1NPPA

Crystal structure of aquifex aeolicus nusg in p2(1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 53
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nppA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nppA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nppA01
5DM7R 1XNIA 1YI2A 1VQ7T 2DO3A 1YHQA 1S72A 2JNGA 3J80E 3CCSA 3LD7A 3CCRA 3A5ZB 3OW2A 1YJ9T 3OYYA 5LL6S 2QA4T 3CCMT 1VQ4A 3H7HB 3CCQT 1K8AU 1Q81U 1VQKT 3J81E 3CMET 3CPWS 1VQLA 1VQ8A 1M1KU 1VQ6A 4QQDA 3G4SA 1KQSS 2LCLA 3CCJT 1VQOT 4RG2A 3JAME 3G6EA 2LVMA 3CD6T 3PIOA 1VQ9A 3CC2T 2E70A 3CCLA 1QVFS 1NPPA 1YI2T 2E6ZA 1YJNA 3CCET 2OTJA 1YHQT 1M90U 1SSFA 3DLLA 3CC4T 3CCST 3G71A 3CCRT 3LPEA 3P8BB 1VQPA 2OTLT 2JUFA 2JOYA 2EXUA 1NPRA 1KD1C 2JVVA 2QEXT 3I55T 1VQLT 1Q86C 1JJ2S 1EIFA 1NZ9A 3I56A 4ZN3A 1YIJA 1K73U 1QVGS 3CC7T 2KPPA 1YJWT 1N8RC 1VQNA 1M1HA 3J7AF 4TVRA 3CCUA 1KHIA 3HKSA 2OTJT 1IZ6A 2MWOA 3CCVA 1Q7YU 1KQSA 3CPFA 5A2QE 1YITA 1KC8C 2MI6A 4OBIA 2OUGA 1NZ8A 1QVFA 3CXCS 1VQMA 1S72T 1UEBA 1NJIU 4CRIA 3OW2S 1Q81C 2L3RA 3PIPA 1VQ4T 1Q82U 1M1KC 1YIJT 1VQ7A 1VQNT 3QQCD 3LGLA 1VQ6T 3TREA 1VQ8T 2K06A 1M1GA 3G4ST 4ZN1A 1VQ5A 1W2BS 2MWPA 2KDSA 1JJ2A 3CCMA 3CCQA 3G6ET 1YITT 1VQ9T 1Q86U 3CCLT 1K9MC 5HY6A 1VQKA 3CPWA 1YJNT 4YTLA 2LQ8A 3G71T 1N8RU 1VQPT 5IT9E 1VQOA 1YBYA 3CD6A 3CC2A 1BKBA 4X34A 3CCEA 5J3BA 3CXCA 2G3RA 1K73C 5DLQE 2IG0A 1KC8U 1K8AC 3CC4A 3KBGA 2EIFA 1VQ5T 3CMAA 3LGFA 2OTLA 3I56T 1Q7YC 5IAYA 2QEXA 3CCUT 2XHCA 3LH0A 3I55A 4ESNA 3EWGA 1YJ9A 3CCVT 2QA4A 1W2BA 1KD1U 1M90C 3ER0A 1QVGA 3CC7A 1YJWA 1RL2A 1NJIC 1X6OA 3DB4A 3CMEA 1XTDA 1VQMT 1Q82C 5J26A 5FLXE 3DB3A 3CCJA 1K9MU 2CKKA 3CMAT 2KVQG
chains in the Genus database with same CATH superfamily
1QCOA 5HKCA 2ZNYA 3WIUA 2D3ZA 4QWBA 2GTJA 1Q5YA 4I64A 2JSXA 5KFQA 4JV2A 2BZXA 1E6GA 2CUBA 1VQOT 5GAHI 2BX6A 1DURA 5GMKe 2E70A 1WHXA 3BGLA 3IRWP 4ZVQB 2FJWA 3J81j 4FL6A 2EEYA 4JI3F 1IQZA 2N4CA 2J5AA 2HKEA 2OPQA 5LXRA 2GAGC 2RVJA 1F3FA 5LJ5g 3NWRA 4DPXA 3OL8A 1PC0A 1WHLA 2HWTA 4KRTA 2YWKA 2V4RA 1FMVA 1AA1B 3O6QA 2A18A 1FX4A 4IFYA 2XNQA 3RTVA 4DQRA 3JQKA 5CQYA 4RLEA 4X4SA 5F8MA 2XWYA 3KG4A 3OFEA 3H0FA 2CZ6B 2EK1A 2R58A 2Q79A 4CLUA 1B07A 1RAJA 2XMMA 3ENWA 1YJVA 3I56T 2RI3A 3LGMA 2C0TA 4TLQA 3VAJA 1LXJA 3L3CA 3K89A 1BCMA 2DBBA 3AH6A 2IRUA 1N5YA 1VLYA 2RQRA 3ENAA 3JCMe 5F0WA 2DGXA 2Q3PA 4C0HA 1A0OB 1X2QA 2X4WA 2MKCA 4RU9A 1D8ZA 1KN6A 3C94A 2VUBA 4RTXA 4C11B 4OYBA 2KJWA 2KKHA 3DLBA 4N4HA 1M5HA 4NWBA 2OFGX 1NJIR 3JSYA 2MAMA 1WF1A 2DNOA 4QJVA 4OJ3A 1FJEB 4XTWA 1RAEB 2B9WA 2O5DA 2R7TA 4QU7A 4IDKA 3HX9A 1S97A 3EYZA 5B08A 3VS4A 3U1MA 1J5OB 2VF3A 1Q7LB 3R8YA 3HL8A 4A8KA 1ZSGA 1JLGA 1LW2B 1HW8A 3HP9A 5ETSA 3LGLA 5LSOA 5IHKA 2DVIA 3NBPB 3M32B 1DZ5A 5BYSA 4K4XA 1AW0A 2OTJS 5FLXY 4UW2A 2XU8A 2D3OR 1Y5LB 2B9YA 1NCLA 1YBYA 3SWNA 5HP1B 2YSQA 1D9AA 2GF7A 3CXCP 3BYPA 1NU4A 1KC8T 4DR4J 4OMLA 2AHOB 5HVFA 1PYTA 1S7HA 2YX7A 3CCUT 3REAB 2E7XA 3H5XA 3NGPA 1W4SA 3ZXWA 4DG1B 1TWBA 4PJOF 5F9NA 3D4JA 4ZTFA 4EMKC 3X25B 5A0YA 2JTEA 1N48A 4F4KA 2ZH3A 1H0HB 2NR0A 2X4JA 1VIEA 2U1AA 3J80E 1WX6A 1Y10A 4PFOA 4IIMA 3EDQB 3DM2B 1M1KU 1MLAA 2M88A 2BTTA 3OBWA 2ZZMA 3TZXA 4DL3A 5DY9A 1YNZA 1YN8A 3S6EA 2DBMA 2OTLT 2SRCA 4FPRA 3JCMJ 3GSIA 3HSZA 4PG8A 1XMQJ 3FJPA 3R5GA 3Q8RB 1YJWT 4E7KA 3BBFA 5FWBA 4HI2A 4DR2F 3F41A 4LSZB 3M0QA 4USJC 2OSQA 3FMWA 4K0KJ 3US5A 1JEGA 1LKZA 1X4AA 4WYLA 1VQLS 4ZPVR 2VG7B 4F4XA 4ZPTR 4OJGA 1IJEB 7FD1A 1S1VB 5ETQA 4FF2A 3M1VA 3DGPA 4Y2MA 3EGNA 1TMMA 3NG8A 3FSXA 2Q6BA 3KLHA 4OV6A 1IGUA 4CM0A 2Y8WA 2A6MA 2ZD1B 3QZ9B 2RJDA 2L9WA 3ZC4A 2PMZD 3M0TA 3CC7A 3Q2SC 3EG9A 5LMUF 3IG1A 1U48A 4NLDA 2GTOA 2F2XA 2HQ3A 3O44A 2RJZA 4OX6A 3HTRA 3BN4A 5AXMA 4MAKA 2BABA 1H74A 2H4YB 2FDNA 5J1EA 1I5OB 4ZVUB 3KJFB 1MMLA 1TH7A 3FSIA 3VGSA 3SCLE 1HMVB 2JUFA 3H42A 4DQIA 4RTVA 4N5SA 1QAXA 5F8LA 4V19J 2AW0A 3AB2B 2MWOA 4BWMA 3P45B 1NKCA 3EVWA 1S1XB 2K7KA 1CQMA 4DV3J 1HL6A 5IFMA 2NLUA 2OSRA 4RTZA 1WOPA 4FBUA 5HQ8A 2QYCA 1X43A 4IG3A 4OFZA 1KSWA 1AUSL 3EFOA 3H20A 2QDYB 4R0KA 3SXLA 2IJNA 2EC0A 2GO9A 1AWWA 1VK8A 2BDPA 2CXEA 2KXNB 2FPHX 1YG0A 4DQQA 4LREA 4DCPB 2DPPB 3M4YA 4HA8A 5B7WA 3CC7Q 4ZA1A 2IMOA 3D1HA 4PFZA 1BI0A 1VQMT 3RW7A 2YWFA 3VVUA 3JYTA 2V9WA 3V6DB 4K2XA 2QC3A 4UZCA 1WDXA 3ENVA 4AD6A 5ETVA 3AQOA 1FKPA 1P6TA 2HNDA 3TUZC 3IS9B 2VPXB 2QLFB 2GC8A 3C6TA 2MXYA 3KHGA 4MKBA 