1NPPA

Crystal structure of aquifex aeolicus nusg in p2(1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 53
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nppA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nppA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nppA01
1YIJA 2OTLT 3CCLT 1QVFA 1M1GA 1NJIU 4ESNA 1EIFA 3A5ZB 3QQCD 3EWGA 1W2BS 2E70A 3CXCA 1S72A 3CCMA 3LPEA 3CCUT 1VQPA 2LQ8A 4ZN3A 1Q81C 2MWOA 1W2BA 2XHCA 2LVMA 3OYYA 1YJWA 1K9MC 1VQMT 2CKKA 1VQOT 3G6EA 1NPRA 1Q82C 3LD7A 1X6OA 2JNGA 5J3BA 1XNIA 5IT9E 1K73U 1K8AU 3J81E 1Q7YC 3CCLA 3CD6T 1Q7YU 1VQ4A 2KPPA 3PIPA 1KC8C 1N8RC 3CC2T 3J7AF 3G4ST 3CPFA 3G4SA 1Q82U 1M90C 3CD6A 2EXUA 1YITA 1VQKA 1VQNA 4QQDA 1BKBA 4RG2A 3CCRT 1YHQA 1QVGS 4TVRA 3I56T 1VQOA 1VQ4T 2E6ZA 1VQLA 1JJ2S 1IZ6A 3CCUA 1VQPT 1NZ8A 3CC4T 1KD1C 3J80E 4X34A 2QEXT 3CCQA 1KHIA 4ZN1A 1RL2A 1YJWT 2QEXA 2OTLA 5HY6A 3CMAA 3CMAT 3CCVA 1QVGA 3I56A 1XTDA 3I55A 4YTLA 3CCQT 1UEBA 3CCRA 2MWPA 3CC4A 1YITT 3DB4A 5DM7R 5FLXE 1Q86C 1VQ9A 1VQLT 3CCST 3CC2A 2KVQG 1YI2A 1VQ5A 5J26A 1YHQT 2KDSA 1YBYA 1K9MU 1VQ7T 1VQKT 1Q86U 1VQNT 2OTJA 4OBIA 3CMEA 1K73C 1K8AC 1M90U 2OUGA 2IG0A 1KQSA 1N8RU 1KC8U 2JVVA 1YJ9T 2JUFA 3CC7A 3P8BB 3CXCS 1NJIC 1NPPA 3TREA 1YJNT 1KQSS 1VQ8T 1M1HA 3ER0A 3G71A 3G71T 1S72T 3CPWS 3OW2A 1JJ2A 3PIOA 1VQ6T 1VQ6A 3G6ET 4CRIA 3CMET 5A2QE 1VQMA 1YJNA 1Q81U 3JAME 5LL6S 1VQ8A 2JOYA 1YIJT 3CPWA 3LGLA 3OW2S 5DLQE 3DLLA 1YJ9A 1M1KU 1VQ5T 3CC7T 2EIFA 2L3RA 2QA4T 1KD1U 3CCSA 2K06A 3CCMT 3CCEA 2MI6A 1SSFA 1VQ7A 2OTJT 3LH0A 2LCLA 3I55T 1YI2T 3CCJT 2DO3A 1M1KC 3HKSA 1QVFS 3LGFA 3CCET 2G3RA 3DB3A 5IAYA 1NZ9A 3H7HB 2QA4A 3KBGA 1VQ9T 3CCJA 3CCVT
chains in the Genus database with same CATH superfamily
1GXIE 4ZVEA 2RT3A 2G0CA 4Y65A 4RKUE 2XHCA 2BOPA 2QEXQ 2WRMA 2C2ZB 3MOJB 2XBPA 3HD1A 2MDAA 3QIIA 3HDSA 2RE1A 4I2QB 1K73U 2BKOA 4OV6A 3ASKA 4NL5A 3T5HA 4EZ6A 3DLGB 3MPDA 4BE2A 2O1PA 1U3OA 4ZIVA 2YUNA 4J9PA 3UNYA 5L9NA 1YGYA 1HI0P 4AL6A 2DPIA 2KL8A 3PEJA 1XMOJ 2XS2A 1WQWA 3UD5A 3BEGB 2DD4A 1HQUB 2HIQA 4DV6J 3FRZA 3ILJA 1WX6A 4QYRA 3ADAC 2AYGA 2Y1RI 4BI8B 3KG4A 4Q2LA 4A53A 3I5BA 3S3NA 2OTJA 5LJ3Y 2UU9J 3P8DA 1TFWA 2OPQA 1RXOB 1G5VA 2JC0A 3I5AA 1TUVA 4LFCF 4C8MA 2ZVSA 3PIOA 1DTQA 5GAN8 4ZP6A 4NEYA 1Q7LB 4ED4A 2G6FX 4O3QA 1IR2A 4B9TA 4F4ZA 3IAS9 3ITHB 2L89A 2GV1A 3M57A 2Z4PA 3CCRS 4QR1A 3VS0A 3W7BA 4F4YA 5DQGA 4G3IA 2XHWA 3I96A 5L8RE 2IMWP 3N5FA 4PYDA 2F9JA 2AJ0A 5KYYA 3TEHB 4GKJF 1OQ3A 2BJ9A 1FDBA 4M5NA 1B4SA 3LWMA 1WHVA 1IB8A 1SJRA 2I8EA 2W9BB 4FCYA 4P2FA 2JEIA 2P4TA 2XLJA 4M95A 2QJ3A 1YHQA 1QVGS 3MI7X 1P1LA 2HWHA 2F2WA 2E29A 4K5RA 3CMEQ 3V81B 1PBAA 2OPPA 3JYTA 1X9MA 1IQTA 2X51A 4M5DB 3PYFA 2D0NA 1LK5A 4ZITA 1KC8R 4B17A 2ZH7A 2RQMA 1OY9A 3GFYA 2D69A 4LNPA 2OPQB 2B3TB 5IXFA 2FLPA 1B99A 2RJCA 4YUDA 4ED2A 5D3GA 3PM9A 4WFYA 4CO1A 1OX9A 4LN2A 4B9WA 4M5HA 3MUMP 3QNWB 5CZXA 2FQQB 4OI0A 2CPHA 3RBXA 1N8RT 3CEYA 1VQ6A 3VAJA 3SCIE 2Q1LA 3QYGB 1Q81U 2M70A 3TUPA 4U67Q 4QVZA 3JCMX 1F5BA 2U2FA 1SH2A 3K5LA 2E41A 3R5BA 1PO6A 1GRIA 4DV3F 5I2MA 1WIEA 4QIFA 2QFJA 4JI8J 2HAFA 4L6V3 3CCJA 1G2BA 1JJCB 1NKBA 5T14A 3N4WA 2DFUA 2R5MA 1Y0HA 3M05A 1Q81C 3K2YA 2DIUA 1MW7A 4F36A 3KJVA 2M8DB 5H9FJ 1UVLA 3M0QA 1X75C 2DBKA 1IO6A 1VK8A 4UOGA 1UFLA 2F65A 3ZTRA 1D0EA 3DU6A 1SJFA 1YJWS 1PJ5A 1VHIA 1YJTA 1Q8BA 1KQSR 1G4CA 3CMQA 2W9AA 3EGDB 3D5MA 5D78A 5LMUF 2HQHA 2L9WA 4C7QA 1U8WA 1PD1A 2E65A 3EPIA 2VV5A 1F0XA 4NYPA 3HD2A 3G71Q 4OMMA 4BBYA 1N6QB 1ZUUA 4NOHA 4ZGDB 2RMOA 1HARA 3MECA 3TZWA 3OFHA 2IY5B 1Q0NA 5C6SA 1TKXB 2Z58B 2HD0A 1TL1B 2MKJA 3G71T 1ZAXA 1W2IA 2HHUA 2HURA 1QTNB 4DJBA 2EIFA 3ZZRA 1WYXA 4LR9A 2V4QA 1FHTA 3CCLS 5GANg 2R4FA 4B9NA 4FYXB 2UUAF 5C24B 1ZBTA 4LFCJ 3MR5A 2DNZA 2UUTA 3IGVA 1SBRA 1D1BA 3FBFA 3W65A 2DL7A 1SPBP 1XNRF 1D9AA 2MKSA 1FJ7A 5LMNJ 2BANB 5CKDA 2R7XA 2HFZA 2DNUA 3ZZUA 1PJ6A 1VHFA 1M90C 4J5OA 4NL2A 1PYOB 2H51B 3GIKA 8RUCA 1VQOA 2ABYA 2VC0A 4NLXA 2Z2YB 2ZBIA 2YKMA 3G7ZA 2RQWA 1C2PA 2DZCA 2RIJA 1MHNA 4PWDB 3NGDA 4M77D 2COZA 2YUOA 3KK3A 2K7AA 4ZP9A 3M8QB 4WCEQ 2FJVA 1RI0A 3W8GA 3RTVA 2OD4A 1H74A 1OIAA 3MMBA 4QWEA 2J6FA 1OSDA 1BWEA 2DNNA 4JRQA 2J0XA 3N79A 2VHGA 2LDIA 1NBEB 4QIEA 4D6WA 4PJOF 1S1WB 4FS1A 4CLLA 2JXBA 2GIFA 1CSJA 2QMXA 2RUSA 2E5JA 2FRWA 2I5JB 5CK9A 5AJ3F 4KAIA 1FXDA 3KUGA 5DG7A 1CVJA 2VKRA 1S79A 2YKQA 5A0YB 1FVSA 3GB0A 1VIOA 3IWNC 2RI5A 3FKBA 1WDXA 4OI4A 1SUQA 3M1VA 1YWXA 3GILA 4HA8A 2FHJA 3OW2R 2AGPA 3HVWA 2HNYA 3BSCA 3MPVA 2R8JA 2JEJA 2LVMA 2EGAA 3V7RA 3CCSQ 2JOQA 4YR2A 2HBRB 5AXLA 4P2XA 2PI4A 4KPYA 1AWJA 4X4PA 2LQ5A 1JLFA 2A7YA 5EX3A 4YR3A 2GAGC 4KO0A 1KFSA 2MHNA 1KQKA 3UFCX 2RN8A 4QKUA 4A8QA 4RTYA 1FX2A 2UP1A 2VONA 3G82A 1BI0A 4RBTA 3M8QA 3U7JA 2I6WA 1HD0A 1SH0A 2FPHX 5FRMA 5ADZA 4P9SA 1QAYA 2G2OA 2DNOA 5KFUA 2YKNB 2RRBA 5ETSA 1RWWB 3VVUA 1T3OA 2HHHJ 2XMMA 2QA4S 2OPRA 3RB3A 4HVWA 3HT0A 1TUGB 2JJ4D 4X4OA 4WIQA 2HVZA 1IBMJ 1RU1A 1UFWA 2FGOA 3V6HA 2KDSA 4OZ2A 4OMNA 3D6FB 3D6HB 2YXLA 4AMCA 4OI6A 1G3WA 2OTJQ 1CKAA 1LOJA 1VUBA 1VBXA 1KLNA 5E3RA 5GANe 4QIGA 3CCLA 3C19A 1J27A 1VQ5T 5HANA 