0A 3CCWA 3RR6A 4C2MA 1EJ7L 2I5JB 2MDAA 4C11A 2OTLT 1Q7LB 3W8GA 1CJVA 1TZ0A 3CDUA 2HQXA 2QLBB 2YWKA 4URSA 3NGKA 2K2PA 3D66A 4K0KJ 3T41A 1NNDA 1FJCA 2KAFA 3B8HA 5IFMA 3E2EA 4A8FA 1PKUA 4FSXA 1WHKA 4WYLA 5CYMB 1H8KA 1P9YA 1KHCA 1HI8A 4J7FA 1GTHA 4CWBA 2QL7B 5CKEA 1T3LA 2RUGA 3QAEA 1QSSA 5A8RA 2XY7A 2L2PA 2XQCA 3E01A 3BS9A 1JLFB 3MAAB 3VAIA 3H20A 4ALZA 3OBIA 3GFXA 1WSRA 4RCCA 2ZKTA 4CI0C 4LREA 4QIVA 3N6LA 2DEQA 3SD4A 4IFVB 1UPMB 2WSFE 2I0XA 4JI2J 1QVFR 1QLYA 3JCMg 5C5JA 2CZVC 3HD1A 4QR2A 2U2FA 3LH0A 4QWEA 4U7CA 3DRRA 2VVKA 3CCUA 4M94A 1NDPA 3DI6B 1JLGB 1OYEA 4O6JA 4FCYA 4F17A 1NKBA 2K6DA 4QWDA 1ZSZA 3V8KA 2BJ3A 3BSCA 2RKIB 1IHVA 2JJ9A 1FD8A 3M9NB 1JLQA 1JKHB 3MFIA 1DTQA 5C42B 2CJQA 3LF0A 2W1BA 2XG8D 1M90C 4DPXA 1W2BR 4C0ZA 2BKDN 1YITA 3B6BA 5IXUA 2CH4W 4KRTA 3CC2A 2I2LA 3MWBA 4C8QB 4NLUA 1NDKA 1RWNB 2ZPBB 5JVHQ 3ENWA 2DTIA 1JJ2A 4HT8A 5E3QA 1FK9A 3DLLQ 3A1PA 4QBUA 1VDHA 1UFLA 4L75A 3D67A 4X84A 5HMYA 1PCAA 1XQIA 4F0KA 3G6ET 3ZBDA 3WXMB 1VQYA 4JI1J 3CCSQ 1AWWA 1RI0A 3OD2A 3OTDA 1SJ4P 4OHZA 3LH5A 1ZBTA 5D15A 3CBOA 5C6SA 2UXDF 2DRKA 3JCMh 2GVDB 1NXIA 1MWZA 3IAM9 1G3TA 1U49A 1YX2A 4F3OA 2HFSA 1HWIA 5I42A 4M5HA 1FXRA 2L89A 5K14A 5KT6A 1O0PA 3R2CJ 2JL9A 2W2MP 4NCGA 4C8NA 4HR2A 4Y2AA 2HQCA 2Y9HA 3H5XA 5KFXA 1N5QA 1EIFA 5KFUA 3P45B 3OYMA 3FRNA 2BUNA 3KLFA 4WCIA 1HNWF 2CVIA 4NI2A 2MSSA 2OTLS 1R6YA 2O88A 2YKQA 5J2NB 2EJFA 2NWMA 2V4JB 1ZH5A 3FSXA 1WG4A 3BBCA 3CCZA 1RWKB 1JLBB 2VDIA 4USTA 3UR3C 5GMKa 5LJ3e 3I0RA 1H92A 3VV2B 3BE3A 2UP1A 2AKWB 1IZ6A 3L3CA 3R6NA 5CKHA 2FDNA 4DFJA 2FVSA 3OB9A 4ES3A 1VQNQ 2V69A 1U2FA 2CWXA 5E2QA 2VPZB 3QZ7A 3QQCD 4M95A 1FWKA 3TA2A 3TUZC 2PI5A 3E1SA 4CLPA 4C0GA 4F7UG 2H3JA 4B9SA 