2CZVC 2VJUA 1EJ7L 2C2EA 4ZJLA 4I4BA 1D1BA 1WTFA 2HMIB 4JI6J 2Y1LB 5CD4H 2FB7A 5KCHA 1M5KC 2FEIA 3RUXA 5GAN6 4F25A 3GNGA 1Q8KA 2ILYA 1AFJA 3CJQA 4I68A 5C2GA 4Q0BB 3QWUA 1HNZJ 1KQSP 3EPGA 1NZ8A 5J2MA 1HNXF 4KGMA 5KFEA 4KBMB 3OR1B 4P73A 1VQYA 2CPDA 1NH7A 4K7QA 4PYAA 4M77A 3G6XA 1V76A 2AJ2A 3EM1A 3ITHA 5I22A 4JI0J 1BD6A 2XYPB 3KUHA 2BEFA 1WKJA 4P75A 1NK7A 4WFNQ 1TKTA 2ZHBA 4DV5F 3NFCA 4BE1A 3LTOA 4IUUA 4DL2A 3JB9D 1D1CA 3IBWA 4ES1A 2MLZA 2CSIA 5FLXU 2RILA 2F4VF 2J9DA 2ZH5A 2QEXA 1R3NA 2VG5B 4HVZA 1RAFB 3W7BA 1Y11A 3DB4A 3CTRA 2E5KA 1DTTB 1U1LA 4C8QD 1SJ1A 1PJ5A 2HQCA 5GADI 3LD7A 1EKSA 4DL0C 3VAMA 2KXDA 3REBB 2CJYB 2MGZB 1PAEX 2YKMB 1W6XA 4P10A 4O3PA 4I2PB 2R8GA 1OQKA 2OFHX 3SYZA 1GH8A 2EGAA 3V8KA 3G71A 4WXOA 4DV7J 2MDAA 1DARA 2JX2A 1Q82T 4CC2A 3VCDA 2R2UA 2HMAA 4IRCA 4ATOA 2DCUB 3QO3A 4IKAA 3PX4A 1Q16B 3ZO7A 3M58A 1A6LA 5GMKl 4OYPA 3ISZA 4NLOA 1WC4A 4NYZA 1QVFA 3GR1A 4PJMA 3SBMA 2C1EB 3QT6A 4Y2IA 1P8GA 3EVMA 3MAHA 2XLJA 3TREA 2L5QA 4RW9B 2FVRA 1SPBP 1UGPB 2EKHA 2XSJA 3JCMg 2KYBA 4M1KA 3UDLA 4C8ZA 4C8QB 4OZJA 4ME7A 2DIQA 4L3NA 1JLFA 4DR6F 3PR4A 5GAMd 2DGQA 4M7DA 1ZAWA 3T9NA 1RYRA 4J9BA 4HH1A 4K4VA 2QEXQ 1SC3B 1NO8A 2EJ9A 3PGGA 2AWZA 4U7CA 1CULB 4ZITA 4CO2A 5GAGI 4HHUA 1SH2A 5B09A 1HI1A 1YBUA 3ZZRA 1ZA2B 4RJVA 1AWJA 4R0EA 1EAYC 1O6XA 3PRDA 5KG5A 3D9BA 1OI1A 3UNGC 3ONQA 1YCSB 3PY8A 1UMJA 1Q7YT 2CNKB 4DR5J 3KK1A 4USTA 1J2VA 1SL1A 2RNAA 3K17A 3NCPA 2M9UA 4M7AG 4K8RA 4M63A 3M8QA 1KVKA 1LV5A 3CCRT 2DNZA 5CCAA 4OI6A 2W4DA 2EPDA 1S6UA 2R8IA 5I3QA 4KAIA 3A3NB 2KPPA 2K7JA 2UV8A 3A8KA 1JXLA 1TTHB 5LMNJ 5HMZA 5KFPA 2HNYA 4TNOA 4NLVA 3HDSA 5D0HA 4LRDA 1SJFA 3UD3P 4B3MJ 1QAJA 3K59A 2LCCA 1FI4A 2V8DA 1RAOA 4NX9A 3CC7S 4OZNA 3DRXA 2RUSA 1SKSA 1S0VA 2BOAA 2CPEA 5L1JA 3QRRA 1MWYA 5J2NA 1VBYA 1U4BA 4ZVPB 2ZH8A 3CCEA 4RUAA 2E10A 2FD2A 2H5IB 3LWIA 4X1VA 3ZEHA 5K5MA 2E5GA 1Y07A 2IJFA 2DR9A 4IG0A 1WKLA 3MUTP 1JB0C 1ZSZB 2J6FA 3LGHA 4FPIA 1RL2A 2UUCJ 3DRPB 3MCOA 3HI9A 3HPWA 2J0QD 1AD5A 4NASA 3Q8PB 2E41A 3UD4P 3CCRA 4RW4A 1UJYA 2HVIA 4DX5A 2EYYA 5DDOC 1K9AA 2CP2A 3HJVA 1K8AT 1D0YA 4Q45A 1QCFA 3VS3A 3RUBL 2J9EA 3P49B 2GMHA 4Y65A 1GCQA 1HNIB 1ELOA 2ZE2A 3K7RA 1HK9A 4RW8B 1NM7A 3RRKA 1X31C 3WC0A 3M8YA 5JVGQ 3H5YA 3B8HA 1U6BA 4A8OA 3HHEA 2GA7A 4C5EA 1M2OA 2ZJPQ 1H3HA 2E7WA 1WHHA 1BI3A 2MJNA 3D1QA 3PYFA 5I3UB 4CRIA 2HL3A 5KFAA 4HI1A 1OMSA 4GKJF 3PVLA 2YQ2A 3M2UB 3OPKA 1VRQC 3MAAA 3EZOA 4X9CA 2A2DA 1FA0A 3OB9A 1UJ6A 3CCLT 4A4FA 1JNZB 2WAQD 4M8LA 4ALZA 3IBCB 1IQTA 3CCEQ 1RT4B 4A4JA 4HLBA 2HZVA 1LW0B 4BD3A 5KFYA 3J80Y 1RTIB 2ZM6J 2YWGA 1GEHA 2V0NA 1TAUA 5C25B 3LP0A 4LDVA 2VBWA 3BR8A 3KG0A 1M90T 3BF4A 1N0VC 2Y1IA 1T3SA 2HS0A 2B56A 2JL9A 2KRMA 2XCAA 3L9ZA 3BO3A 2KVIA 1FESA 3OYYA 3KHHA 4ECYA 4NLQA 1K0TA 1RWNB 1I51B 3TRGA 3V7CA 5FJ4A 4L76A 3JSCA 3GR0A 2CGHA 1Y0HA 1KDNA 1T3LA 3L09A 3OS1A 1FXDA 1TSFA 1FRHA 4ZHRB 5EWEA 2DXDA 1TL3A 1D3BA 2W1BA 4Z8AA 1XR5A 3I55T 2RDDA 4P2SA 3NLCA 3VYGA 3BGRA 4CYUB 3J7A1 4FVMA 2MY8A 4OI4A 3CDUA 2VONA 3VKIA 1MW7A 3PFOA 3RBDA 1X4DA 4ZTJA 2LQBA 3DLGA 5HLFA 2KDOA 4MYTA 4U8YA 1S9EB 3R6LB 2QEXS 1OWXA 3KK2A 3NGKA 2VFSA 2EW9A 2MZSA 4YHHJ 5F8HA 1RWKB 4M77C 1SJ3P 2GHVC 1YFNA 3FKBA 4FYVB 1C0UA 2LKZA 3MTKA 1K76A 4X9DA 4FKYA 2HHVA 2QYGA 1HIYA 3UN5A 4A8XA 2V8VA 3NCRA 2QQBA 3VAFA 3PX6A 3GQCA 3WZ0A 3QSUA 1G3OA 2LX7A 1Z9ZA 2JRSA 2XO6A 3G6YA 1WOOA 3B54A 2IFXA 1FO1A 1X5TA 5KFXA 3PYEA 3QLHB 4YY3J 3OW2A 3PCOB 4DBHA 9ATCB 3C3LA 1RTJB 1FJGJ 1KOHA 2YT6A 2LU2A 2FHKA 4OZ0A 5EN1A 1HWJA 4WU2A 1QVFS 2E6ZA 1XR7A 3BGFA 1Q82R 4CLFA 2JTMA 1C1AA 5K8PA 4PG7A 1RT3A 1P1TA 2GFFA 1UDLA 1VCTA 3M4XA 2UXDJ 1IHVA 4UZBA 3KXDA 2M8DB 2PIIA 4MTPA 1ZUKA 5KCOA 3FVYA 1JJCB 4CI0B 3NAIA 3NNCA 1SRMA 3PTWA 1NJYA 3E01B 2IPOB 2WW4A 2V5HG 3MCAB 1N8RU 4CLKA 2NLWA 3CD6A 2CKWA 1UA0A 3MECB 4J7IA 4NMLA 2K1RB 3SIPB 1ZAXA 2FY8A 2DKGA 4AL6A 4M7DC 2E44A 3VALA 4I69A 4F14A 2FZKB 2E5LJ 2XHCA 4LDYA 2DH8A 2KHDA 1HD0A 3VU3C 4RR5A 1OZ2A 1HBUA 4PJLA 3QWPA 3GOXA 3J7YI 4ECSA 1K9MU 3GIKA 3NPFA 3ZFVA 1Y71A 3NAHA 2MQQA 2D3O1 1RAGB 4DF8A 1N9RA 1S9GA 1Q7YR 2BRKA 2WRMA 3QIPB 4RWWA 1YWPA 3I5CA 5GAMe 4FCYA 3MCSA 4M5DA 4UF4A 2K3IA 3S3MA 4M78D 1LVKA 1SI9A 1M2VA 5C24A 3ISND 2NXUA 3CBOA 5GAGU 2CREA 4NMXA 2ROPA 5EX0A 4ZS6A 4II1A 2W2MP 3CCES 1ZM2A 1CBKA 2VFTA 4LSNA 4DOZA 4KBIA 2J9CA 5CYMA 3IRXA 4RU2A 4DEYA 4ELVA 1EX4A 3KLGA 2D9OA 3E51A 3KLIA 