3HF5A 2CSQA 3GFZA 2NQPA 3S6WA 5HROA 4PJOA 3HHLC 3PW5A 3KDNA 2G4BA 3SQGA 4FNHA 1CS4A 3GONA 4JV5F 4KUIA 3MM5B 1S72A 4LRCA 3B4DA 3DOKB 2NUHA 3UR3C 1TH7A 4DV3J 1FRJA 1CLFA 4YDXA 5KFTA 3R5GA 2JNGA 3OTOJ 3NMRA 3REAB 4KO0B 4H4KA 2ESWA 2E44A 2FRYA 1BWVA 3G4ST 2DH7A 4KULA 2UXDF 4DEXA 2QT7A 3FFIA 3KFWX 1VQOS 1BMQB 4ZOSA 4FSXA 4DL3A 2QV6A 2HLUA 1W26A 4KY3A 1JKHB 2O66A 3PO4A 4J9VA 4M78B 5B08A 4PRFA 3EG9A 1PAUB 2GHWA 3AD8C 2W9CA 3CCUS 2A08A 2LKZA 5KTQA 1CC7A 1OS5A 3LP0B 1UW4A 1B64A 1YITT 2E7WA 4C0OC 3OQ5A 1WHLA 1VR6A 2XMVA 2XI9A 3KLVA 2XNQA 5JUMA 2DGQA 4URGA 2RS2A 4OV1A 1NLKL 4RW4B 4ESRA 5IOLA 2BUNA 4S0MA 4M78E 2VG6B 3TREA 2FVCA 3VAMA 1VQMA 1VQ4Q 4B6MA 2XU8A 1DZ5A 1KQ1A 3D9BA 2DR9A 2D41A 1N6AA 1OZ3A 3T5LA 1YFNA 2ZNYA 2CPJA 1YI2T 2DO3A 4U7CA 2POKA 1LNXA 1EARA 1F60B 2QLBB 5I2SA 4BDYA 2J05A 4D3GA 1QVFA 2ZBPA 3H5SA 2ZBQA 1W6XA 4BD3A 2FUG9 2UU9F 4KHPJ 1RABB 1RI9A 2IRUA 2X9HA 2HW3A 1S1VB 2D3UA 1TS9A 3BH7B 5KT6A 3ETOA 2YHTA 1IKYA 2HWIA 1FE0A 4MIBA 2DH8A 3K57A 2XMWA 3MHXA 1SV5B 1KSWA 2CJBA 4EYHB 1X4BA 2OEJA 1YCSB 1C1CA 4IRCA 3NGKA 4TQRA 4ILRA 4VUBA 3E9FA 2KFNA 2KEAA 1M5PC 2DNGA 3KUEA 4WYWA 2NYSA 2FO0A 4J9UE 3BDPA 4BB7A 2LCWA 4RNNA 5AYFA 1QY7A 3M32A 4KR0B 2V5HG 3FK4A 1RTHB 3CT9A 5B0BA 1N5ZA 2IPOB 4I2PA 3LYIA 2IRXA 4O3NA 4DL2A 4OHYA 2K1RB 3V6JA 1MROB 4WF9Q 3HM9A 5IN1A 1SG5A 2FYKA 3QGIA 4DZDA 2Q79A 2XDBA 3HSZA 2QG9B 4ZCMA 2O2OA 4ETXA 3LW5E 1NJWA 4M4ZA 2AV5A 1RBLA 1QM9A 1UKUA 4DR2F 3KXTA 1SQGA 3G2XA 3DXSX 2E7XA 1IJFB 4F7VA 2UV8G 4RNMA 4AFSC 2MKYA 5M2PA 5J39A 3EFOA 3EG0A 1IKYB 1AFJA 2L48A 1T3NA 1WHXA 1C6VX 4AYBD 3M30A 1Q8LA 2XB2D 5ECAA 5KE3A 3MMAA 1U7LA 3PIOQ 2LTOA 1WQ7A 5AXNA 1XR5A 2CZ6B 4EMKA 2XGPA 4F4AA 4WK3A 1QQJA 1RT3B 2KT2A 4DXLA 4FL6A 3OHAA 3LWLA 2YWFA 5F8IA 2E6ZA 3OXFA 1S6QB 1UJ4A 4B3TJ 3JB9D 4URSA 2C2KB 1FEHA 2YBVA 4E7ZA 4OZLA 1AW0A 3JRZA 3OVAA 1JLQB 5KFCA 1VBZA 4X4TA 5CYMA 2DHXA 4BC9A 3ETMA 2QN6B 3MCOA 1YCYA 1M3AA 2XS7A 4RW9A 1MN9A 1R6YA 3NWRA 1R0CB 4HH1A 1SIWB 1U09A 1YJ7A 3HMJG 2OPSA 3QT8A 2N4CA 2BJEA 3QSUA 4M5MA 4CM2A 1S9EB 1HW9A 1MG7A 3H90A 1RU2A 4ZVHA 4O44B 4O3RA 1O8BA 9ATCB 1VC6A 4RU9A 3IWXA 3MM8B 5LL6S 2CVEA 3CCRQ 2LCSA 4N7TA 5A8WA 4UY8T 3BYPA 1V76A 1JXVA 1X9WA 4D8DA 4C92D 3GP9A 1TAQA 4B3SJ 1W25A 2HKEA 2YKOA 1UJYA 2YNFA 2PI5A 1QVFS 3CCET 5IV3A 3SI8A 4YDDB 4JLGA 2FY1A 2X4XA 3TWZA 2DCUB 1OU9A 2R57A 3N01A 1FEEA 2C2EA 3GOXA 2QLWA 4G1PA 1K9MC 1VQOT 1Y07A 4UW2A 4J9HA 4Q43A 3H41A 4FSSA 4ZCIA 4ZHRA 4B3RF 3EGUA 3PIPA 4FDFA 2ZGWA 3LAMA 4YN3B 4LSLB 3QFWA 1EAYC 4IDKB 3NRBA 4LQ3A 5HO4A 3LA0A 3QRRA 4NRUA 2YNHA 2EK1A 2J7IA 4RW9B 2VF3A 4ID5A 4IUVA 1RQ0A 2YWWA 4OI2A 4RW8A 3MPYA 3RR6A 4XU2A 2VASA 4HL9A 2MWPA 5LSRA 4FF3A 1UPPA 1D0ZA 3DRXA 1OWXA 5AXMA 4ED6A 2QLJB 1X31C 2P9EA 4JP8A 4ZPVR 5CIUA 2CZVC 1TG0A 2RRAA 3DDNA 5ETRA 3JCMJ 1H3ZA 1S49A 2ZKTA 1H3HA 4C8YA 3LLRA 4HHHA 4RNFA 2ZH6A 1NH7A 5LJ3h 3OB9A 2ASLA 2V34A 1U0HA 3SXLA 2BA9A 4FXWA 4B3TF 3DGVA 2VGNA 5K20B 4R5PA 4J7IA 3IBWA 2QQRA 4CLUA 4HACB 4BCAA 4NMXA 3LQVA 4F7UB 2EYYA 5FJ4A 4ZVFA 1RTJB 5F8NA 2RVJA 4I1TA 5ETOA 1JQGA 1KOHA 2Q3PA 4DOVA 5AT1B 3DRYA 4DR4F 2Z2ZA 2CNNB 1ZM4A 3EE3A 3DLLQ 3J81E 1RHMB 4HI2A 2GMHA 2DL4A 4C0GA 5KFBA 3C8YA 2BUDA 1N5TA 2WSCC 2O4XB 4UOFA 1U1SA 4E7SA 5ETVA 1Q5YA 2QSFA 1R6VA 2BEFA 3U23A 2XWYA 4F4KA 1L3TA 1N8RR 3ULRB 2FHOB 5HQLA 4CO5A 4Y91A 1WI6A 2VQFF 4ECZA 3E8OA 4IH5A 4ZJQA 2EWHA 3HP9A 4XTVA 1VQ5A 3IRWP 1RYSA 4ZVPB 1T03A 2DKOB 2EGEA 4BLGA 2XC9A 1KQSA 1M0SA 2LRQA 1NK9A 3HK2A 4M5DA 1I51B 1S72T 3AXMA 4CYUB 1M9SA 4A47A 3HJVA 4LDUA 3C15B 2L3RA 3ZTQA 2M1HA 5CZVA 1TK5A 1GX6A 4OVAA 1ZAWA 4X66F 1S6OA 1GTHA 2KG0A 2GHPA 2D74B 1QAXA 3NWGA 2YWKA 3M6XA 1S4EA 1YJ9S 1WXBA 2BRKA 1MV0B 1HNVB 3FZ2A 3QIDA 3LPEA 4UT4A 3VQSA 5H9EJ 3W63A 1VRTB 3PTWA 3EGWB 4EGLA 2A2CA 1GMWA 1TWBA 4ID8A 2N7YA 4FXDA 5BYSA 2V8GA 2KU7A 2HFSA 2KQWA 4MFBA 5F9NA 1N27A 3RAXA 3M8YA 1YITA 3OTCA 2HEQA 2JMCA 1NJZA 1HBUA 4DBFA 1NSKL 4Y92A 2DL5A 1VQLA 3MEDA 4X62J 3IR7B 2E6NA 2M5YA 4X34A 1HHSA 3K59A 3A8IA 3MTJA 2MYSA 3GP8A 3MHYA 4PJLA 1EX8A 3QT5A 3SB2A 3NY0A 3JQMA 3NOGA 4XTTA 3D67A 4JI1J 1TAUA 1FKPA 1KIKA 1H641 2D1CA 5MLCV 2EFIA 4JS4A 3RZAA 4USHA 1HQUA 3OSNA 3EJMA 1NB2A 4CYUA 3GIBA 3SIPB 4ZTFA 3VCDA 5FU7B 2QTWA 3P6YC 4PFZA 4K50A 2I1RA 1RT1A 3FCHA 2X35A 4EDUA 4RJVA 4Q5WA 4PG7A 3MR3A 3ZFJA 2HHVA 2BIVA 1WNLA 1TL7A 3QWYA 2ADBA 4M77B 2HBYB 1YG0A 1NEBA 3EAEA 3A5ZB 4DL0C 1Z2LA 3LW5C 2HFOA 3DNCA 5HQMA 1X2QA 2Q43A 1ZPWX 4RPFA 1WA7A 3DOMA 1NH8A 4LUDA 1RDRA 1T9VA 4Q0BA 4FN5A 4PFOA 3Q8SB 4U95A 3B6BA 4V19X 3BO3A 3T5KA 1S1TB 3KJQB 2ZUGA 1HBNA 4MKYA 4OI3A 3MR6A 4EPCA 5GAOp 5LJ3d 1HQEA 3BREA 5KFAA 3DRPA 2V26A 1FMVA 4XPEA 4RWXA 3HFOA 4ZCLA 3TUZC 2OJ2A 4DHVA 1URRA 2E3HA 2YX7A 4LFBF 2COWA 2R7QA 2L3PA 1VQ9A 2FHJD 3M58A 2XMAA 3GYGA 3OL7A 4DV4J 4E2FB 2ZC4A 1RI7A 4RU2A 3M6UA 2ZH1A 2JHEA 4F26A 4PCQA 1HWUA 4A8SA 5J2NB 2CQ1A 2JVVA 3EXCX 2MKKA 2B4PA 2DGSA 4CO2A 4RR5A 3W66A 3ENAA 4DR2J 2EAYA 2QO3A 4LXCA 4M7AF 2CDQA 2KFZA 1TTHB 1CJUA 1Q1KA 2QA1A 1GTEA 2D0QB 5KYXB 3UDEA 3UWTA 1HYSA 4Q8FA 2V8PA 2DXDA 1XJWB 1VQMQ 5KG7A 3ZBDA 1HI8A 