2I8EA 5KFSA 1WI7A 2G4BA 4M77C 4ZIWA 3BGOP 3MGJA 3MMAB 2RHIA 1RAHB 1KD1U 3CCVA 1B99A 4P71A 3BO3A 2DEIA 3WBZA 4J9NA 2VU5A 4J91A 2KYZA 2DL5A 4Q2LA 5M2PA 3GSDA 1SRLA 4HCZA 3PKYA 3HHLC 2FY8A 3C4SA 4JV2A 1VQLT 3HTRA 4O3OA 4NLDA 3PCOB 1NEEA 3OSSC 1RU2A 4WZQA 4QJVA 2CP2A 1UVJA 4UOCA 1JEGA 1NJIU 4N4HA 8ATCB 1S7IA 5HLFB 4M5JA 2W2NP 3SXLA 3HVWA 1D9DA 1FRJA 2VG5A 3S3OA 2DBBA 3DMJB 4M5IA 1X9MA 5L9XA 3HCXA 2DHXA 3HX9A 1T8EA 2DJZA 1N6AA 2XGPA 1FX7A 5KFVA 3BGRA 2DX1A 2YUNA 1KONA 3CJQA 3ZTOA 2NYIA 2OMLA 4OZ1A 3GILA 3IRXA 4B17A 2OPPB 1N8RC 1DQAA 1XOVA 2B86A 2A1BA 3GMGA 3GIJA 2X4YA 4NEYA 2L3MA 3LD7A 3PW7A 1QWFA 3DM2A 4RBUA 1S6QA 4JZ4A 5AJ3F 4DL2A 2XWXA 2WONA 1NO8A 2E3IA 4EFAC 3ONQA 4Q43A 4F4WA 2HGLA 3AFGA 3J7AN 5IXFA 3QGGA 4NZ7A 5D0EA 2MQ8A 2YQ0A 4O5VA 4KO0A 1DLOA 3UE2A 1U8WA 2RMOA 2QASA 3A8IA 2RM4A 5LJ3f 2HLTA 5T41A 4IRKA 2OH2A 1FRKA 3D6HB 3D3CJ 2NUTA 3KHHA 3NNHA 1T0TV 4A4JA 1YKWA 2QL9B 1TQLA 1XMOJ 2PUKB 2R7QA 2RRAA 3UD4P 3AJ2A 1FXDA 2OHDA 2B4VA 3LA0A 3KXTA 5C2CA 4TY8B 4JRQA 1KHIA 2F8MA 1S1TA 4OYBA 4RTWA 3VWSA 3DOLA 3MR7A 4OYXA 3HFOA 2ZDOA 4D8DA 1HHTP 1XR6A 4PFZA 4JYAF 4M75F 4K4WA 4Z7YA 2WBMA 3CCUT 4IUFA 1Y0HA 5CA5A 2AKLA 1IKVB 2AJFE 3OFHA 2IYIA 4J6YA 3ME9A 1K1QA 2ROTA 1NH8A 2BJ7A 4DSFA 2KO1A 4DUZJ 3LPYA 4B08A 1T9UA 2NYHA 2DLPA 4LRFA 1RGVA 3PHEA 4YB5A 4CO3A 2HGNA 2W9CA 5L1LA 4NLVA 3OQ5A 1G1XA 3MEKA 1YITT 4LSLA 3FFIB 3AODA 4PG6A 5BR8J 5F41A 2VUGA 3KJNB 4K7QA 2XMJA 4WFBQ 2F4FA 1VQ7Q 2ZHBA 3T6BA 1N54B 2CNOB 1UE9A 4WK3A 3BN4A 2WZ1A 2F2VA 5CKBA 2RIJA 1MU2B 1J5EJ 2LJ3A 3H8YA 3CCRA 2JM9A 5IN1A 2R7OA 2HVDA 3UA7A 2E4HA 5KFHA 2CG4A 4A4HA 2PSZA 2CKKA 4PR6A 4JI3J 2QA4Q 1E7OA 8AT1B 3CCQS 3KNAA 4XTUA 5B0EA 3CJ5A 1I1JA 3LH2S