4FXDA 2OD4A 2O9SA 4ANJA 1HLWA 3B82A 5HL7Q 1HD3A 3CD6Q 3HSGA 1QSSA 2LQ8A 1WEYA 5THWA 2KXCA 1IRXA 2CG8A 5LSLA 1NEGA 2LCSA 1B3QA 3UT1A 3FRYA 2ZITA 5K20B 3OFGA 3MPYA 3J80U 2VZ9A 3Q24A 1UG1A 1QDUB 2P6TA 2DB1A 1NKEA 2GGPA 4DPUA 4LQ3A 1IM4A 4F7UA 4M78B 4WIIA 1NLOC 1PO6A 5LL6S 4DV1F 1B0VA 3SFUA 2E3HA 1U24A 2KM8B 2V50A 1ROFA 4M77E 2AKLA 4OGEA 2M02A 5A0LA 1DY3A 4ZP7A 4DV2J 2MQ8A 1BQMB 1YDLA 3MMCA 4ICLB 2EXUA 3K5PA 2OPPA 4OHVA 2DO4A 3NEKA 2MKKA 3TZZA 3H2LA 1GCQC 4RWXA 3PHTA 1FCAA 2DHHA 3D6HB 4AL5A 4HCKA 4C8QF 2A7YA 1R0BG 4RNOA 2HHPA 4B9XA 1JXOA 2H3EB 1J3TA 5GANd 2VBYA 4BLGA 3D7SB 2GMLA 3AOBA 1VS3A 2L3RA 2ZOFA 2DERA 3M8PA 1JQQA 4NCGB 5GAOp 1K0VA 1LXNA 2V26A 4DV6J 2GVZA 2DNYA 2AGQA 2CRLA 4QR1A 1T95A 1T9WA 3PMTA 5RUBA 4I7FB 1AROP 2WTFA 2IAJA 2EQKA 3FEZA 3TU4K 1M5SA 3DOLB 3GBQA 4FYXB 2D3UA 3AA9A 2XSFA 4NA1A 3CWJA 2ZAEA 5AYFA 1PYOB 3LH0A 2XMAA 2D8JA 4JUVA 2ZC3A 1JBMA 1UHFA 1M90R 2ZPBB 2XI2A 3W5YA 2K9GA 4USUA 4YDDB 1B0TA 3TVKA 4EI2A 2B4PA 2OP5A 3LALA 1TXQA 3I35A 1WHGA 1F5AA 2I9SA 3EG2A 2ZDOA 4JS4A 2V6AA 2QA4T 1VQKT 2DPJA 1IKYB 3GNFB 1UFLA 4IUVA 4J6WA 1TV6A 4DV0F 1A7GE 2GJFA 4X66J 1ZS6A 3OW2R 3FDRA 1JMTA 3TAQA 2ZVSA 1U2CA 2XMJA 1XMOJ 1U0HA 3KMQA 3KLFA 2JOYA 2EJFA 1PD0A 1JK9B 1OY8A 2LQJA 1HI8A 2DNRA 4C5IA 1Z2LA 4B02A 4RL1A 1MWQA 4CWBA 3LP2A 4Z2XA 1KR4A 2BUNA 1NJXA 1Q81C 5A8RB 3HFZB 2KU7A 1RE1B 2MWPA 5ITHA 2CYZB 2Y9HA 1VGYA 3UVJA 4B9SA 2CDRB 1AWXA 1FVQA 1JXMA 3QFHA 1KLMB 1TUWA 2NSBA 2MF2A 3DOKB 2ZH7A 1Y3KA 1BQXA 4KRWA 1HBNA 4LSLA 1F1BB 1WOSA 2BOPA 5E3AA 4ETZA 3ILLA 3TQ1A 2QA4A 2K7AA 1M90C 2DT9A 4M5IA 3N6MA 1ITPA 5J1NA 4USWA 3VWSA 4GVBB 2R8JA 2QA1A 4WP9A 2ROTA 5E0OA 4J9MA 1YIJQ 3W8GA 1RLDA 2ED0A 5KT2A 2IYIA 2K4YA 2ZUGA 1KQKA 2ZPGB 4C92A 2CVEA 2CQGA 1F6TA 2IC3B 2ZFHA 4Q43A 5E5NA 3DKDA 3RRGA 2F3JA 4RTTA 2XEXA 5K8NA 2XNRA 2MZTA 4J9RA 5FDLB 4ZVHA 2NYHA 4DR4F 4NZ7A 3K5OA 3ZBDA 2RKIB 4WFXA 4OYXA 3CD6S 1G3TA 2HHXA 1R8PA 3CMAQ 3NMZC 1CPZA 2VC0A 4ITSA 1NJIU 2XZWA 3OYKA 1QW1A 3OS5A 3V6KA 1NZAA 1KD1T 2RS8A 5CXTA 3TX0A 1KONA 3ETOA 2EG2A 3QFWA 3CPWP 1W25A 4OB0B 5LL6d 5B0AA 1UWBB 1BU1A 2KJVA 5KAKA 2W9CA 3P6YC 1OPKA 1Y4ZB 4NLGA 1QP3A 3CBMA 1K0XA 3ETMA 3MM5B 3ZFJA 4A48A 2VGMA 2W9BB 1S6QA 4XAXB 2BE2B 3QWYA 1XMQF 1TELA 1HJDA 4IH6A 5DM7R 3TSZA 4J9QA 3EAEA 3EHRA 1F5BA 2VD3A 3GLXA 1XIQA 1VFJA 2C06A 3UD5A 3HO1A 3V6JA 4K5RA 4DFPA 3L42A 1CJUB 4K0KF 3CXCR 3PNIA 5AT1B 2LQKA 4PG6A 1KLNA 1YBAA 5L39A 2R7UA 3K5MA 3OMGA 1CJTA 2EG1A 2KYXA 3AJDA 4FSSA 3MEDA 4DUTA 2L3PA 4JRQA 2Z30B 4UUXA 2WZ1A 2Z4PA 1Z2ZA 2Y1JA 2MKSA 1F0XA 1GL5A 1VC0A 2BM0A 4LRCA 1LQ9A 3J7YU 3TI0A 2HKNA 4JZ3A 1IZ6A 2HGMA 3X20B 2FHJA 2W2PP 3CPFA 4YUDA 4JI7J 4NCBA 1IXDA 2FJBB 2V94A 1HHSA 1HQUA 1N5TA 1YJ9Q 5EWGA 1D0XA 4PXDA 1JXEA 2HRYA 4YOEA 2MKHA 3V81B 2E4HA 5EHHA 3KHRA 2FGCA 3MPUB 4K5SA 5CIUA 3I0RB 2YPYA 3WVEB 4O4GB 1VQSA 3TEEA 1FTCA 4J9GA 3SFMA 1I3OB 2RO0A 2AJ1A 1UE9A 3GFZA 3F73A 3QNWB 2AJ0A 4JDSA 2UU9J 1LK5A 1U5SA 5K14A 2OHDA 3MFHA 5T41A 2W7PA 4KKOA 3RR6A 3MM7A 1NSKL 2JS2A 5IC4B 4WXWA 1E6YA 4DF4A 2HNZA 4ES2A 4RBVA 4DV3F 4WZQA 2QO3A 1K73T 4I67A 3BEGB 4JI1J 1F2HA 5KFSA 3BDPA 2WSFC 2YNHA 1GMVA 3FBFA 3R5BA 1BMQB 1VQ5Q 1SQEA 2GJ2A 2HSEB 3MPDA 2DK2A 4PJOA 3GJRB 1PHTA 2OI2A 2RPNA 2P0PA 3GG1A 2IRXA 5L1LA 4MIWA 4FSXA 3FFIA 1VUBA 2B6AB 5LJ3d 4KB7A 2M51A 4CNYA 5ETKA 1KBRA 1OV3A 1UETA 2AYEA 6AT1B 2EBGA 3FCWA 1VRTB 2R57A 2JWNA 2FHOB 2LTOA 3DI6B 4DMZA 2A37A 1WC0A 3UA7A 4RMOA 2UVUA 3ADAC 2BYCA 2KDSA 5FU7C 3CCQA 5KYUB 3O5TB 4OLPA 2IA6A 3G6VA 1CJVB 3RKWA 1SIZA 4USKA 1NB2A 3B6BA 3VAHA 3LWMA 4ZDNA 1YIJS 3L7PA 4NRUA 4JI6F 3OVBA 3GG0A 3PXGa 2HFZA 2XMTA 3LYIA 1U6ZA 3MEEB 4EMKB 4ANCA 4F4AA 4M95A 4K4ZA 1HKAA 5GANe 4C2MA 4OI1A 1HNZF 5GMKj 2LNVA 2O3DA 4UOFA 1PCAA 2RJEA 3H90A 3QAUA 2XMFA 4ZOSA 3CPWS 2GIQA 2G0CA 4MMOA 4E7JA 5JVHQ 2VC8A 4HEA9 4L3KA 2LVMA 1VQ9A 4JI0F 1YHQT 4P6QA 5KFTA 2DRBA 3RAXA 1X27A 1MWZA 3CMAS 4LBHA 2M0OA 2EBEA 4CQ1A 2CQCA 2J6SA 2PI5A 3R5AA 3JSMA 2KE9A 4M75A 2QE5A 3HFVA 3GIRA 4ZN3A 1SUQB 4HVWA 2WB4A 1UWAA 4MK7A 3G86A 4BDPA 2YBVA 1AB8A 3MMJA 1LEOA 3OD2A 1RLPC 2KR3A 4E47A 3GCWP 2J0WA 3CCQQ 1OULA 3TP2A 1P9YA 3EGZA 3CJ4A 2NUZA 3CCMA 2KK4A 1NE8A 1RT6A 1ZH5A 2GMJA 2QLBB 3CT9A 3ET6B 5AE3A 3QSIA 2IM0A 1RHJB 2G3RA 4M78F 3VS6A 2HLUA 1JIHA 1GFCA 1MV0B 1WXBA 4YB5A 3OYAA 4WPAA 4DV7F 3VS0A 1PJ6A 2B51A 3MTJA 1TQLA 1AXQA 3I5BA 4DR7J 5U47A 3KJVA 1X2KA 