2EYWA 1AA1B 2OSQA 5D6WA 4WFNQ 1NDLA 4IFYB 4OIXA 4DR5F 2ROGA 2MWOA 3TX8A 1HA1A 2W25A 3SV3A 3A12A 4E7HA 2LQJA 3DDIA 3P96A 1XNIA 4CDIA 4HVUA 3E19A 1RB0A 2IM3A 4LDXA 5T41A 5KCOA 2EQMA 1G8XA 3KJVB 1AWOA 2L9DA 1NEEA 1S99A 4N8NA 2K2VA 2FHMA 3OVBA 1TL3A 1RLCL 4TYAA 1RYRA 4OHVA 4HT7A 3I56A 3VS6A 1TL5A 2OGUA 1S1XB 2N3OA 2WOMA 1CJVA 2C3PA 4QU7A 3CCWA 4K2XA 3BB5A 2VG5A 2IG0A 3PJWA 1X6BA 3ENVA 5ETLA 2CQDA 2P9CA 4PUOB 2CJYB 3PW0A 1YTYA 3MECB 1SL1A 2ZH4A 3TJAA 3H2VE 1FXRA 3NCRA 3QLHB 1TKXA 3R1LA 3O8WA 2N7CA 2RB7A 2VKNA 4OYOA 2V1QA 2HZCA 2BJ7A 3PYEA 3H4DA 2YQ1A 1FERA 1MU2B 4CC2A 4NLQA 1FX7A 4WU3A 1OPLA 4C5EA 2YH1A 3AODA 2M0OA 4DL7A 3JCMW 1AHJB 4GKJJ 1HR0J 5J3BA 1K8AU 1K1ZA 3W2VA 1YWPA 5CCAA 4HHUA 5GAMg 2LXFA 1I5OB 5KG4A 2V4JA 3CJRA 1BQNB 3C6TB 3HPOA 4DX7A 3BW1A 1OSCA 2RF2A 1QVFR 2O3DA 5KG3A 4RO0A 4XDCA 5F3ZA 2CQHA 2E9ZA 2QEXA 2E1PA 4QPXA 2R7SA 3CMAT 4OZ0A 2HAIA 5C25B 3TA1A 4JV1A 1RAJA 3CCRA 3FGVA 4HTJA 3MUTP 4OMOA 4G65A 1J5EF 1MNDA 1QKXA 5KYUA 4ILLA 1HXDA 4OMFB 3CWJA 2FG0A 4ZKAA 1VQYA 3QLHA 4LD9K 5KFMA 1TOVA 1VS3A 5GAOq 5B7WA 2RI2A 3MF5A 1Q4RA 4M75D 2JM9A 3S1TA 4HTIA 1X4CA 1MU2A 4ELTA 3FEOA 2Y1JA 3DFEA 1TV6A 4ZPTR 1CJTA 1R43A 3K7RA 4LF5F 2PT0A 4DI6A 5B0CA 2IVFB 5K14B 3M0RA 3X26B 2M0YA 1RJJA 2XMKA 5FDLA 1OULA 2LU1A 1S5ZA 1JBMA 3OSVA 2LQBA 2WSFE 5E33A 2B4VA 3TQ7P 3SCKE 1RLPC 3AB4B 2A37A 1WTBA 4LBIA 3AQPA 1QP2A 2DAQA 2GA7A 3RMSA 1VQ4T 1D3BA 1W4SA 3D3CJ 5KFHA 1QCFA 1LV5A 4O3SA 2BE9B 2NLUA 3CD0A 2MEWA 2D9OA 2X3GA 5KOWA 2HS3A 2JEFA 4J9BA 4E8UA 2C2MB 1BI1A 2YKNA 3CDAA 4NZ0A 3OYMA 1YZ6A 2K3BA 4KGXB 2K7KA 5B0DA 2VPWB 1S6PB 1VQKQ 3PYGA 2DHGA 3GU0A 5J2PA 2RILA 3MD1A 4NLYA 4LF6J 1YJNA 1DQ8A 3GG0A 4JDSA 1U1RA 4E98A 4M7DG 1NK8A 1ZSZC 3MEEB 1JO8A 2EG2A 5D6YA 2HGNA 2NCKL 4KRTA 1VJWA 2P4RA 2OAWA 1TL4A 2EFNA 3DXBA 1M1GA 2VFUA 3QQCD 5GAN5 3ISNC 3MDFA 1WHYA 3UD4P 3M0UA 5F8MA 5KFXA 1U1KA 5AJ3J 1SIZA 2VYTA 3A8LB 4DV7J 1IBCB 5HL7Q 1S0NA 1WKLA 2DX1A 1U4BA 4M7AB 3JB9H 4LF7J 3TCJA 3IR6B 3M2UB 2KGTA 4ZVTB 4PKCC 1D0YA 3RIRA 4Y28E 2CXEA 3W5YA 4ES3A 4FPIA 4OP0A 1RT5B 2YKAA 3V2UC 2DR8A 2V69A 2E9RX 1JKHA 1V6HA 1V1CA 1OYEA 2XY6A 2YVSA 2W9CB 2BMBA 2FJAB 1BC6A 5CCMA 3GLJA 1W2BP 4M7DF 1NUEA 1N32F 2Z8QA 4I4BA 4ED1A 1RA6A 5B0GA 3QO3A 5GMKl 3PTAA 4I56A 3CCZA 2GJIA 2IM2A 3WDOA 1WGSA 3GPAA 2MQMA 2B5JA 3OW2S 1U06A 3HCXA 5HVGA 3KNGA 3CBMA 3DI6B 3JCMP 1SC4B 2MI6A 1YK9A 3CMAQ 2DO4A 3CCJT 3ZEHA 3EHRA 2RHYA 3BGUA 2ZDOA 2QTXA 4OYZA 3PX4A 2IIHA 3K17A 5A8KB 4ALZA 4LMZA 2UZAA 2ZOFA 2VOOA 3UN5A 2V1RA 3KK2B 1VFJA 1X5TA 5GMEA 1P1TA 1M8VA 2WONA 4NLRA 5F3TA 3M2UA 4AL7A 1Z4UA 3EGNA 2M2BA 2GHVC 5A8WB 2LU2A 3J81U 4ZIWA 2IBKA 4LSNB 2J7UA 1S1VA 3HHLD 2AZVA 5HP1A 1K47A 2LX9A 1UGQB 1NYFA 1KHVA 2GQCA 4PEOA 4WXWA 2R8HA 2QYCA 2ECZA 2ZZNA 2OJ3A 5FW9A 3M2VA 4RUCA 4JRPA 1RKIA 5LM7E 2ED1A 4PQUB 8ATCB 3E1SA 3VQTA 2FEIA 2PE8A 5DM6Q 3HVTB 1IHVA 4P71A 2QLXA 3EZ5A 1WC4A 4WKRA 1FKOB 3QRQA 1YHQT 3CCUQ 4W92B 1K1SA 2V8DA 5IHNA 1UA0A 2JUFA 3E2UA 4GVBB 3LWHA 3AY0A 3OR2B 3BGRB 4J83A 1X4GA 1M3CA 1MMNA 1WOOA 1NHUA 1OJ4A 5CAIA 5FD1A 2F8HA 2QC3A 1WHHA 3KLGB 4C48A 2KROA 1BIAA 2CYZB 2DPJA 2V8JA 3UDCA 5A8KA 1QAIA 1NEGA 2NXEA 3D1OA 3EUNA 2RJFA 2CG4A 3RBBB 2VVKA 4GY5A 4DX6A 4TY9A 2R2RA 4P2SA 2WONB 4CO4A 1C1BB 1M30A 3I35A 3CVKA 4CH1A 3KUHA 2K2MA 3DN9A 2M51A 5KFOA 3KMQA 4DUTA 3GNGA 1SL2A 3NGPA 2JLFA 2MMYA 1FKAF 2HKNA 2OMLA 1HL6A 2B6AA 4TLRA 3TX0A 3GIRA 4UZBA 4JBCA 3MO8A 4C8QG 4OX7A 1Y96B 1P6TA 1AZEA 3DM2A 2KRNA 1VQNA 3M2VB 4I68A 1UB4A 1Y0MA 2D3ZA 2XYPB 1N34J 5M9OA 4JJNK 2HNIA 1RTJA 1L3UA 1FO1A 4DR6J 4KHPF 2CA9A 1RWOB 3HVTA 2ACYA 2LDMA 1B3TA 3GPLA 1XR7A 2A3JA 1S9GA 2DYIA 3KHLA 2NSCA 1V9OA 3DB4A 3T3FA 2FY8A 4OGEA 1FMWA 1JLQA 4QU6A 3JXOA 1R7IA 4USUA 1N8RU 1JXOA 3O44A 2BJDA 2JWNA 1N33F 1UZHA 3ZO7A 5GAOn 1B07A 4ANJA 2K8GA 5KFRA 2M8HA 3T5JA 3URGA 2OI3A 3W2WB 2HKQB 1UW9A 2IJRA 5D15A 2HS4A 4BACA 4N77A 2DTIA 4WE1B 3CJKB 3QUIA 2KXNB 4JV5J 2BRLA 3BN7A 4FIBA 1QSYA 1K0XA 1R27B 1VQ9S 3KLFB 3LD7A 2LX7A 2AYMA 1TSFA 3D68A 4OL8A 4KPCA 1YITS 4QVDA 4DL4A 1WC3A 3UNGC 2F5GA 2OEKA 4RG2A 4RX6A 2A6OA 4Q8EA 5HJYA 3LX7A 4NEZA 3FEZA 2RNAA 3FEXB 1ZTTA 3X25B 1PKUA 4JI2J 5G0RB 4QPTA 3FCVA 4CQ1A 3RYLA 2XSFA 3M4XA 1KK7A 5CHCB 4LF9F 1VBKA 4N41A 4DQIA 1V29B 2MQPA 4C8QA 3H25A 4OYBA 2CIMA 1BQXA 1RLDA 3SSRA 4B9LA 5K9FA 4ZK7M 2X4JA 2DK3A 4OFZA 1Q82T 3AA9A 3JTPA 4DV5J 3W61A 2NUPA 1RT4B 1QE1A 1WORA 1X43A 3NGSA 4FT2A 3G71A 3TA2A 3NBPA 2UVUA 2XIDA 3CPWA 4QQBA 2UVVA 2AJ4A 2XICA 4FZVA 4OI1A 1YJRA 1TR0A 5H1SV 1U0HB 1T95A 2DXTA 4P6QA 3TSZA 2GJ2A 1T0JA 4M77F 1CSKA 3WQPA 2VOPA 3QXEB 3T1YJ 3QT7A 5DQIA 3EPGA 4PR6A 1R8PA 4DX8H 2GVDA 4HVVA 1FCAA 3PRBA 2FVQA 1N56A 4U7UK 5L38A 3C16B 1HKAA 4JJBA 2PIIA 1QSLA 2R7RA 3MMBB 4DFKA 2YXYA 1BY9A 3CD6Q 1DFDA 3MXHP 5KFIA 1IXKA 4FF4A 3GMGA 4X4SA 3Q1JA 2EYZA 1C0TB 4ZLNA 4IH7A 2O4XA 1Q86T 1K4US 4G1QA 1I0CA 5IQQA 3NCQA 4DPWA 5J1EB 4OHZA 1N5YA 3FSIA 4PL6A 2L3MA 2V67A 1YSJA 1SJ1A 3O5TB 2HQ3A 4AFUC 1N32J 2AEFA 1W70A 4WYLA 3SSQA 1YX2A 3H0FA 4A8MP 3MTKA 3UCZP 2BW2A 3QIPA 3JSCA 4FW1A 2W4CA 2YT6A 3S3OA 4MKAA 4J6YA 3J81j 1X60A 2EW9A 2VBWA 5M2UA 4DR7J 3OYBA 2V9WA 3ICLA 3R7NB 1T9WA 3R27A 1OI1A 1JLFB 1LWCB 3JQKA 4PWWA 2RMLA 2G3RA 1VQNS 2FJEB 3KBGA 2J0QD 1OQ6A 2K79A 3H4BA 1U6ZA 1A6LA 3NNCA 5I42B 2MGZA 1URNA 4D8KA 2MAMA 5DETA 2VG7A 1Z9QA 3FSYA 3JSMA 2Y90A 3I9QA 2B9WA 3JB9I 3TYTA 3H6ZA 2DF6A 2CZ0B 4P10A 4IFVA 3HTRA 3R5DA 4DCPB 3BGFA 3MM9A 2KTQA 2KMTA 4USTA 1IVZA 2ASDA 2RKIB 4OMQA 5ETQA 4KSEB 2QFIA 4XIUA 1HBUB 1OOTA 4GLKA 3I56S 2MLXA 1EETB 3B54A 3EXYA 2JJ9A 2LP4A 4DQPA 2KYZA 2VDIA 2E5LF 4C11A 4ATNA 4LSZB 2XZWA 4A8FA 4CLFA 3C12A 2A6MA 4U8YA 4AFQC 3WVEB 2DXEA 2Z30B 4JI3F 3MM6A 3TQEA 2CPFA 4MH8A 3MM5A 1VQNQ 1GFDA 2CUDA 2FB0A 2JZ5A 3KOAA 1YJNQ 4YB1P 5KE2A 1PYSB 3UPFA 2MZQA 2VBXA 1X4DA 3VAFA 4C5GA 1LVKA 4LIRA 3CCVQ 3BFMA 4DV1J 3CCEQ 2GCFA 2BKDN 1KG1A 3IGNA 1NJXA 3PW2A 2VG5B 2VBZA 1EIFA 3EG9B 3QJYA 3L1AA 2BE2B 4J9NA 4PUOA 1SRLA 1GXTA 2LQ8A 4QVCA 2EVZA 4IFVB 2QL7B 1G3SA 3V8LA 1NKEA 4G1IA 1QVGP 3HZGA 4ICLA 3D6TB 2QQAA 4KYZA 2F8EX 3J7AF 4JOUA 3MCAB 1FD2A 5LSLA 1GT8A 2EK6A 3JAMY 1ZYQA 1KSPA 3RRHA 4B3SF 4K4VA 3A1PA 4M7AE 3VAHA 4J9MA 3CCQA 5LMUJ 2AGOA 3W64A 1ABOA 2D3O1 2GVZA 3VALA 3CJTA 3BR9A 4IG3A 4A0UA 4FS2A 1Y3KA 3DGPB 2K5IA 1FMKA 2RO0A 2KNBB 5L8RC 4ELYC 4AG2C 2KHDA 3N6LA 1WF1A 3NLCA 4X64F 4ES2A 3M8RA 2ZZMA 1UZDA 5HKCA 1S6UA 4UY85 5GAN4 5D0GA 2FPEA 3SFGA 2KH9A 2EFVA 5CVIA 1EP4B 1W1FA 1L5UA 1WJRA 4BI3A 3KLHB 2OO4A 4B02A 2C28A 1NJYA 1RAAB 4P72A 1U1NA 1C4AA 2BOAA 1RE1B 3THKA 4F4WA 2MZJA 2F5TX 3TVYA 2HVIA 3VYGA 1DHMA 1FK9A 4IUTA 1PBUA 2P6TA 1S12A 2LJ3A 3FBEA 3KJNB 4NRTA 3P4UB 2IC3A 4NLVA 2EJGA 3OUYA 4DDFA 4ELUA 4A48A 3R9LA 1I8FA 1HNWF 1REVA 2WCXA 4P2MA 2H3EB 2IAJB 3LP1B 2XEXA 3RW6A 4HVZA 4A4JA 3EGXB 3OTEA 1VQ9Q 2C3OA 3RKWA 5A6PA 1IBKF 4RNHA 3CCRT 4BY6B 4DQQA 4ANCA 5A8RB 3OMGA 3N0VA 3I0SA 1BQMA 2HQEA 4JB8B 4PAAA 1TUCA 2V2ZA 1MROA 1WDDA 1Q8KA 4XTXA 4HCZA 2JLGA 2EKYA 4LBHA 2FVPA 1MNEA 2X7IA 1QDUB 2RJDA 2WSEC 4DCJB 2W1BA 4TU8A 3JCMV 3MEGA 3TUIC 2XI3A 4JI1F 1CC8A 2KSSA 2KXFA 3TAQA 3VF0B 5E7OB 2PTKA 2YKMB 1YJ9T 3EZUA 4L72B 4M7AD 5C42B 3D4JA 2G2ZA 1M2VB 1GX5A 5ITHA 1QD1A 1W7WA 2RH3A 3PNIA 3JAMU 2XTJP 4OZ5A 4AD6A 4CI0C 2J6UA 1FD8A 3BM7A 3I4PA 1HWKA 2VPZB 2R7OA 4EMKB 1XEZA 3HKSA 3H5YA 2ZH5A 2AIRB 2ROPA 2J7WA 1VQ8Q 4M5GA 4J37A 2PZ1A 2RDIA 1SKRA 4ZPAA 4IQXA 2VWFA 3CD6S 3AB2B 1A7GE 3RB4A 1VA7A 3S6EA 3EGXA 2VFRA 3OYEA 5L9XA 2CJKA 3OBWA 3X3UA 5CYMB 4F04B 2NSBA 2KZMA 3AHUA 2DJWA 3ILOA 4KGKA 5DS7A 1VQMS 1VQPQ 2D7SA 2UVWA 2CJAA 2X1GA 2CPIA 4GC7A 1KD1C 3UDVA 2CPXA 3C6TA 4O44A 4Y2CA 1B34A 3WX4A 2QRRA 4Z7YA 1M5OC 4B3OA 3MEGB 4KQZA 3QBCA 4P5NA 1ELOA 3I55A 5LXYA 4LRBA 3POTB 3H0PA 5FLXU 2B8AA 4K4ZA 1IBLJ 3V5RA 3BH6B 4JUVA 3CXCP 1M1KT 1JNRB 1KD1T 1AWWA 2HSPA 4DV5F 1JNZB 4USMA 4AL5A 2O67A 2DGVA 2CZ7B 3JV3A 3OW2A 2FTRA 4CRIA 3HHLB 4JYAJ 4C97A 2LQNA 2DIVA 2C2NA 3PYDA 4QCLA 4NX9A 4LF2A 5KFWA 1IN0A 2PGCA 2VDHA 2KB2A 2MHEA 1IKWB 5BXIA 3IFEA 1IBMF 4K8RA 1UVMA 1TUWA 1LW2B 4OYPA 4JI6J 2XGQA 4XO0A 1Y7XA 3A3PB 1IKXA 2RPNA 3M56A 2DR6A 1NJIU 3MR2A 1VQPS 2CNOB 5IXBA 1YLXA 2EI5A 1X69A 3SHWA 3KKFA 3UATA 1EIYB 3J7YI 4DSLA 3IS9B 3LO3A 4WXOA 3GR0A 3HRUA 3JB9k 1Q7YC 3IRXA 4R25A 2MZTA 3M2RB 1PKSA 1RAOA 4LJMA 3UDLA 3JQJA 4A8YA 5IS2A 2XS5A 3JCMc 3GZ7A 1HSQA 3US5A 4ECUA 3OMCA 2XG8D 5I11A 5C7PA 4CM0A 5L1LA 2JTMA 1MGQA 2E1HA 1UECA 2L41A 4A8KA 1KVIA 3KFVA 3KK2A 3POTA 3MMCA 4CNYA 5I22A 1RWXB 2IBOA 3ZTSA 1X7VA 5AE1A 3OFGA 1W2BR 1YRXA 1D9FA 1WNEA 2U1AA 2EFOA 2J9DE 5DJBA 2MF2A 3D66A 1TQLA 3KLEB 5ETNA 1PD0A 3NNHA 1Q16B 2XKOC 2HK3A 2KRBA 2VFVA 1IRXA 1JJ2A 1IKWA 3HVRA 4NLGA 3QGGA 1QCOA 4I67A 5GJVB 4DS4A 1TXQA 1C4CA 1CKBA 4C8QC 1P9YA 5GAMj 1WZOA 1GBRA 3V4MA 1YDLA 2M9UA 3FB9A 2P5VA 3HHKA 3V6KA 1RTIB 3A8OB 1SCJB 1NM2A 3EICA 4PQAA 1FFSB 1Z1ZA 4DSKA 4TVAB 4C92A 3V6DA 2XO6A 4HLBA 3MMCB 3EG1A 4RCCA 4WP8A 1YWOA 3OYIA 2PSZA 5DDPC 2EGCA 3L95X 2I0NA 4X84A 3RESA 1D0XA 2QQ9A 1YRUA 3VZHA 4PNOA 3NGRA 3IQLA 5LJ3f 2K3IA 4R0EA 5GAGU 4OX6A 3TAMB 2HCKA 4FPRA 5D0RA 4BC7A 3DM2B 3PR5B 2MB0B 1SV5A 1RGVA 4TXSA 1OPIA 2AT1B 4ZGJB 2PC6A 4DPXA 1KC8U 1MSWD 5LJ5e 2YDLA 2ZD1A 1JLCB 2HNZB 3HHNB 4UOHA 4DQSA 3IG1B 2BZ8A 1T11A 2K06A 2FZKB 4L5GA 3SEMA 3FZBA 1N5VA 3A8MB 1RHRB 1QUVA 4XAXB 4NCBA 3FFIB 3OXLA 5E3PA 3DB3A 3H7HB 1VQKS 2CWXA 3BV8A 3CBPA 3NFCA 4EMHA 3G87A 3IMQJ 3UCGA 1PM3A 2GGPA 5HK3A 4V19J 2K1RA 5GAMf 4C8QD 2CKKA 1SB6A 3D28A 4YEAA 2DE0X 4WZQA 1FVQA 4KIAA 3QSIA 2DNQA 4MMLA 4Z02A 3FEYB 1X4EA 1Y10A 1WEZA 4O3PA 2RM4A 4YHHJ 3UO0A 1OU8A 3M7VA 2DTJA 4L74A 1UJ6A 2EQUA 3DLBA 2N82B 5DZ6A 2Y3YA 2M4MA 3N9UC 1WC5A 4BI4A 3ZFVA 2NYIA 1I6JA 3CF5Q 1I5LA 2KN4A 5A2QU 1X8DA 3C2PA 4EEYA 1RT2A 1HR0F 2VA3A 1RT3A 2QA2A 2ZD1B 3MP6A 2HNZA 1RWMB 5IFMA 1MWYA 1S7IA 4K4XA 4M7DA 4AQYJ 1Q86R 5G0RA 4ECTA 3CPWS 2FZGB 3DOMB 3QGPA 4KBMB 4ZP7A 2WSEE 4DV4F 3BGRA 3CCMT 4M75C 3CCEA 1DTTA 4ZMMA 2HMIA 4CC7A 1D1AA 4KUDK 2JC1A 1LOUA 2AX1A 5AXKA 2H54B 2BJ3A 3UA7A 2IVMA 1VQ9T 2UUCF 3KLIA 4DV0F 1XMOF 1R8CA 1E6YB 3CCMA 4DPUA 2LXIA 2H8HA 1AZSA 1YP5A 2YQ0A 3HSJA 4OX8A 4RKUC 3E3XA 3H2UB 2LQKA 1RHKB 2JM8A 1X01A 2VBYA 3HO1A 3U1NA 1N36F 3CC7Q 5HVHA 5FWCA 1SF9A 2Y1IA 