4J5YA 4OYOA 2ZKTA 1YHQA 2OPRB 4LIWA 2V8KA 3LH5A 1S1WA 3W64A 2PNIA 1ZBTA 3CO9A 5KFGA 4X4OA 1VQ9Q 5GAEI 2M52A 3Q8QB 3D6FB 3Q8SB 3GYXB 1YJNA 2CQHA 4PWWA 1RT5B 3BR9A 5CHCB 2MLXA 4C92C 5HK4A 4X62J 3MHYA 4CO0A 3C14B 4D8DA 2RRAA 1YJ9S 2DXBA 2RA2A 3UE2A 3UN2A 2RHYA 3TUPA 2OI3A 4QIEA 1SHFA 4C3MA 3DMJA 5L9NA 3OYHA 3EG3A 2MKIA 5C6SA 1M1KC 4OZ3A 3CCMQ 4KR0B 4F7UE 2F4FA 1M3BA 4QKUA 4YTLA 1XQHA 4IRKA 5ADZA 1OS5A 3A3OB 5G0RA 3U23A 4DR5F 4ELTA 3AODA 1LJOA 1H641 2J76E 4NI2B 4FYWB 4MKVA 2IVYA 2BKOA 3CIMA 3EZUA 4DLEA 2OJ3A 4EPCA 3LH2S 4ZVEA 5LJ5d 1LWEB 4DSLA 2EQMA 3FEOA 2Q6CA 3MM8A 3MEUA 1O8BA 2W7AA 1N56A 5LMNF 5KFZA 2ZHAA 2J06A 3HVTA 1VQ5S 3JCMP 1VQ4A 1IVZA 2HNIA 2HAXA 5I21A 2I2LA 1YJNQ 4B3MF 2AZSA 3R2CJ 5IQ6A 2DJWA 2OD6A 4OI3A 2JEIA 2A3LA 3CCST 4LFAJ 2AZ1A 2COWA 2Q1LA 2W25A 2KT8A 3CDEA 2X3XD 1UCNA 4PXEA 1T8EA 2FTRA 4A8FA 3TUIC 1QLYA 2FRYA 2KXFA 4K4YA 2L8DA 4CLPA 3N6LA 4K50A 4W92B 2J0SD 1I07A 2RQKA 5GMKh 3LW5C 2UUCF 2H9ZA 1G8XA 3L2VA 1I81A 3MR3A 2K3YA 1EIYB 5CZXA 3T19A 2ADCA 4RKUC 4OYWA 3NGUA 2UVRA 4Z89A 3BQ1A 3DNCA 3MEKA 2C2KB 1P27B 2I0XA 1TKZA 4MZTA 3NHNA 2G9OA 2CSQA 2DD5A 1REVA 2PT0A 5GMKm 2JXBA 5IS2A 2JS0A 1JNRB 4KO0B 1W2BP 4QU6A 1H73A 2C3UA 1VQ4Q 3TO8A 1K73R 1VHIA 3CCSA 1FYNA 1QLNA 3NNHA 2BXJA 2ZWOA 3RIRA 1U8RA 3B4DA 2K3XA 4I2QA 1WHMA 3OL6A 1N5VA 2DRKA 4EYHB 3QWXX 1VQPA 1JLQA 5CR2A 3B78A 3JCMh 2RHSB 3QSYB 2DHXA 1ZLMA 3J7ZT 4M7AD 4AQYJ 2XI9A 4LN2A 5ETPA 1Q86R 3MMAB 4LE9A 3CCQS 2WHOA 4WTYA 5D0RA 1SEMA 4KQZA 4WK1A 2ZM6F 3V7SA 4C6AA 2N82B 4PJOC 2JM8A 2YUNA 2HQXA 1VR6A 1BXNA 3I9ZA 4E98A 3EG1A 2O31A 2KRBA 3V7RA 2RD1A 3LAKA 3HRSA 1TUDA 2I5JB 1YGYA 3PJWA 2DPIA 1EHWA 3QYHB 1H8KA 4O5VA 1YRXA 1BGXT 3NWGA 2RMLA 2BQRA 4IR9A 5I2SA 1RTDA 2CP7A 4HKEA 1RTZA 1LWXA 2M2BA 4NYOA 4ECXA 1R89A 2HBPA 1SJQA 3MD1A 2FJXA 5KFNA 3IM8A 2HZCA 1VQ9S 1G5VA 2YWWA 5LJ3e 2HD0A 2P9GA 1X60A 2CP5A 4M7AB 2EFNA 3LA0A 1KIKA 5D0GA 4B9WA 1NXIA 1C1CB 3FK4A 2D1XA 2FO0A 2B8QA 3SSQA 2FYXA 4KFBB 2QLWA 5CA5A 1T9TA 3CC2T 1BQNA 4NLTA 3S6WA 3A3PB 2DIVA 2QL5B 4YHHF 2AZVA 4KGZB 1FDDA 2AKKA 6FD1A 2QIFA 4M4ZA 1Q86C 4IOAQ 1NDLA 3CCMS 4X64J 1UEKA 3OYJA 3R3TA 3M0UA 5GAN3 1ZUYA 5L8RC 2VG6A 1L3UA 2ZPHB 2WSEE 2BUDA 4M75C 4ENOA 2RQUA 1WC3A 4M94A 3JRZA 4I0WA 2HW3A 1J5OA 2FL7A 4ELZC 2XLKA 4ANDA 1LFWA 1NK8A 1YKWA 4DR3J 3UPUA 4OHYA 3G82B 1M1GA 2YWEA 1M30A 2DD4A 1JLCB 4QOTA 4YY3F 2A3JA 4M75G 5HY6A 1TG0A 2Z0WA 5D77A 3QDFA 1D0EA 1FJGF 5HI7A 3DRYA 3OLAA 3V6HA 3M1VB 3DGPB 2QFJA 3OYMA 1H92A 2HPUA 5FRNA 3T1AA 4PAAA 1PD1A 3POTA 1OYXA 5HP1A 2IBOA 1YJNS 2UXDF 3AJ1A 4R0JA 1T9VA 3AHUA 1PBUA 1RACB 2QQ9A 2GHPA 4W4MA 2KVQG 4RTWA 3EG9B 4BI4A 3IG1B 3TAMB 4ELYC 2DRAA 4DG1A 2ATLA 2EYZA 4AE5A 4Y3CA 2JEJA 3CMET 1WJ9A 3ZZ0A 4B3TJ 4I1TA 1FEHA 4M5HA 5KE3A 1M4ZA 2R7WA 4XTYA 2WK4A 1YI2T 4EWTA 1AYEA 5T7LB 1RUSA 2MPUA 5DG7A 2JLFA 4HXJA 4DEXA 4DL4A 1S59A 1QM9A 1SJ4P 3OXFA 2NWMA 2FVQA 3FCVA 2FHMA 4OMMA 1QUVA 3OYGA 3CF5Q 1N88A 2ACMA 3LAMA 2E5LF 3OT9A 1H7WA 2FLPA 1RWVB 1YRTA 4BC9A 4B6MA 1Q82U 4B3RJ 2R42A 4FXWA 4DFMA 2GW8A 2HURA 4ZPBA 5GAEU 2IVMA 4L73A 3Q8UA 4DEZA 2ZDPA 1N34J 3FC3A 2C2DA 1KVIA 5IOLA 4IG3B 1O51A 4LVNP 1DJ7B 1VA7A 2ZH2A 3ASKA 3EFOB 4IRDA 1Q8BA 2AZ3A 4LUBA 5HBMB 2EWNA 1U1NA 1MMDA 1VQ4S 3VR1A 3IA0A 3WVDB 2V8GA 5LM7E 3M6UA 1WWHA 1FFSB 1DJ0A 3CMEA 4PJOE 2VV5A 5E41A 5HJXA 1D3WA 3Q89A 4OV1A 2CKKA 2R7VA 4HL9A 2ZD1A 1YI2A 1VQ7T 1MG7A 4O3NA 4PRFA 3OS0A 2Z57B 4PJNA 4PUOB 3JYTB 2VKRA 2DNPA 4TKTA 3FQLA 3G4SA 1FKPB 4NLPA 1NM2A 2HNDB 1S0MA 3TYTA 3MDFA 4C0DC 1WEZA 4KT0E 3SB2A 3KG1A 2V2KA 2XTJP 1GQEA 3I9QA 2W2OP 1YP5A 2B4VA 4CH1A 4JJCA 2YH1A 1H6KX 1FXLA 4PPDA 3G8SA 5HAOA 4P7TA 2IBKA 1SKRA 1RCXB 2VFVA 2CQ1A 2K79A 1Q7YU 4M5GA 1HMVA 5LJ5e 5LSRA 5A2QE 1U1SA 3RJMB 2BZ8A 2BJ3A 3CJKB 1U47A 2CNOB 4LRBA 2HHHJ 5DQHA 2AYGA 4JRKA 1G2BA 5J2MB 2A08A 3MEVA 2E65A 3VYHB 3X3UA 1XNRJ 2ZHOA 2CNLB 2ZKUA 3CVKA 2CJXB 1VHFA 3GLJA 3KUFA 2XDBA 2IJRA 1U7LA 4FNIA 5LT5A 1TL1B 5KG6A 4N56A 5A8KB 3MR5A 2OPSA 4LNPA 2ASYA 2P4TA 2ZBPA 2QFIA 3R5JB 5D15A 1S1TB 1BYMA 1QWFA 3A13A 2V69A 4QR0A 3D5MA 4DOVA 4D3HA 2PA8D 1UP1A 2RH3A 3IR7B 4JV5J 1K44A 2VKNA 2HL5C 1JJHA 3TQEA 3ICLA 3T5LA 3G4SQ 4B3OA 3MUMP 2E66A 4ESRA 1FRXA 3LWHA 3J81Y 2F8MA 1IHWA 2RRNA 4M7DD 4B9TA 4X4NA 1WD6A 3K5NA 2GNKA 1C4AA 3JCMd 2R5AA 4DV6F 2V67A 3RKXA 4WE1A 4GVLA 2COYA 2HQFA 2E5HA 3MFIA 1PKSA 4Z7YA 2RF0A 3W2VB 5EX3A 5D6WA 1HR0J 