4WP9A 5IC4B 3DRSA 4YR0A 1HBOA 3CW2C 2F40A 4YMEA 2KT8A 7AT1B 5KAKA 2CPYA 5HMWA 1JQQA 2J76E 1MN7A 1Q82R 2FC9A 3EX7B 2AZ1A 5J2QB 2V63A 5KYXA 4IG0A 1ZM3A 3M53A 3FSXA 5HQ8A 1M5KC 4C9DA 4ZLPA 4F4XA 5KH6A 4M5LA 4ZPDA 4N8OA 1YJNT 2ZJQQ 1LJOA 4BHQA 3HXMA 2CPDA 3GJQB 4ID5B 5KYNA 1JWWA 2FPFA 4OX9J 1WHGA 2QK0A 3FVYA 3CCSA 2KZZA 5CQYA 2R8GA 4F3QA 1JJ2P 1SVDA 1FRMA 4IYQA 2KAFA 2X3XD 2J8AA 5IT9U 5DLOA 2CKWA 2GAHC 5B0FA 4A8XA 2BJ1A 3RBEA 1KONA 3JCMd 5CKEA 4OJGA 3AJ2A 3OYKA 4IO9Q 4TYBA 3QFHA 1K73T 8AT1B 4BE1A 3ZXWA 1Q7YT 4RNOA 5K5MA 1X6GA 4JI0F 2F8MA 2JX2A 2P6SA 4DR1J 4HCKA 2WOMB 3CSKA 1LCKA 4R5PB 2XDPA 3EGZA 1UE9A 2JFDA 1HBOB 4C8KA 2VPYB 4AT1B 4LDWA 1VMBA 2Z2LA 1RACB 1RWKB 1N5QA 4ZVGA 4PXBA 3OYJA 3TP2A 2H5EA 2W7AA 1VQ6S 4PWUA 5CQXA 2AMCB 3CC4S 1PRMC 2ZOMA 4NCGB 2IYGA 2VUBA 4EO8A 3RB6A 4H4OB 1FYNA 2GIRA 3MM9B 3CMEA 2KRMA 1D8YA 2PFFB 2LQWA 1T94A 1IQZA 4HEA9 3W9IA 3WVDB 2SXLA 2DIQA 1OPKA 4F0KA 2NS1B 1QE1B 1KHCA 3W8PA 3VU3C 2WSCE 3J7ZT 4K4TA 1Y4ZB 5GAN2 3QG1A 2EG1A 1UHFA 3ZTPA 1J2VA 2EYXA 3OW2P 2O9SA 2R7WA 1YBAA 2G1HA 3G6ES 2CH4W 2QGGA 2K2PA 2YWHA 3RBZA 5E3AA 1NDKA 4N76A 3PVXA 4U96A 2E1MC 2P0PA 4XDDA 4CLYA 4M77E 1IKVA 1YITQ 3D0GE 2BABA 2RHUA 4RW8B 2MTLA 2WACA 4EBDA 2J6OA 3CNQP 3C15A 3G86A 1APSA 2W10A 5CKBA 2ZPBB 3BKUA 2V2KA 3GFXA 2IDLA 5EG2A 1LXNA 3N6NA 3MEAA 5EN1A 2ATLA 3WIUA 1VI7A 3CIZA 4F2RA 2HHTA 2F69A 1HQ2A 2ZFHA 1UTIA 1NZ8A 2MSTA 3GSIA 1HPZB 1HI1A 3OD2A 5LOQA 2BYCA 1U8SA 4ME7A 4FYYB 3CMAA 3E01B 2CSIA 4RW7B 1WF2A 4LRDA 4F0HA 4YHHF 3MAAA 2JW4A 1YIJQ 5C0MA 4Q7AA 3VYHB 1Q86C 4B9VA 1U24A 3D2WA 4DOZA 1FNMA 5D6XA 4LDVA 5J1EA 1IJEB 3W60A 4EWTA 3VS2A 3FBCA 3JB9F 1P9QC 4L76A 2WVBA 3A3NB 4ETZA 1IGQA 1HWIA 4OQJA 4FM4B 4OHXA 5HMXA 2Z0WA 2RQCA 2V9KA 3N28A 1RLQC 3SCLE 5DGBA 1SI9A 2D8HA 4Y2IA 3QZ9B 1WUUA 4P7VA 3FJ2A 3HSBA 4DLEA 3KDOA 2BQ3A 2FJWA 2DRMA 4NXNF 3VJPA 1V5IB 4C0ZA 1T9TA 3I55S 3HSGA 2HK2A 1N9RA 1LWFA 4E7KA 2QYGA 2PO4A 1HHTP 2LECA 2UUAJ 3ZZTA 1N4LA 2O31A 2MGZB 4ZPBA 1FTRA 3N5BB 2WAQD 1Q81T 3G1JA 2OMOA 4DV2F 3IXQA 5LJ5d 1UHCA 2QL5B 2EBGA 2FHDA 3E01A 3EMTA 3OXGA 3EHQA 2ZH8A 4FW2A 4MKBA 3J7YU 4ZPCA 2OFHX 4ZS6A 5DG9A 1PG5B 2A18A 1FX4A 2NXUA 4HYKA 3DLEB 2KT3A 4GO5X 4P75A 2DZ9A 1PCXA 2IAJA 2M52A 1CG2A 3OHBA 3V7SA 1DBDA 3ET6B 3HHDA 1GMUA 2MXYA 3KHGA 2LA4A 4DL5A 3QPIA 2FLLA 4WPAA 2LEBA 1UEVA 5GAN7 5GANh 2IRYA 3I82A 3M9MB 1DTQB 4UUWA 1KRPA 2FJBB 2EJ9A 3DOLA 4ZLJA 1HNVA 3AFGA 3A4TA 3CCLQ 3S3MA 2ZJRQ 4QQGA 2DCLA 3EH2A 4M5KA 1S0OA 3QJ6A 2G1DA 1WSVA 1HW8A 2PMWA 4LE9A 4Z88A 2DXUA 2L8DA 4CH7A 2VZ9A 4FVCA 1GEHA 3ZZZA 4QIVA 2Y0BB 2XYGB 3HP6A 4ZA1A 2DKGA 1GK8A 5J2NA 1XNRJ 1VQSA 1K73R 4O0IA 5DY9A 2AQ4A 1HNXF 3ZNUA 2DISA 4FP9A 4UUXA 3CEDA 2MZRA 4KGVB 4OB0B 3M8ZA 2LFVA 5CCLA 3FC9A 1SHGA 5L1JA 4ZLLA 5J2MB 4A8WA 2VFSA 2FYXA 2WK4A 3QMQA 1F3FA 4ELVA 1HFEL 2OIHA 1Q78A 3FJ5A 2MK5A 4MJKA 3MKDA 2QAZA 2IIMA 2DRKA 5JXSA 1R0AA 2HBWA 3PXGa 1FWPA 5D4OA 1RT1B 1XOVA 3R97A 5KFQA 4M63A 4NXNJ 1H2VZ 5BYRA 2NLWA 1U25A 1SL0A 2C06A 4RTWA 4I2PB 4CRJA 3DOLB 4X1VA 4ED0A 3PX0A 4GLMA 2V8VA 1K8AC 4ED5A 1NE8A 3R8YA 2FLOA 1VQ5S 1WC1A 1U2FA 3D0IE 4R55A 4K4UA 4ELZC 3G6ET 4U8VA 3RUBL 1YJ9A 2MZ1A 1EP4A 2DBMA 4QWAA 3TVTA 1X5SA 1F6TA 4Q45A 4MDWA 1QLYA 2LLZA 2KXDA 2LT1A 3IM9A 3Q8UA 2Z57B 4JI7J 2UUCJ 5IM0B 2VJVA 1U48A 2XLIA 1OYXA 2MMPA 3OBIA 4M8LA 3OTDA 4C3LA 2RHIA 2DPPB 2MLYA 2CREA 1VQMT 1Q82C 2KHCA 3CMAS 2AD9A 1K9AA 5IT4A 4ZVQB 1N48A 2ALZA 1HK9A 2BM0A 4F2SA 3QHSA 4TVRA 4NS5A 3PCOB 2ZEJA 1RT7A 2B7CB 3ONQA 3ZTOA 1UEUA 3SDEB 3OR2A 1H72C 1KQGB 4U6PA 2G0IA 1BQMB 1G3OA 3O1LA 2HFNA 3RRKA 1Y5LB 4M7DE 2OLWA 2V2QA 4LF5J 2RHZA 2OTJS 4DUZF 2HSEB 3FNNA 2MQ8A 3NNAA 3PFOA 1UPMB 4NZ6A 2XD0A 2CP0A 1M90U 4M7AC 3L7PA 2DXCA 5D6GA 5D4NA 2DNPA 2J7KA 2ADCA 3I0RB 3EH1A 3RR7A 3R5AA 3MP1A 2SEMA 4DS5A 4XAKA 2DNMA 4QR2A 3QPHA 1WXUA 3BPSP 3K0JA 1PNJA 1M5Q1 4J9GA 3UQSA 2RSQA 1O9SA 1JK9B 1S72Q 2RH2A 3UI3A 1U6FA 1QP3A 3EZOA 3NTHA 2B51A 3EM1A 1WHKA 1B7YB 1TL3B 1M4ZA 1HWJA 3NGUA 3OS0A 1NKCA 1ZM2A 3CJ5A 4EK2A 2DL3A 1IR1A 4M7DC 3L9ZA 1Y9OA 4QQ6A 1KTVA 1RT6A 4ZTJA 2HDAA 2P2CB 4J7FA 4RUHA 1G83A 2QEXT 1XIQA 2GFUA 2K3XA 4F3MA 4N0AA 1M5HA 4NYOA 2CFXA 5KFGA 4EIKA 2FPDA 5L39A 3I87A 1XERA 1BHNA 3M8PB 3MR7A 2Z0GA 2PQWA 1OMSA 4RG8A 1O5JA 3QJPA 1JU5C 4AFFA 2I38A 7FD1A 4OGCA 4HI1A 1ULRA 4HXJA 1GMVA 1UAWA 4LRFA 4A63B 2B4OA 4DSEA 1AUDA 4M5IA 1H92A 1PC4A 1T0TV 1DAXA 3C4SA 2BVZA 5IV4A 1D09B 1VC5A 2F9DA 1XQIA 5DRKA 4ECVA 1WELA 3CPWP 3SFUA 1TKDA 4BDPA 1TVRA 2HYIB 1KLMB 3Q8PB 3NAIA 3PRDA 2KFYA 4KV8B 4JI4F 3C6UA 4IOBA 2V2VA 2M7SA 1U8RA 1WKJA 2RF2B 2VH7A 3TVZA 1S6PA 1F5CA 4P74A 1DURA 1A0NB 4YY3J 1E6VA 3IG1A 3VR1A 3HI9A 5JVGQ 2E3IA 3OS5A 5FU7C 3Q86A 3MEEA 3A8HB 1RTDB 4JI7F 3A8GB 3DHWC 5KFZA 2WBMA 4QQDA 3RUXA 3M2RA 1SJ3P 2VB6A 5DDQC 2XSJA 2CT4A 1X9SA 4NLOA 3RR8A 5KT4A 3RNJA 3AA8A 4W4MA 4FYVB 1BCMA 4B3RJ 2DT9A 1BLUA 4DFJA 1NK0A 3SWNB 3CQTA 2AYEA 3TEGA 4NLPA 4PYAA 2N3LA 2M16A 2BW7A 2JZ2A 4J9FA 2ZZDA 3H98A 2VPXB 4MZMA 1YBTA 4ANEA 4CO3A 4IRKA 3HLUA 2FL7A 2BR0A 4UQGA 3CO0P 2YNIA 4Y00A 1KHWA 1HHQA 1BIBA 1K1QA 2LNVA 4IR1A 5K14A 