3IWNC 4QT7A 3OSNA 1IKXA 2NYSA 5EG2A 3W60A 4BBYA 1WG5A 2KO1A 3RAQA 5E7OB 3J7Z5 2HMIA 2B8PA 2QLXA 2CADA 2DVEA 1UEBA 4KTQA 1TL7B 2W2QP 1DLOA 3GWCA 1SQGA 4QPXA 1EX8A 3Q8VA 4L5GA 3U02A 2JT4A 2XYGB 3C16B 1FWPA 1VQ6T 4Q0BA 3HHDA 4J9CA 2LQ5A 4TY9A 4M5KA 3JCMX 2FPDA 2Z58B 3C66A 3BW1A 3V8JA 2XSJB 3TAPA 2FLLA 4N8NA 4WZMA 4ETXA 4X66F 4M7DB 1D1UA 2J7KA 1SC1B 4XK8C 4ZCKA 4QQBA 2E5JA 1XMOF 4CLLA 1A9NB 2O2OA 4WFYA 3C4SA 1X6OA 1RA7A 1RHUB 1N32F 4M78G 1TUCA 2EKOA 3O5ZA 1RBAA 4A8SA 1S72A 1UTIA 4OL8A 1PRLC 5DDPC 3W65A 5DZ7A 1DTTA 3N79A 3NOGA 3ZTRA 2KZMA 2QXFA 3V4MA 5HSPA 3UN3A 5IM0A 1M90U 2YVSA 2DXFA 3PNWC 2YLCA 2LQWA 2J0XA 1R43A 3KK1B 3KDNA 2RNEA 2VQFJ 2BJ8A 5D4PA 2B4OA 4MZMA 1B7YB 3G2XA 5JXSA 1NK6A 2HIQA 4OMPA 4NEYA 3FRNA 1UVIA 4L75A 3META 1RHMB 4CO5A 2F2VA 3U27A 1WC6A 3SQGA 4URSA 4PQUB 5IWAJ 5H9FK 2HQHA 2HNYB 1LFPA 2BANA 2DHAA 3QQCD 4UQTA 1HQEA 2AJ4A 1URNA 1LWCB 1QD1A 1G83A 1XEZA 3JSRA 1TU0B 3T1YJ 1IBKF 2P0QA 4LR9A 1VI7A 3CJRA 4HT9A 2MOXA 1JKHB 4F02A 1PG5B 2HFSA 2D0QB 3A4TA 2WCXA 3CQTA 4C8QA 2X3DA 5J2PB 2V4QA 1RYSA 2RAQA 2BRLA 2EJGA 1TKXB 2MTLA 2DXTA 2FLNA 4N0AA 1ZZFA 2DXEA 2RU9A 1ABQA 4IG0B 4RNFA 2FUG9 3M6WA 5KFLA 3KTQA 2KN4A 1X9WA 3KDOA 4ZGEB 1CULA 2E9RX 3ZZZA 2XZTB 4JBCA 3HKZD 3T6BA 4DI6A 1FMWA 1Z9QA 2OMOA 1WPYA 1YITQ 5IT4A 2QL9B 1UFKA 2RS2A 2V8JA 1UAWA 2OKQA 3OYEA 3A8HB 3CC4T 4IUFA 3IC1A 1B3TA 2MB0B 4JP8A 2ZJRQ 1X75C 2MSSA 5GAN8 4C8OA 2E9TA 3EGVA 1B7FA 1JLEB 1NKBA 3UFCX 3CUNA 4B9LA 3PDNA 3O2IA 2UUBJ 3ZNJ1 1GRIA 3MPVA 4K4WA 1C1BB 2ROEA 1WHYA 5F8JA 1VQNT 3IAM9 1UA1A 2W2NP 3JTOA 3WDOA 3LP1B 4MK8A 3MAAB 4Y28C 2ZVIA 2PMHA 4M7AF 3OTBA 1DTQA 1FK9A 2HHQA 3PV8A 5CQXA 1ZHIA 3G4SS 1MGQA 1L3TA 4U67Q 4OX9J 3CCVT 2BKPA 1TK8A 5BR8J 1H38A 4U95A 2C3YA 3GPLA 4C9DA 1VYTA 1UW4A 2JVRA 3LP0B 1T9YA 4Y2KA 1Y0MA 3MP1A 1X7VA 4JI7F 2UXBJ 2DLPA 3OSVA 5GAMj 5KYXA 4A54A 2Q66A 3GJTB 4I6WA 3CCZA 2ACYA 3VS7A 3VRYA 2DYAA 7FDRA 5DM6Q 4M5MA 4I6YA 5DS7A 4JJNK 2PU9B 4KC5A 3HSDA 3HRTA 2CPXA 3PYGA 1MUZA 1XQIA 3PT9A 4DS5A 3PHEA 1CKAA 2CQ3A 1PSDA 2J6KA 5C42B 4MDWA 1VQNA 3VAIA 4A0UA 3ZNUA 1D3BB 3F44A 3NL0A 1HNIA 3BGRB 2UU9F 1IO6A 4O3OA 4GKKJ 4FF4A 3OA6A 3A1YG 4ZJQA 4N76A 2VXEA 4RW8A 5J39A 2F5TX 2WVCA 2WVFA 4ZNXA 2MQNA 3H0HA 3QPHA 3MUVP 5HLFB 4MFBA 2ZBQA 3CCJQ 2DR8A 4DSIA 1TFWA 2BW7A 1REGX 3KK2B 2KRNA 2YDLA 3HZEA 5K8MA 3D3BJ 2QRRA 4H54A 2Y3YA 3CBPA 4FYYB 4JI1F 4QIVA 1H2VZ 4LF4J 4DBRA 2BV3A 4A47A 3GF5A 3C6UB 1EETA 5KT7A 2H4WB 5IHIA 4RG8A 3W2WA 1FKOA 1RT4A 4KIAA 2ZH6A 4KPYA 4IO1A 2XC9A 2PVOB 1RAAB 1PKTA 4OB1B 3C12A 2DO3A 2HLTA 3NGRA 2CPFA 3LUYA 1T03B 4PFPA 1EB0A 2LLZA 2CG4A 2BKNA 3DYAA 5IN1A 1KRPA 5HJYA 1HWUA 1AUDA 4WP3A 1FFGB 4RW7B 4FIBA 3C2PA 5CKHA 3N4WA 4ECZA 2E64A 5LOQA 3P8BB 4HCBA 3EE3A 2CH4A 2DZ9A 4PZVA 1QKXA 2HBRB 2COZA 4EBCA 3R6NA 5DO2A 1G3WA 1UW9A 4LF9J 2RD5C 2XB2D 2XG8D 3A8OB 5L46A 4ZHRA 3IGNA 4DL7A 1JXVA 2XKOC 2E5IA 5ETOA 4U7UK 3B4MA 5IXBA 1FVSA 2KAFA 2E1MC 1S6OA 1RSCA 4CT9A 2IA0A 3UATA 3H9NA 3KHLA 4H4MA 1NNDA 2VVKA 2EFQA 1FFWB 1QSLA 2DF6A 2QTVA 1VQOA 1S6PB 2MQLA 2AK5A 2DEIA 2E29A 2EIFA 2R2SA 5I42B 5CK9A 1X5SA 4J9KA 3S01A 3OYBA 5A0GA 1Y7PA 1NG2A 1WFWA 1YITS 1T11A 1AZGB 1C4CA 4CO1A 2DO0A 2IY5B 4ZKAA 2VC1A 3A8IA 5D78A 3MEGA 3C0CA 4HCZA 2ZBIA 4X4VA 2BJEA 2RI5A 1HBUB 2BZ2A 4CT8A 3THVA 1ZPVA 2NQPA 4E7LA 4M5JA 3U1NA 4EGLA 4IYQA 2X1FA 2VPYB 3OQ5A 2QASA 1VJWA 1RLCL 3RRHA 5A2QY 3QLHA 5GAOn 4Y28E 2HSPA 1S9GB 5HQLA 1KTQA 1X4BA 2W01A 1HA1A 2GGRA 4QVCA 2OEMA 3H0IA 5FU6C 4B9MA 3I56A 5M2UA 2PD1A 3DRSB 4HKQA 1KHIA 4DSFA 3S8SA 2PEBA 1CJKA 4EYIB 3SHWA 3UCUP 2FZGB 5C24B 1K1SA 2FVPA 4J9HA 1N6AA 2D9TA 5GAMh 4DR7F 2WONB 2EFGA 2A6OA 2EFPA 4LSNB 1S0NA 5CYMB 3PR5B 3E9FA 3KLGB 1VQOQ 3RNJA 4JZ4A 2DL4A 1W1FA 5DZ6A 3KLVA 2KB2A 3CJ8A 3RR8A 4F4YA 2FY1A 1KQGB 3NY0A 4QQGA 2YRCA 3HVRA 4Q44A 3EWGA 5KFRA 2O01E 4ID5A 3N0VA 1QVGA 1Y57A 1NJIC 4VUBA 3MD3A 1U1KA 1M1FA 5M2PA 3TVTA 2B43A 3DDNA 3VV2B 3X24B 4N0AC 3OXLA 3FZBA 2G13A 1U1PA 1UGVA 4QVZA 1HBOA 1T9XA 3QO9A 4K4TA 4FBTA 3D2WA 4F2RA 5HK3A 2YRDA 5J2QB 4O0IA 4J9UE 5GAOq 2F7VA 1T0JA 1FNXH 3I56Q 2OAUA 3OY9A 1PRMC 1VC5A 3MM6A 4HT7A 3MMCB 3M2RB 1JX4A 2FC9A 4JRIA 4DR1J 2V4JB 3NMAA 1W2IA 3CCUA 1IGQA 4MJKA 4WBFA 3CCJS 1GAOA 5DDRC 5E3CA 4OBIA 4YN3B 1ZZNA 3ULRB 1CC8A 1PC4A 2DGUA 4MIBA 4J9IA 2RI2A 4M7DF 1P9QC 4RTYA 4A53A 5FU7B 4ZMMA 2L9DA 3NKYA 3CJ0A 2EBPA 3QUIA 3D3CJ 2GVZB 2XQCA 4CLZA 