4QBUA 3NPFA 3G4SQ 5GVQA 3C16A 1IXDA 3MEWA 4DBQA 5SUHA 1Y7PA 3H5XA 3JCMb 2B7BB 2IMOA 1NNDA 3QAEA 4R8UA 2J5AA 5EX0A 2W2QP 2EPIA 3DOKA 1VRTA 4ZJOA 4NPOA 2NZCA 1JLAB 1HIYA 4J5YA 5LXRA 1Q7YR 3L2RA 3EFRA 1V3RA 2BACA 4CO0A 5K8MA 5HBMB 2MQLA 1GNKA 5HSPA 4IIMA 2XYHB 4GKKF 2QIFA 3F56A 5GMKh 1R31A 2AX0A 1X5OA 2MZSA 2EJFA 4IKAA 2G2YA 2HG4A 2R7TA 2AZSA 3DRRB 2XSJB 4MZPA 1ZA2B 5H9FK 1RHQB 2QZ8A 3UCUP 1J5OA 5GMKi 5F41A 3DDKA 2E1AA 5J2PB 3GCWP 1SC1B 3WIVA 3KHRA 2AK5A 1U47A 2UXCJ 4F7UE 1JLGB 3OL8A 1UGSB 5CYQA 1VQLT 2ZITA 2WW8A 1UWBB 2X1BA 2BJ8A 4HHJA 1I07A 2BTTA 4J6XA 5J26A 3FDSA 4OBIA 1H0HB 3VHQA 4PLIA 5IT9Y 4RUAA 3TAMA 3SZ2A 1LKZA 3LH5A 2RF0A 4QIWD 2EVRA 1OO0B 3OVSA 4USIA 3OYFA 4CLTA 2R7VA 2XMTA 1UEKA 3VS7A 1TL7B 4OZNA 2EBPA 5K8NA 1CQNA 1AD5A 1PKTA 3OFFA 1TKZB 4CLKA 3OLBA 4IG0B 4LF4F 1M8MA 4ECYA 1RT5A 2HLTA 4BUGA 4MIWA 2PMZD 5EWEA 5LT5A 1WACA 2R3VA 2GO9A 4V2SA 3G6YA 4Y34A 4DR4J 2EW3A 1EETA 3X28B 3VKIA 3LF0A 2OHDA 3TQ1A 1VOMA 3M59A 1S1TA 4DR3F 4DV1F 4C92E 2IHR1 3CPFA 2L08A 2B8PA 4MKVA 1HMVB 2DXFA 2QEXS 1RSCA 2E5HA 3FMWA 3DLHA 5KFLA 1CEZA 3IWLA 1ZS6A 4C0FA 1X2KA 2E4HA 1WI7A 4C8QE 1DQAA 1GAOA 2BZ2A 2B5JB 1VQOQ 1FRHA 3DI6A 3F70A 3HSDA 3JSRA 1PRLC 2HGMA 3QO9B 1T9UA 3M6VA 3UE2A 1MUZA 2QX0A 2KG1A 1YJNS 4DR7F 3U27A 2H65B 1ZPVA 3BDLA 2CNKB 3CCVS 2I2YA 3ZZ0A 3INZA 2B0GA 2GQ2A 2RHSB 4WWSA 1L3SA 3CDUA 5GMDA 2QQBA 2HL3A 2X3DA 5GANd 1HYSB 1Y00A 1PGZA 3J7Z5 3TU4K 4ICLB 3BQ2A 1HNIB 3BO2A 1MLAA 2MOXA 4DN9A 3ISZA 5E2QA 2EYQA 3OL6A 3DLKA 2HRTA 3TRGA 3BN4A 5KFSA 4WF2A 2CQGA 2EFGA 1YI2S 4MK7A 2KRRA 4E0DA 1FDAA 1R3NA 1XWLA 4YFUA 1S72S 1S9FA 5HI7A 4GRSA 5C24A 3CB4A 1UVJA 4PQUA 4H4MA 3LGHA 5LJ5j 2AKWB 4L3NA 2DTOA 1DARA 3M9OB 4O4GA 2VXEA 2ZCFB 2Q66A 2F1LA 3C14A 2EFQA 3CC4Q 2GIQA 1XC9A 2HPUA 5A2QY 2R5AA 4CT9A 2EFPA 4WE1A 3CJKA 1UG1A 2A2DA 1IWAA 1FTCA 4DR6F 2ZDPA 4WZMA 3CCUA 2MY7A 4JI2F 3CC4T 3V8KA 2Y8YA 2GS8A 4I7FB 1F3VA 5HMYA 2O88A 3CDWA 1S1XA 4GBQA 6FD1A 4DA4A 5CH7B 1FT8A 4DWIA 1GBQA 4X9DA 4R56A 3H0HA 1ZLMA 4F16A 1N54B 2CVIA 1S9EA 3AD7C 1VYAA 4QOTA 2ZHBA 3MGJA 1ARKA 2BBEA 3TSWA 1T9YA 1VQLQ 2YH0A 4C0DB 1B70B 4IH6A 2OEMA 2X3WD 3DU5A 1HPZA 2DIGA 3NAHA 4IRDA 1IR0A 1F5AA 5FRNA 2J9DA 2NYHA 2B6AB 5FWBA 1LWEB 3MAAB 4U9RA 3DLKB 2AGQA 3BSAA 3DLMA 2RDDA 1UCNA 4FYWB 1BXNA 2RU9A 1TUDA 2OKQA 5KT2A 5F8JA 2ROLA 4Y0FA 1ZUKA 5T7LB 1NAQA 5CAAA 2JS0A 2GQQA 3I5SA 4IUPA 4CC3A 5GAN3 4DL6A 4O4GB 4OB3B 2KY9A 1XK8A 3K5MA 3CC7S 2HNYB 5MAOA 2EBEA 4GMKA 2K7JA 4ED7A 1WXTA 4F3OA 3K5NA 3TW0A 1RAEB 2W2PP 1YJVA 2W8KA 4GKKJ 4X9CA 3BQ1A 1ZQ1A 3SV4A 1K9MR 4ERDA 1HWLA 1WG5A 1OYDA 3HZEA 1RADB 1NM7A 1ZTWA 5LJ3j 5CQGA 2IA0A 1H8KA 2H5JB 1XTZA 3H59A 3H42A 4KT0E 1DQ9A 2LQ9A 3CCST 3NMZC 2NXJA 2VQEF 1E7OA 1VQKT 1K73C 1PSDA 3TNVA 4H4OA 4PJOE 1NXIA 3Q89A 3P8BB 1WD6A 2VICA 4UC4A 3UWNA 2GTJA 4Y6IA 3DLLA 2CP6A 3CCQS 3VS4A 4FBTA 4F7UA 4PK4A 3SSSA 5KG0A 4IKFA 3I55T 3C0CA 2CP5A 3VGVA 1UFFA 1KQ2A 2VJUA 1R8AA 4PJOB 1FA0A 3JB9G 3JS9A 1VQ7Q 1GCPA 3QIPB 3LTOA 4X2BA 2H5IB 2XULA 5AE2A 2CJ9A 5G4DA 4NI2A 4CZCA 4KT0C 3QZ8A 1ZM9A 3DKMA 4B3MJ 2HFVA 1BUXA 3GNFB 2V50A 3V4IA 4DEYA 5BYQA 5HLFB 3PW4A 5CA5A 2YTCA 3OR1B 4A4KA 5GAGI 2WBRA 1ZBXA 2IFXA 2NUPB 1JMTA 3HHEA 5HAOA 3SDZA 3OTOF 1T02A 4HCCA 4N4HA 4H54A 3W62A 3K5OA 2ZNZA 4M78A 3JSMB 3I32A 1D1UA 2DRAA 2ILZA 1AT1B 4XK8E 4K4WA 1M1KR 3A8JA 4RZRA 2DY1A 3BSOA 4C92G 5EWGA 5GMKa 3M5AA 3PMTA 1P92A 3KTQA 3LP0A 1SPKA 2J8SA 2LVWA 5GADU 4E7IA 2BXJA 1IKXB 3GYNA 1X5PA 4IUQA 4AFZC 4I6AA 3B82A 2K6DA 4USWA 1NO8A 4BS2A 4B9XA 1JLEA 3LGLA 3Q8VA 3UVJB 2QTVA 4P7TA 3IRXB 4KTQA 2OELA 2IYIA 3OA6A 3CE8A 1SSFA 1WFWA 1H38A 4N0AC 2JL9A 4ZVRB 3BGOP 2FB7A 4W98A 1NB7A 2DLPA 2FC8A 4Q2MA 2CZ9A 4M7AA 1F2GA 3IM8A 4M75G 3VS5A 4FVMA 5HMZA 4PPZA 1R89A 4KB7A 4NLUA 5D0HA 2V94A 3PO5A 2KYBA 5C2GA 3UR0A 4Q44A 3GSDA 3SCJE 1XMBA 1QJHA 1IM6A 3OR1A 3CD6A 3Q2TC 2RQKA 4W90B 2MJNA 1LEOA 4LFBJ 1MMDA 3QKJA 5IM0A 3OQ2A 3QWUA 1B0VA 4EMKC 3DC2A 1NU4A 3RG6A 2XY7A 1WSRA 4ZN1A 2Y0SD 4A54A 3FQKA 4WTOB 3KHHA 1FKPB 2MCNA 4P52A 2O01C 1B7FA 2ABLA 1E6HA 3CIMA 4YTLA 2D3OR 4LREA 4MZTA 2VA2A 3NG8A 2AF6A 3DLEA 3HFZB 4TNOA 1NDPA 1YKWA 2LP5A 1DY3A 2K5FA 1I1GA 1SKSA 4DOWA 3G6EQ 1JLEB 4OF1A 4M78F 2DB1A 2AP6A 4BE0A 1RTIA 2DVIA 5CABA 1S4FA 2E66A 3GJRB 3DGPA 2VQEJ 2LEPA 3MZIA 1H3DA 4N5SA 4LT6A 2VIHA 1FRXA 5DLFA 2YRVA 4OYWA 2F2XA 2UUBF 2H4YB 3BDUA 3MCNA 3CXCA 2P84A 4MT1A 2AHOB 4ZN3A 3A13A 3S8SA 4M75B 4OHWA 3NTIA 4RW6B 2CZ1B 4LRAA 3S01A 5EWFA 2B43A 1D8ZA 2HMAA 1VC0A 4C92F 3GCXP 1WJSA 2R2UA 3LALA 1P27B 1K44A 4NLSA 4OYAA 3M9QA 4K0KJ 2HGLA 1HBMB 4HKQA 4J90A 3GWCA 5LJ5f 2CDTA 2CQCA 3MM6B 4LF6F 2AJQA 1A9NB 2X4YA 2YQ3A 1NHVA 2C3UA 1EKRA 3D1HA 5KG2A 3OUYB 2MQNA 4Q5VA 2DD5A 2Y1LB 5KFEA 5IHIA 4ZCKA 1C1AA 3H9NA 3QYYA 2L0AA 3BR8A 5BR8J 1MWQA 4C6AA 5CD4A 3JSBA 4UTGA 1K9MU 2PEHA 1VQ4S 3CTRA 1AVZC 4CI0B 1KBRA 1KQSS 1VDHA 1FRLA 3PKMA 4PJJA 1CJUB 3IC1A 3FLGA 5M2RA 4EYIB 2MQOA 2VU5A 1EKSA 3JAME 1C0UA 2HQIA 3G8QA 4KHMA 2E5IA 2AZ3A 1T7PA 4EBEA 4KFBA 2QDLA 3PG9A 2XY5A 1S1UB 2ZZTA 1KTQA 4DR3J 1Y11A 1NZ9A 1SJQA 3OL9A 4IFYA 3QGHA 3L2ZA 3BDEA 