2GVDB 3T3FA 1G2EA 5DLQE 1WG1A 2OTLA 5IC6B 2R7RA 2KL8A 3BN7A 1IBMJ 4LFAF 1R0AB 2MY7A 1N4LA 3HM9A 1OU8A 1KD1U 2YNGB 4BUGA 1GX5A 1BUXA 1YJWA 1DHMA 4O3QA 1IJFB 4EUVA 3IBFB 1UUEA 3UW1A 1T9UA 2CJQA 4YB7A 3PMIA 3MURP 4DWIA 4RCBA 4C4WA 1YK9A 1RTHA 3GIJA 4ED3A 1UPMB 4NZ6A 2W24A 4I6AA 5L1KA 2X4YA 4YR3A 4PLIA 1X6BA 2HFNA 1I0CA 4EZ9A 3QIDA 3RZAA 3CCUQ 2EQIA 2DK3A 2O1PA 1U0HB 2I6WA 2YWHA 1BQMA 4DHVA 1F60B 1ZX6A 3CO0P 2KROA 4AFFA 1NK0A 3FIFA 1Q8LA 3NGDA 4ED8A 5CKEA 2E9ZA 2EAYA 4J6YA 2W9AA 2AJQA 1SL2A 4IIOA 2AU0A 3DLEB 4J9VA 1AFIA 2HHSA 2KT1A 1RI9A 1TK0A 4J91A 4WCEQ 3G6ET 4O44A 1OSCA 2DETA 4KY3A 4NCGA 1N8RT 4XO0A 4AYBD 3SI8A 3UVJB 2OTLQ 1Q53A 4MH8A 2E5QA 2DHSA 1Y3JA 5KFFA 2HBZB 3M8RA 4YS2A 1WHWA 1YJWQ 3R1HA 2DILA 1MHNA 4AQYF 2VWFA 2Q43A 4O4RA 2RN8A 2BW2A 5A76A 2AX1A 2B0GA 4HCCA 2LMIA 2NUTB 4CC4B 3DU6A 1N54B 4F17A 2M70A 2RM4A 2RMOA 3UWNA 3G8TA 3KUEA 1EQ0A 3SV4A 1U45A 3VS5A 2YH0A 4AXIA 1F5CA 4R56A 2L9NA 4C92B 2HVDA 3W8PA 4CM2A 2FJEB 1W2BR 5A2QU 3SCJE 1W7WA 4ZK7M 5KT5A 3H98A 4FN5A 5EDWA 1K73U 1BI2A 1TR0A 2Y8YA 2ESWA 3QT7A 4OMFG 3BFMA 2BQUA 4C8QE 4IFVA 1VQOS 3IWLA 1VQMA 2C2RA 1FMKA 3LANA 3CJSA 1FRMA 1RA6A 3WQPA 3DC2A 1M9SA 5D6YA 1RT2B 2K5FA 2FJAB 3OJSA 3AB4B 1VQ8T 2PN6A 4A63B 3ME9A 3JQMA 1NUEA 3I5RA 1NDKA 1UKUA 1Q86U 2JHEA 5I3PA 1SB6A 2MKYA 5FWCA 5D4OA 4WF2A 3G87A 2FPEA 5A8RA 1R6YA 1WDTA 1UVMA 2RQVA 2WACA 3BKTA 3M8ZA 4EO8A 1WTBA 2G4BA 4MKAA 1D9DA 2FHJD 2LA6A 2VKZG 5GANj 2W9CB 4D6WA 3KJNB 2K2MA 2FLOA 3BGUA 1OEBA 2DM1A 2D9PA 3KUGA 4TY8A 2J6UA 5AE2A 1S6QB 1Q1KA 3CE8A 4FKXA 4X4RA 3VS2A 3EG0A 5B0DA 3I9V9 3KFVA 3QHSA 1Z4UA 4J83A 5C5JA 2FVSA 1QVGR 2F8EX 3I56S 1T7PA 3H7HB 3FSYA 1ZYQA 2VU5A 3NTKA 2CQPA 2KT2A 1OIAA 3MR2A 4PNOA 3HZGA 4RCCA 3RESA 3JAMY 3PTAA 1RI0A 1V3ZA 4HVVA 3GYGA 1LNQA 2WOMB 3I6PA 2JC0A 1VDHA 3Q2TC 3L7OA 2JEFA 3QJJA 1NHVA 2PE8A 2VOPA 2KSSA 2LDMA 2DA9A 2GQCA 2OLWA 4J9LA 3M30A 2OELA 3UDVA 4NXMJ 2IC3A 1P92A 1CJTB 2H8HA 1F2GA 3ZTSA 3MEDB 1VQMQ 4BI8B 1GMWA 3IMQJ 3CGIA 4OF1A 1KC8R 2NS1B 1BI1A 2AJFE 2QSWA 2DNUA 2CQIA 4ILMA 3JXOA 2FIUA 3INZA 3O8WA 2ZPFB 2W4CA 4RBUA 2X51A 1GFDA 5KYNA 3SWNC 3WC2A 1NRKA 4Y34A 1H3ZA 3GIIA 2RUGA 3P96A 2EQUA 4CO3A 2VICA 1HWLA 2E6NA 3MM9A 4NYPA 3RB6A 2DYIA 2R3VA 3NGTA 3VUZA 3W9IA 3O3LA 4B3TF 1R31A 4W98A 1PJ7A 5CYJA 4ZCMA 3PG9A 1R7IA 3ZTOA 4OHXA 4D8KA 4CI0C 3FRZA 3G71Q 4DQSA 1JLBB 3HFKA 2MQOA 4ORZA 2RE1A 5J26A 5K14B 2DNQA 1U3OA 3M0SA 1YTYA 4RX6A 1OY9A 4KKOB 4QVDA 3CCUS 1E6YB 5B0CA 3T1HJ 2DGTA 2HNZB 3THTA 2IMWP 4B3RF 3QDRB 2XLIA 1OQ3A 5KG0A 1N34F 5DGBA 4NOYA 1KWMA 2YNHB 4GBQA 2KXHA 2ZJQQ 1UPPA 4RPFA 2V34A 1IN0A 5AXNA 2V68A 4A8WA 1KC8C 1BIAA 2QJ3A 2CQ4A 3QPIA 1RKIA 3FFIB 4F2SA 1QVFP 2OTLS 4XTXA 3PKMA 3RR7A 1U1QA 4RUGA 2C2OB 5B0BA 1ZTTA 1YJWS 3MO8A 4L72B 2HWHA 1SVDA 2JN0A 1BB9A 1VK3A 2A28A 1BWEA 2CYYA 4UC4A 4M75D 3I0SB 1Q79A 2VIHA 1N36J 1S0OA 3A8EA 2UVWA 2EC2A 8AT1B 5M9OA 4NCAA 2PI4A 1U09A 3I0RA 1WHJA 5H9EK 5KE2A 4O4GA 1HYSA 2KRSA 2JZ2A 4CH7A 1I5LA 3BV8A 9RUBA 3OYLA 3IR5B 1URRA 1PAUB 2BJ7A 5GMKa 3N5FA 4EDUA 3CJ5A 4OMOA 2QGGA 2QG9B 5A6WA 2HHHF 1UZHA 4GO7X 1UVLA 2PVGB 5KFKA 2Z2MA 4WU3A 5KFOA 2R8HA 2ATCB 1TVRB 1LWFA 2EYXA 1XNRF 4XPEA 3A8JA 2LNHB 5KOXA 3U7JA 5GANh 3JB9H 3G1JA 2HQEA 2M8HA 5JMNA 1SV5B 1A0NB 1HXDA 3UA6A 2EFOA 2OTJT 2ZPEB 1G4CA 3JSMB 4EFAC 4M75B 1FX7A 3HHTB 3KK3A 3EICA 2HEKA 4P71A 3HHKA 5EWFA 1RB0A 1B0PA 2DVJA 2B6AA 1NSAA 2A10A 4U9RA 4JV5F 3RG6A 4WKRA 2FPFA 5KYWA 1NEBA 2XY6A 1VRTA 3TVYA 1AZEA 3QRPA 2K57A 3CCRQ 1TUGB 3HD2A 3TR5A 2B5JA 3Q23A 1CJVA 1T0TV 4OHZA 3TVZA 1S49A 3M9NB 2UZAA 4QYZK 1HR0F 2AKWB 2AT1B 2DE0X 2F1FA 2QTWA 1Q0NA 2RHXA 3DHXA 3MEWA 4UOGA 4PKDB 3VQSA 4QR2A 2Z2LA 1WI8A 3C8YA 3KJVB 2J7IA 1X9MA 3MEEA 1QCNA 3EPIA 1S1WB 3CCLA 1VQMS 2BIVA 2B9EA 2OTJA 4ED4A 4KGVB 4ED2A 2AIRB 4AFSC 1F3VA 3FJ2A 1VQLT 1T02A 2K3KA 1EIFA 3HHLD 4X65J 1HSQA 4R8UA 2E1AA 1Y5IB 2N7CA 1WORA 1RK8A 2ROLA 1QY7A 3TX8A 1NSQA 2KBTA 3VGUA 1RCOB 2MMYA 2YKNA 2WB1D 2X35A 2DCLA 2JMAA 3K8VA 1HPZA 1XWLA 3HMJG 3DMJB 1VOMA 2K06A 3JB9I 4HR2A 1JJ2A 3MHXA 4M77G 3H41A 3FCHA 4KHRA 2CJKA 4EMDA 3G71S 4Z7CA 1NSPA 3NMRA 2FQQB 3M2VA 4HH0A 4C3LA 5LJ3j 2KY9A 1KHVA 4IH7A 2UP1A 5C2CA 2MZQA 1K4US 5G0RB 5IAYA 3I55A 4ZPWR 4QWCA 1JLAA 2VQFF 4RW6A 2JFDA 1QP2A 5E2QA 3BB5A 1FX2A 3E2UA 1U2RA 3WX8A 2A0FB 2XS2A 5IXFA 2B9XA 2OEJA 4DN9A 3O1LA 3HHLB 2DISA 2WW8A 4WKYA 2LDYA 3MM8B 5CYQB 3CJ2A 4PWUA 4LUEA 5E33A 3TQ7P 1EP4B 5IWAF 2RF2A 1VQLA 4DPWA 4C97A 3CCLQ 3LPYA 2V8HA 3HSBA 2M9KA 1L3KA 4RG2A 1TFYA 2OPRA 4KPCA 3M9MB 4B17A 1M8MA 1X4EA 1T94A 2PVDB 3T1YF 1FT8A 2RJCA 2G0IA 3PEJA 4L6V3 5GAOm 2CZ4A 5I11A 2F63A 3VF0B 4ANEA 4P74A 4MYUA 5B0GA 2M1HA 2JDJA 3AA8A 1MNEA 1WG4A 5KFJA 4XU3A 1V5VA 4DUZJ 3DKMA 3EFSA 3UR3C 1JQGA 2HAIA 2MQPA 1MV3A 3M59A 1EFNA 4LFCJ 2YRVA 4XU0A 3CULA 2RJFA 2DZCA 4G1QB 4DCJB 4AFZC 3TZWA 1SKUB 4M7DG 2IG0A 4M78E 2YPZA 2Y4YA 3I55Q 3LGFA 1WXUA 1D09B 3PKYA 4RZRA 2MYFA 1NPKA 1KFZA 3JB9J 4A0TA 3DXBA 2N3LA 3M56A 2ZBRA 3EGDB 3R7BB 2E1PA 2DR7A 2BJDA 5DGAA 3EGUA 1REVB 3C15A 1WI7A 1Q82C 3TSWA 3H40A 3RBZA 4NI2A 4C92F 3NRBA 4YR2A 2YKQA 2KI7A 1CS4A 1SPKA 2RHQB 2B7CB 4FYDA 1SG5A 1LWEA 2UUBF 3OW2P 3FQKA 1H2UX 4L59A 4MIAA 3S3OA 2YUPA 2QAZA 3H5SA 2W10A 4I2QB 3K0JA 5CAAA 1S1NA 2JVVA 3PFEA 4LF6J 2DX1A 3BE3A 1JLQB 3Q0AA 2JTFA 2HZAA 2A2CA 2L2PA 2CAJA 4ZLJA 5KG3A 4FW2A 2UV8G 3SV3A 4NZ0A 4OX9F 5BR8F 1FXRA 3CCRS 1VYUA 3N01A 3BKFA 1BCOA 5D3GB 2XIDA 2SXLA 2UXBF 2P9CA 4NLYA 2CUDA 2F65A 2J8AA 1WJRA 1FJCA 3PW0A 1NDPA 3CXCA 1K8AR 2O67A 5HROA 4ECUA 1VLOA 1U8WA 4DV0J 1Q7YC 2H1YA 1RTDB 1MN7A 2RK1A 4XTTA 2VH7A 2PSZA 4M5NA 4WWSA 3IP0A 2AEFA 1GX6A 4OJ1A 2LT4A 4OJHA 2AQ4A 3WIVA 4WFZA 2IIMA 5D4NA 3OXGA 2IHR1 1SKWA 4GKKF 2HGLA 3EZ5A 4KO0A 2LJ3A 2AYBA 2QYZA 3JQJA 2XDPA 4PEOA 2D8HA 4KUIA 4DU8A 1U1TA 4JS5A 2NUHA 5E3PA 5LJ3h 5LJ5j 5I2MA 4X4PA 1T3NA 1BQNB 4U6PA 1EKRA 1MN9A 1KHCA 3OTDA 3CCTA 4LF4F 4XDDA 2GQ2A 4URQU 4RNNA 2C22A 3GSDA 3FBEA 5CVIA 1FRLA 1TMJA 1QKWA 3MMAA 2VG6B 4ID8A 4NOHA 5SUHA 1YJRA 5CZVA 5DM7Q 4B08A 1XK8A 4P52A 3MMBA 3VV0A 1DRZA 1KNZA 2EQJA 4Y0FA 1I1GA 3THKA 2AP6A 4AG1C 3FGVA 4CDIA 2CZ9A 5IT9E 2ABLA 1JJ2R 1VIFA 3OTEA 1K8AC 2I5JA 2Z56B 2GV1A 3NS5A 3L4BC 2GO8A 2LVWA 4YMEA 3JCMc 2MSTA 3UQSA 4HDHA 1GTEA 2YNFA 3CCLS 2ZCFB 4LF9F 4A4KA 3EJMA 3POTB 2KEAA 1FTRA 4H4KA 3RBEA 2QMXA 1D1AA 3IWXA 3H4BA 2R5MA 4QQDA 2O88A 2KT5A 4M7AA 1PILA 4YQWA 2ZGWA 4LR7A 1C1CA 5KT4A 4ZVRB 1N6QA 2GJIA 3K57A 3CDBA 4KFBA 2GAHC 1NHUA 3IO1A 4P72A 4DL6A 2HEQA 1JJ2S 2AV5A 4BS2A 5D4LA 2CP6A 3DOMB 1UECA 3CC7T 2M5YA 4QIGA 3M0RA 1MROB 1FF2A 3PW7A 5HO4A 2BACA 1EQMA 1WSRA 3K58A 3OW2S 3AJ2A 4K59A 1HWIA 4PYDA 3UDEA 3I55S 4S0MA 2KTQA 5E3QA 2V2VA 1VQKA 1IBCB 2J6TA 3PO5A 1U8SA 3SDEB 3BO4A 2YLBA 3W61A 2ASDA 2IIHA 1X4GA 2B4UA 1L3VA 1X8DA 3G82A 4URGA 3CDWA 4B3SJ 5BJRA 4F4WA 1JLCA 4CLTA 3F56A 2O4XB 4Z02A 1WYXA 1KQ1A 1B34A 3BM7A 4NRTA 3W62A 4F16A 3L2UA 2CQBA 3NGSA 3E8OA 1N27A 3N5BA 5GVQA 3ZZTA 2KNBB 1SHGA 3PEHA 3OR2A 1WXTA 3HT3A 2C42A 4F0HA 3GJQB 1AT1B 1NYFA 2HK3A 2YQ1A 1GXLA 4TXSA 5KG2A 4ZVOB 4CNZA 2RB7A 3AT1B 1ZM4A 4H4OA 5D7UA 6FDRA 2RHUA 2PUOB 4M75F 3P8HA 4USMA 5F8NA 3TAMA 2YTCA 1PSEA 2LFVA 3HFNA 3EGXB 4IQMA 1KQFB 4J9NA 2HVEA 3SZ2A 4K4SA 4Y6IA 1CKBA 4YB1P 2VA3A 1U1MA 4HVUA 4OQJA 2QZ8A 5GAMf 2XMUA 5T7LA 3V4IA 2MPXC 1KQSA 3QT5A 3D0IE 3S7RA 3UPFA 2JH3A 3GIMA 3SEOA 1ULRA 4OB2B 2QA4Q 3M53A 1QE1A 5HVGA 3DDKA 4KGKA 3KLEA 1VQKQ 2ADBA 4F7VA 3FDSA 5EUHA 3PRVA 4Y2AA 4FDFA 3R5CA 2CJBA 3I4PA 3EXYA 3L1AA 1JU5C 2IRYA 1MSWD 5LJ5h 2F5GA 2GFAA 3MR6A 1O9SA 4E6RA 2POKA 2ZH4A 2X4XA 2DTHA 1PNJA 1NJZA 3ER0A 2LJ1A 8RUCA 3R6OA 5KFDA 2OPSB 5HMXA 4BY6C 2HBWA 5IV3A 2DNLA 5HBMA 2LDIA 4DR1F 2FGOA 3OFFA 1UEVA 2YNIA 4MMLA 1RT7B 4QIWD 3QGPA 2WSCC 3K8WA 1ZETA 3F70A 1DFDA 4PWDA 4B3OB 2ZWPA 3GP9A 1HNVA 3UR0A 2L89A 4PUOA 2ZPIB 5KT6A 1T05B 3QZ7A 4ZPDA 4WE1B 2QEXT 4UQGA 3DHWC 3VZHA 4MKYA 2B86A 4RUHA 1KG1A 1IR1A 1WF0A 2VBXA 2CT4A 1IBMF 4AL7A 2KG1A 1IKXB 3VAGA 3BDEA 3QGHA 5DETA 3CXCS 3CD0A 1Y9OA 2NXCA 2ZEJA 1BY9A 3HKWA 1NEEA 5HCKA 5CO7A 3LF0A 5K9FA 4ECQA 2RHIA 1DLOB 4DPOA 1VIOA 1WQ7A 3CJKA 4KGXB 2LP4A 1Q5VA 3EH2A 3NTHA 3G71T 1XNQJ 2AEJA 1YQHA 4LF2A 1IKVA 1HFEL 2HHUA 1U1RA 1I4K1 4AUKA 1WF2A 1BHNA 5GAHU 1UJ5A 4OZ1A 3LWLA 1D9FA 1X5OA 1XTDA 1TL1A 1QTNB 2AHJB 1UFWA 5A8KA 1OX9A 4ILRA 1GFWB 4GLMA 4ECWA 1ARKA 4JI2J 4CIOA 1XMBA 3GE9A 2DGOA 2PDAA 4F7UG 1S1TA 2LP5A 1KSPA 3QG1A 2YQ3A 2ZZNA 2R7QA 2VDIA 5FD1A 4PJJA 2CQDA 5CABA 3PW4A 5F3ZA 2WVEA 2HQGA 5IM0B 1N33J 2DR5A 2F1LA 1DQAA 1HNWJ 3WHIA 5FU6B 2CDTA 1V3SA 3JTNA 3BO2A 2LXUA 3UWTA 3WX4A 4KH1B 1X0FA 3W2VA 3GV7B 3R1LA 2CPIA 1UEUA 3Q1JA 1MU2A 2VFRA 4DFJA 1S7IA 4PXCA 3RAMA 4J9PA 3SQGB 4PLLA 5CCLA 4OYAA 1G3SA 3IN5A 2V8IA 4ZGDB 4F36A 5D8HB 2BANB 1TL7A 2HYIB 3TWZA 3UNYA 2DAQA 2FZCB 3LLRA 1HQEB 4ED6A 