3MPUB 4RW6A 2XDDA 1WJQA 1K8AR 3RJMB 2AYBA 2JFKA 3Q8YA 3CCUT 2XMJA 2AJFE 9RUBA 1NPRA 1D1CA 1WPYA 4BDZA 4PFPA 4X4QA 4IUFA 1KC8C 2OI2A 3VRZA 1LK7A 3KJFB 1RT2B 3H5UA 4QJVA 1LQ9A 4KRWA 4CLWA 5D77A 1TK0A 1NPKA 4QYZJ 4C3KA 1TK8A 4DV2J 1R8BA 1ITPA 2R8IA 4YB6A 4OJHA 4WBFA 4LF7F 1ZHIA 5HVFA 2B9YA 4OYMA 2RI3A 3LP2A 1CJVB 4OJ3A 2F4FA 2HAXA 3CCMQ 2IJFA 3R5CA 2OSRA 3JCMQ 1S77D 3M54A 3RGIA 1RTDA 5FU6C 4EI2A 5JVHQ 5D0EA 5IHKA 3GIIA 1KS2A 4F7UG 5IH2A 5LJ3g 1E6YA 3RDVA 1S1NA 5A76A 3O6QA 2W0ZA 4DUYJ 1S1UA 3T9NA 4Y3CA 3CULA 3VS1A 1KD1U 1CULB 4ZNXA 5I3PA 2QSWA 1GCQC 5LSOA 3MAQA 1N88A 3B4MA 5A8RA 1M27C 3VGTA 2UXDJ 2AHJB 1VRQC 4A46A 2JEGA 4JPBW 3MD3A 1DLOA 4HACA 1SXLA 2KT5A 3JB9J 2P8IA 4QW9A 3CC2T 4XTZA 4C5IA 5J2QA 4FF2A 3A98A 3MWBA 4R8UB 1U2CA 4PXEA 4F0MA 1UUEA 3TARA 4C5HA 3THPA 4Z2XA 3LP2B 3EGVA 2Y9HA 1OEBA 4G6VB 4WJBA 2GQIA 1M2VA 1QSSA 5HBMA 4LF1A 4DQRA 1UWAA 4IO1A 1QVGA 3G6XA 1YHQS 3ZNJ1 1KVKA 1AFIA 1J3TA 3OS1A 5I3UA 4QYZK 1BD6A 2G13A 2XLKA 4WFBQ 3P8HA 2HNDB 4HR2A 1OZ2A 2LT4A 1YI2A 2RU3A 1L3VA 1WI8A 1V3ZA 2MPXC 3NBPB 3OJUA 1SHFA 1HYOA 1GXUA 4YB5A 2K57A 3EVMA 3CXCS 1YNZA 2D8JA 2RA2A 3T9ZA 2M9KA 1SRMA 5KG1A 1IWGA 4DU7A 5CKHA 1WHMA 2MSSA 4WFZA 2XG8A 2KRSA 1JLGA 4JUZA 2DGWA 2DNYA 1K0TA 2ASYA 4LQ9A 5HROB 1UDLA 4FYDA 2QMUB 1LW0B 3T1HF 2DERA 3LAKA 1CS4B 2DNHA 4B3OB 4FBUA 1T8EA 5GAEU 4F50A 3IO1A 4OYXA 2W2OP 3NS6A 3PX6A 1U1MA 1I3OB 3PJXA 1E6VB 3KUFA 3TZYA 1RAFB 2F3JA 3M0TA 3NL0A 3R2CJ 4BWMA 4X4NA 1VIEA 2ZHOA 4H4KC 4RUBA 5A0LA 4G1QB 1H7XA 3MP8A 1FXLA 3HKZD 5H9EK 4HT9A 2W7PA 4B9SA 1RL2A 3PE0A 1H98A 4ED3A 1N5YB 3FRNA 2YRCA 4OMPA 4GVLA 4M75F 2QMWA 3GIJA 3OYAA 1JJ2R 3PNWC 3AOCA 4XU3A 4C92B 3VV2B 2R42A 4JV0A 3HULA 2VKZG 2N4DA 2CRLA 1Q86U 3B8HA 2KJVA 3C66A 3HFNA 3OYHA 3EDRB 2J6TA 2OUGA 3QRPA 3AOBA 3L4BC 1IKVB 3SMZA 3PW7A 1HLWA 1GMWD 1KR4A 1D9DA 3CJSA 2M02A 2UXBJ 4I2QA 3BS9A 3MFIA 1GFWB 1SSHA 2HQXA 5B0AA 2HQCA 2F4VJ 1U49A 1FDDA 4ZGEB 5EDWA 4YP3A 3UN3A 2IM1A 1Q81R 2ZKUA 2HVDA 4KC5A 4PXDA 4CLSA 3F0NA 4RMOA 3NP5A 4B3MF 5D3GB 2F63A 3EWGA 2VC1A 2RQVA 1T9XA 4WU2A 4EO6A 2W01A 3CCES 4LF9J 1SEMA 1JLCA 3WC2A 4DEZA 1K8AT 4K11A 4TU9A 2DM1A 4AXJA 4Z37A 4DBRA 2WVCA 4EMDA 2C2RA 1TFYA 3LPYA 3CJ8A 4NASA 4UOCA 1FWKA 3BZQA 2C2DA 3AJ1A 3IP0A 2KBTA 4WTYA 3MM7A 4KJIA 5IQ6A 3CJ2A 3ULHA 5LJ3e 3DYAA 3G71S 4CLZA 1ZOTA 4LR7A 4EUVA 1S97A 3ILLA 2DGTA 1WHJA 5DM7Q 1U5SA 3EVOA 3H8ZA 2IVYA 4TU7A 2BQUA 3JCMf 1T3LA 2ENMA 4ZVUB 2DGUA 5THWA 1UWBA 4FU6A 1VLOA 2ZPEB 3R6NA 5A2QE 3I6PA 2L2PA 1LWFB 3NGTA 4J9OA 3O3LA 2X1FA 2YWGA 4M78C 3P5BP 3WC0A 3V6DB 2KYMA 2Y4YA 3PMIA 3WHIA 4RUGA 1FWLA 2FJXA 3FMBA 2LNHB 3CCTA 3MCSA 4M7DB 1TL1A 3CMES 4XU0A 1B3QA 2F5KA 3FC3A 2XWXA 5DDOC 1R77A 2DR5A 2K3YA 2GMJA 1EZZB 1YJ9Q 5HK0A 3IBCB 3NEKA 1KDNA 4WCIA 1WC0A 3ET6A 1SH3A 4M7DD 5BJRA 4NA2A 3GV7B 4K0KF 1HD1A 1B0PA 1VRUB 2DRBA 3M30B 2GX8A 2FDNA 2UXBF 1E6GA 3MMAB 1PCAA 6FDRA 1O0PA 2LJ0A 5HN0A 2OTLQ 1ZA1B 1AZSB 3OT9A 2VGMA 3W3SA 1YN8A 3REBB 2HVHA 2KYXA 4WFXA 1S6QA 2F7VA 2IJNA 4YS2A 1AYEA 1UEBA 4DQ2A 3QYHB 2KVIA 3JSYA 3MMJA 1T05A 1RAGB 3GLXA 1JRIA 4GVBA 3JCMg 4XK8C 1K0SA 4K5SA 1N0UA 2RD1A 2PN6A 1Y5NB 3J81Y 3JCMh 3ME9A 2LZ6B 5GAMe 3G8TA 2C22A 2GO8A 3OYCA 2OPSB 1BB9A 4TN2A 1O51A 2UVRA 1NSQA 3DKDA 4KGMA 1RUSA 4TY8B 1KP6A 2AKKA 3PACA 1GL5A 1JEGA 2C0TA 1VQ7S 3P49B 3WBZA 4A4GA 2Y8WA 2KJWA 4O3OA 2RQTA 4LVOP 4MAKA 1RHUB 2KXCA 5KCHA 3TR5A 1KN6A 1PWTA 5KFVA 2DHSA 2LEAA 3M8SA 3PKYA 1R0AB 1X4AA 4USVA 4R0JA 1EJ7L 4CP5A 1VYTA 2FHKA 3G6EA 2PD1A 1VRUA 5K8OA 1YBUA 2V8IA 3CDBA 5IXUA 3GE9A 3CJ0A 4OMFG 1F9HA 3LGMA 4H4MB 4HH0A 1BKBA 1PSEA 2DILA 2EKNA 3I56T 3KK1A 1NJIR 1F2HA 2HL5C 3LOUA 2QA4Q 3X1LB 1Z2ZA 3PJ9A 3VGUA 5HY6A 3KNAA 1IREB 2Q6BA 1XTDA 2YNHB 4NI2B 1KD1R 2HHSA 3K5PA 1DTTB 2XO7A 3BF4A 2J06A 5RUBA 4ANDA 3V4IB 4O4RA 4RTVA 1CJKA 3KLIB 3MFHA 3NMAA 2DRDA 1FESA 1CBKA 4LUEA 5KFDA 5E3CA 4OX9F 2ROTA 1UVNA 3R1HA 3THVA 1YIJT 1HNXJ 1RP5A 4NXMF 4NCGA 2AEMA 2L5QA 4V1Ak 4PG6A 2OPRB 1O75A 2FVUA 4M5JA 3R6OA 4UZCA 2KE9A 5B0EA 3OSPA 2DYAA 1LWEA 2X1AA 1YIJA 4PWDA 3RKYA 4NLTA 4N4IA 2ZWPA 2HBZB 1G7CB 1ICEB 2GW8A 1EQMA 3OLAA 3MJXA 2J6KA 4DR5J 3UD3P 3G9CA 3LWIA 2CQ0A 3PDNA 1VQ4A 1FNOA 3TUJC 2NR0A 4XQ3A 1UL3A 3PVLA 3Q0AA 1NDCA 4UF4A 5KFYA 3U02A 4AG1C 1M5VC 4LIWA 1WJ9A 5DGAA 5GAOl 1SJ4P 2GJFA 1CQMA 2CPZA 3I0RA 1FJGF 2RUGA 5E0OA 4C8QB 2RJEA 1UGPB 1IBKJ 2KM8B 1JLBA 5LL6d 3GIMA 4A0TA 4KH0B 5DM7R 5FLXE 3FBBA 4JRIA 1RT4A 2DD8S 2NUTB 3CC2A 4X64J 4JZ4A 2C2OB 1LNQA 3HVAA 4EZ9A 1YQHA 4C0HA 4NL3A 1BBZA 3K8VA 3SWNC 1RA7A 3CO9A 3ER0A 1U02A 3OSSC 3ENWA 2VXFA 1G3YA 3CCJS 2KR3A 2CAJA 3B78A 4RW7A 1LW2A 5GAMd 3P5TL 2RHQB 1JX4A 2C0OA 3GR1A 1UGRB 1NG2A 1F9FA 4I0WA 4RLEA 3I5RA 4A4EA 4J7CA 2GFAA 2J0WA 3I9ZA 2K5LA 2VUGA 2VG6A 4F8RA 2EKOA 1M90R 1M90T 3RMQA 1W2BA 1YJWA 4JV2A 2RDJA 1FI4A 1RBOB 2DL8A 3PGGA 4CC4B 3R7SB 4C8LA 3H40A 4Y2MA 5CXTA 2GBQA 2HHHF 1T0HA 1NK4A 3ITHA 1C0TA 2CJXB 1JXMA 1FFGB 4MFBB 4DV7F 1BYMA 2E12A 1FWZA 5I21A 3F41A 1EX4A 4JLIA 2W8LA 4F17A 4M75E 2L3QA 2MPUA 3T1HJ 5A0GA 2HZVA 4UQTA 3BY7A 4QZVB 3TEEA 5GAHU 1TKTA 2AU0A 2QA4G 1XN9A 2KVQG 2MQQA 1KQFB 2HQDA 3M4GA 4DN0A 3C3LA 2OPPB 3JYTB 4ECRA 4E7JA 4NOYA 3GJSB 1LWCA 4MIAA 4I6YA 1Y71A 2I9SA 5LJ5Y 4Y2KA 3J80Y 1YVFA 2EQIA 1MWZA 2AWZA 1NLOC 3KYLA 1LFWA 2W2NP 5I42A 3X20B 7FDRA 4DBHA 2FIUA 2J9EA 4IR9A 5IT0A 2D9TA 1Z9ZA 2SRCA 4M77A 2KK4A 3KG0A 2CP7A 2OTLS 1VK3A 3M9NB 2HBQB 5E5NA 4F02A 3SD4A 1N8RC 2G9OA 3L2WA 1KWMA 5KFFA 4EMGA 2KO1A 4Q0BB 2VQFJ 1U1LA 1RBAA 4J9IA 2O01E 4PABA 3QJJA 1WWHA 1I1JA 1QUPA 3C46A 1YJWQ 1G1XA 1FJEB 2UUBJ 2XCPA 3ZZOA 2KT1A 4DSFA 3G4SS 2OP5A 3NHNA 2XMFA 5J2MA 3CCQQ 1JIHA 4MK8A 2OAUA 3K58A 2BV3A 1YIJS 3NCPA 3NOCA 3UW1A 3CC7A 2HIYA 2YPZA 2RQRA 2ALYB 1FRIA 1XQHA 5E3QA 2DXBA 1N34F 3CC7T 3VVTA 3G6VA 3Q24A 1S10A 1NJIT 1VQ8S 1U1QA 2IA6A 4Z7CA 2V8KA 5AE3A 4O6JA 5KT3A 4OB2B 2BE2A 4L59A 2LMJA 4CLPA 1Q53A 2ZE2B 3TJ9A 1W2BS 5L1IA 1U0SA 3RBDA 3LGNA 4L6V5 2H4WB 3T41A 4IQMA 2MY8A 3PZPA 1UMJA 2PUOB 4JI3J 4MYTA 2HS0A 1Q5VA 2V0NA 1AB8A 3HFKA 1NYGA 4XPCA 3M32B 4F25A 5GAHI 2FD2A 3DHXA 3FRYA 2RD5C 3I56Q 3FUYA 2ROEA 1DJ0A 5A6WA 3D6MB 1VQPT 4K2JA 2IDEA 3HPWA 2ZH3A 3J80U 3PEHA 5IWAJ 3PR4A 4PG8A 2JVOA 2BANA 4NA3A 4R0KA 4K7QA 3QDFA 3HX9A 2ED0A 2J0SD 3J7AN 2B86A 1NSAA 4OZJA 2CG8A 2ZVIA 1RT7B 2ZPIB 1B7TA 2H3JA 2QGFB 2HMIB 1RTZA 3H20A 3KK3B 4JI5J 4C8QF 3IAM9 3Q2SC 2CS7A 4PJOG 3JTNA 3KMSA 3DMJA 1BK2A 2ZE2A 2P0QA 4PZVA 2HNDA 2Z2MA 2ZWOA 4PKDB 1FDNA 1X0PA 3H0IA 4ZVOB 3GF5A 4TQSA 4KFBB 2CJQA 2LXUA 3W2WA 1GCQA 3EVWA 3GQCA 2DETA 1NZAA 2K9GA 3I4HX 4J9SA 1FF2A 3SEOA 3BBFA 2I5JA 3BBBA 4I6WA 1RZMA 1IGUA 2OFGX 2CNLB 3HRSA 2EKHA 3FIFA 4KKOB 4NCAA 3BSNA 5FU6B 3BGLA 5IZHA 2A1BA 2QL9B 1YHQQ 1VYUA 3I0SB 3DRSB 1ZSGA 3GBQA 1QW1A 4Y28C 2EQJA 3RERA 3QJLA 1QVPA 4DPYA 1EQ0A 2DVJA 2DBBA 1KHIA 5GANf 3BJYA 2ZOGA 1AROP 2ZPHB 2GGRA 1PHTA 1HNIA 2DGOA 4DUZJ 2AJ2A 4C8NA 2CQ2A 4ZVSB 3ZZYA 4RWWA 2L3SA 2JVRA 5C25A 1RT6B 4KHRA 2JT4A 2LYVA 2K4YA 1YBYA 3RKXA 2P0KA 4PJMA 3CBOA 1VLYA 4YQWA 1XNQJ 2OH2A 1U1TA 1JXLA 5CR2A 1RWNB 1N0VC 1VBYA 2XZTB 3MAHA 3DLJA 4DFPA 4JI6F 3OJSA 1QLNA 2JSXA 1QWEA 4C92C 4QR0A 4X65F 4N4GA 1OV3A 2RNEA 2LDYA 4X4VA 5C5JA 4U7UD 3LH0A 1CULA 5D4PA 3M6WA 2HRYA 4IDKA 2CH4A 1NMEB 2OTLT 1AXQA 3R3TA 1PILA 1L3KA 2DYBA 3H2LA 2EWNA 4KKOA 2J9CA 1TZ0A 3CD7A 5KG5A 1CJTB 1Q8IA 3PV8A 2A10A 3CJQA 1IM4A 4X66J 3G4SA 5F8GA 3TZZA 3A8KA 3OV7A 2RK2A 5L46A 4NXMJ 1RAHB 5EUHA 4OLOA 3ILIA 4ECQA 2Q6CA 1PC0A 2EQKA 3VAIA 2XZDB 4NWBA 1ZETA 3PRVA 4YY3F 5KG6A 4LBPA 2YNGA 2YUQA 1S76D 2PEBA 2GMLA 3HT3A 3ELHA 4KH1B 2AW0A 2ACMA 4OMLA 1WOSA 1T3SA 1WLPB 2HRUA 2W4PA 2UV8A 3I5CA 4Y2AA 4ATOA 3O8VA 2UUWA 3H8YA 2PA3A 3TZXA 5T7LA 2F4VF 3CDEA 1UETA 3Q23A 2DNKA 3QZ7A 5D7UA 3MEDB 1RCOB 2DY9A 4L3KA 4PPDA 3CCMS 3WX8A 2CUYA 3PFSA 1UJ5A 1BCOA 2JOYA 5JJBA 3M55A 2RHXA 2BDPA 2C0IA 3HJFA 1MMGA 2OTJT 2KXHA 2M0GB 2QDYB 1TP7A 2V8HA 4DV0J 4ESNA 2EC2A 3IS9A 2E5GA 3E9GA 1WTFA 4HDHA 5KYWB 1KFZA 2FLNA 1LW0A 1Q95G 2I0XA 5DLGA 3CD6T 3KG1A 4L73A 1I4K1 1Q82U 1SQEA 5GAN6 2GNKA 3GJTB 3VUBA 2ZJPQ 2NWMA 3A1YG 2HHPA 3VAGA 4JYAF 2MLZA 1UP1A 2ZH2A 3RAQA 2CQIA 4LFAF 2CDRB 2O9VA 2FVSA 1RWUA 1VYVA 2RQUA 4QWDA 2W7OA 4LR8A 1QMCA 2GC8A 4JS5A 5L23A 2H48B 4QW8A 3KLEA 4O23A 2RB6A 1DJ7B 2R9LA 5HJXA 1F1BB 3GYXB 2D9PA 3R7BB 4KV8A 5E41A 4DMZA 2COLA 1U26A 2I2LA 4JI4J 3C94A 2XI2A 3OYGA 4B9UA 3NTKA 4M77G 2YPYA 4E6RA 4JI0J 3CC2Q 2W2MP 4HKEA 2WSFC 1Q79A 2CQ4A 5JMNA 4A8OA 3TO8A 4MYUA 2ZAEA 1VQ7A 1T05B 5F0WA 5KYYB 2RAQA 2E64A 4C0BA 1KVJA 1GFCA 4YOEA 5J1NA 4RTTA 2DH9A 4X4RA 4LVNP 1KQSP 2QE5A 2RJZA 1EHWA 1YRTA 3U1LA 2GQVA 4X65J 4A4HA 5GAOm 3K89A 2HZAA 1UJ0A 3SQOP 4NLWA 3N5BA 3SWNA 1MMLA 4J8OA 3PIPQ 2NPIA 2CYYA 2L9NA 3QAUA 4TY8A 2KPPA 4ENOA 1ZUYA 3V81A 3TI0A 4PG4A 1IUJA 1HNZJ 5KT5A 4JJCA 1Y3JA 1RCXB 4AE5A 1U6BA 2DITA 1UTAA 2YNIB 4DSJA 2PMHA 3JTOA 1AUSL 4J91A 1ZSZB 3UN2A 4IURA 2YLBA 3PVQA 2DTHA 4K59A 1WOPA 4CH0S 4PJNA 3GG1A 3UVJA 4ITSA 3WZ0A 4Z8AA 5ETPA 3Q83A 2QASA 3VV0A 1WC6A 3QZ5B 2CUBA 2RK1A 4QT7A 1N5SA 2MKIA 4IG3B 4C2MA 1VGYA 3ZC4A 3QSYB 4RCBA 3KK1B 2YY3A 4JZ3A 1JLAA 4ER8A 2E5LJ 1QTMA 1ABQA 3FQLA 2WVFA 1QVGR 4CCHA 3BKTA 4DUYF 1VQ6T 1P8GA 2RQ4A 2JTEA 3UF4A 4LDYA 1H6KX 5DDRC 2A36A 2ZH9A 3AHPA 1PYTA 5CYJA 2QA4T 2XMUA 3KLHA 2E9TA 4FXVA 3CC2S 3DRRA 1FNXH 2CPEA 3OYNA 5J1PA 3O5ZA 3LGFA 1HBNB 3TA0A 2QA4A 3L09A 2COYA 2YRDA 2VD3A 3QATA 4C4WA 2LJ1A 1PC5A 4C8ZA 2QI2A 4ED8A 3TJ8A 2F1FA 1VQPA 1FK9B 2B9EA 4N56A 3MM8A 5D4LA 1OY8A 1QAJA 3IBFB 2IC3B 1XMQF 2KKHA 1JXEA 2MIOA 3TVKA 1GH8A 1RWVB 2D6FA 3EGDA 3LP1A 4CT8A 4QWCA 2AJ1A 3SBMA 4IOCQ 1U1OA 1Y96A 1V3SA 4WK1A 5HCKA 4J9KA 3W5ZA 2R58A 2CWKA 1X4FA 4CIOA 1N6QA 4AXIA 4C0DC 4PJOC 4ZHRB 2HQGA 2DHHA 3W2VB 4USKA 3I31A 2LCCA 3OFEA 3OYDA 2KI2A 4LUBA 1LPLA 2PVDB 4LSLA 3GTYX 3VWSA 5KFNA 4II1A 1BU1A 1VQNT 3RU0A 4IOAQ 2NPFA 1A0OB 1DRZA 2CT3A 3PHTA 4ZDNA 5EGYA 3VUZA 2NZ4A 3ZZPA 2PA8D 4HT5A 4DZ6A 4M78D 1S7HA 1NRKA 2R2TA 5I3QA 2W9BA 1JLBB 1R0BG 3QWXX 1U45A 2ZC3A 1VQLS 1HMVA 2MKHA 3A3OB 2LCLA 1HBMA 2NUTA 5A0DA 2QLFB 2V68A 5CKFA 4EBCA 4ZPWR 4O0NA 5FLXY 4F67A 3OYYA 3CD5A 4J9EA 1X6OA 3EYZA 4NYZA 2WVDA 4WFAQ 4Z89A 3C95A 5F8LA 2EEYA 3SDEA 4BWJA 1TV6B 2EPDA 3FJPA 1VIFA 5K8PA 1GXLA 1HNWJ 5KFPA