3C16A 1IXKA 2GQIA 3HVAA 2DBKA 1HW9A 5IH2A 1FJ7A 4D3GA 4USHA 2FYKA 1RAHB 2G0JA 1VYAA 3IFEA 2M4MA 1WLPB 2QT7A 1LOJA 1DQ8A 1G1XA 3QZ5B 4PR6A 2X1BA 3W1YC 2HHWA 1WJSA 3OL9A 1ZM9A 1Y7XA 4C0OC 3HXMA 4CC3A 1OZ3A 3OUYA 3ZZPA 2LU1A 1YZ6A 2LCLA 1NK9A 4AT1B 2A1BA 4H4KC 1K1ZA 1SCJB 4HACA 3CCET 5KG4A 2HVZA 3DRRA 4K11A 3OL7A 4JI5J 3MI7X 4LDUA 4M7AC 1IKWB 3JTPA 1IWAA 2QA4S 1VQKS 4WF9Q 2MLYA 3PVQA 4JLIA 3HKSA 2KYMA 2ROGA 1S99A 2LEAA 2E7VA 3OTOJ 1ZUUA 3DLJA 2M3DA 1M27C 1RT1A 3FB9A 1I8FA 1KQSR 2WSCE 4RO0A 2ASJA 4F3OA 4KE5A 1RWPB 1YWXA 1N9SA 2BBEA 1UFFA 4N4IA 4J90A 3GCXP 4FT2A 4PQUA 3JS9A 4IQXA 2OJ2A 2F9DA 5KFWA 1U25A 1AZSB 3BYRA 3FBBA 3SFGA 3M4GA 3OVSA 2EKNA 1LWCA 3NTIA 2DJZA 1DTQB 1FK9B 1NLPC 3NOCA 1JKHA 1VRUB 1E6VB 2ZBCA 4KV8A 4NXMF 2FHDA 1RWWB 2QA4G 3GFXA 2QV6A 3HRUA 3P3DA 3D66A 2RQCA 2CFXA 5J2PA 3MOZA 3L2RA 5A8WA 2R2RA 1TKXA 1UL3A 2M7SA 4FU6A 4G6VB 1XR6A 2QA2A 1XC9A 3J81E 1KQSS 4KH0B 5KYXB 1TK5A 2PZ1A 2IYGA 2EI5A 3TANA 4QZVB 4C92G 3KYLA 2HQDA 3R5DA 3JSBA 4O6JA 4FM4B 5KYYA 3DLKB 1NLKL 2E1RA 1KD1R 3R7SB 2RH2A 4Q2LA 2R4FA 2DNKA 5CKFA 2M0GB 4TVRA 4ZPCA 3TA2A 3A8GB 2W8LA 5IT9Y 3T5HA 2UUAJ 3VZIA 4C3KA 2CQ2A 4AMCA 1JLEA 3AD8C 4CTAB 2LXIA 1OYEA 4HHHA 4UT4A 3KNGA 3TW0A 4ZVSB 2K2VA 1SJRA 2K8GA 4MFBB 1C1BA 2VA2A 2WSEC 1YHQQ 2WVDA 1YCYA 3T1HF 1YBTA 4GC7A 1RABB 3P8DA 4ZP8A 5J3BA 3THPA 1KC8U 1M5PC 1I94J 5DG9A 1RWXB 4AFQC 1Q81T 3LP1A 4DX7A 3H4DA 1G7CB 3BSOA 2L3MA 1R8CA 4DX6A 1EETB 1NJWA 4NA3A 2HKQB 2JFKA 3W2WB 1FKOB 1NAQA 4DPTA 4C8KA 2CNNB 3MR7A 4CLYA 1S12A 5KFHA 5D6GA 2LJ0A 2XS5A 3MOJB 4N8OA 5SZTA 2MZRA 4ZCIA 3MJXA 2ED1A 4FP9A 4FF3A 1TL4A 3K5LA 3M55A 2UVVA 4OMFB 2LQ9A 2NREA 2OPQB 4Q7AA 2RT3A 4R5PA 2DGWA 3DYAB 2HGNA 4U96A 4BE0A 3RU0A 2BE7D 4OYMA 2GCXA 3PZPA 2PA3A 2G1HA 4JI4J 1KD1C 3L95X 1PKUA 1S1UA 2IM3A 4IFYB 3UDCA 4CLSA 1N36F 1CLFA 1F9HA 1C0TA 1VIXA 2DXCA 1KHWA 3HF5A 2XHWA 2ABYA 1KEKA 1WDDA 2NUPA 4F67A 2BJ1A 1Y96A 1OOTA 3MCMA 3PIPA 1M5OC 5C42A 3H2UB 3N6NA 2DNHA 4J9OA 3VGTA 2O66A 2H54B 1S4EA 5GAN5 2KRRA 3HLUA 1BE4A 4F8RA 1ZQ1A 4H4MB 4ECRA 2LQNA 3DDIA 1YRUA 4KHPJ 3EUNA 4M7AE 1N5YB 5GJVB 3GJSB 2ENMA 1CSKA 2H48B 4C5HA 1HBMA 4LJMA 1WHVA 3RGIA 1QVFR 2YXYA 1GXIE 2AGPA 3W9JA 1WACA 1H98A 4RNHA 1UZDA 3C6UA 4R25A 4GLKA 3I82A 5IXUA 1OX8A 2UXCJ 2DTOA 2DY1A 2FVCA 5F8IA 3OBYA 3MEGB 4IDKB 1MMGA 5C7PA 1X01A 2BJ9A 5GANf 3CD6T 3WXMB 3PIOA 5I4MA 4NXNJ 1RJJA 2RQMA 1T03A 3CNQP 2RRBA 3LPEA 5F9LA 4FXVA 3M9QA 5KFCA 2LXFA 4JI8J 3M6XA 1K0SA 4RW7A 3CB4A 1JLGB 2I0NA 2EFIA 1FRJA 4PJOG 4F0MA 1FDNA 4PXBA 1X5PA 2DIUA 3PJ9A 4YFUA 1V5IB 4KT0C 3PIPQ 2VB6A 2PC6A 4LBIA 3M57A 4LXCA 2BMBA 3JCMV 3TJAA 3L2WA 1J27A 3A1PA 1CJKB 2L08A 4OZ2A 3I4HX 3SWNB 2XMKA 4DSKA 1FRKA 4WK3A 4KHMA 1S5ZA 3RYLA 1JB0E 5IQQA 1M0SA 1R8BA 2AMCB 4LD9K 1FD2A 2ZOGA 3QJLA 3CCSQ 1N52B 4ZJOA 5GADU 1K73C 4NA2A 2VXFA 1LK7A 2E3IA 1Z1ZA 2QK0A 2I8EA 5A0YB 4ZVGA 4C8MA 4C8LA 1ZM3A 4NEZA 1S6PA 5L38A 1Q95G 1CSJA 5CKBA 1S57A 1VQPQ 5HATA 1R27B 3GU0A 4X65F 2EVZA 2LZ6B 4ID5B 5I42A 3RMQA 5IV4A 2JC1A 4IO9Q 4C11A 3KKFA 4AG2C 4LUDA 4Y2CA 2JNGA 3JV3A 4DA4A 4A4EA 1SH0A 3PE0A 3W5XA 5DLGA 3SCIE 2RQTA 3PIOQ 2PUKB 1F9EB 3QGGA 1HBOB 4L74A 3EGWB 2HRTA 3EXCX 3QO9B 1R6VA 2XG8A 4FZVA 1FEEA 4N41A 4JJDA 4WTOB 4C7QA 2I38A 2YKAA 4IUTA 1BWVA 1CG2A 2YKOA 1BBZA 3J7AF 2VQEJ 3GYNA 3BZQA 3H2VE 1LW2A 3MGJA 4X4QA 3MM6B 2QGFB 4PK4A 2R2TA 3IAS9 5HK0A 1YHQS 1WJQA 2DIGA 3NBPA 1U0SA 3M32A 1GBQA 3BSNA 4Q8EA 3DRSA 1BC6A 5IT9U 3W63A 3PW5A 2GCFA 2XGQA 4DUYJ 3RB3A 2GX8A 3KLHB 3VHQA 4J7CA 4DV4J 5ETTA 1ZTWA 2JNJA 3CC2A 4MDXA 2WONA 2XY5A 4JLGA 2C0IA 3R9LA 5ETLA 1N5SA 3A98A 4E7ZA 1YJ7A 4LD6A 2VHGA 5F41A 1VBKA 3OFHA 2J7WA 3SMZA 4TU7A 1AOJA 1SIWB 5J1EB 3DM2A 2XBPA 1T3OA 1VC6A 4FT4A 2RHZA 5L23A 1ACMB 4DUZF 1WI6A 4J7FA 1R0CB 4DBFA 4EZ6A 1B70B 3KOAA 3RBXA 4A8QA 1RTHB 4PG4A 4LFCF 1B99A 4DXLA 2DKOB 2DHGA 3I32A 5DQIA 5AXKA 4DJBA 2HG4A 3GPAA 1ZA1B 4GO5X 2BZYA 4ED1A 5J2QA 4TQSA 5KG7A 4X2BA 4XAKA 3NP5A 3TEHB 1U49A 3V5RA 1RWUA 1F9FA 5CH7B 3JB9F 1KQ2A 2OUGA 3FNNA 1KJWA 2IVWA 3MP6A 2VG7A 1FNMA 3M2RA 4LRFA 2QMUB 4ZPAA 3BQ0A 1U26A 2V4JA 1YIJT 1S1VA 1TZ0A 1K1QA 1SL0A 1C0MA 2KMTA 3R27A 3CEYA 4KULA 1VBZA 5C0MA 2CIMA 2D74B 3LOUA 2BA9A 4QPTA 3BS9A 3CC2Q 5HANA 4O3SA 2J9DE 1LPLA 1IR0A 2PGCA 4M77D 4OYIA 3OV7A 4HTIA 2BVZA 2WVBA 4O44B 4NLWA 5DLOA 1Q81R 4A46A 4XQ3A 4E0DA 1H3DA 2GIFA 4R55A 2L41A 2GVDA 3H25A 3EFRA 4GMKA 2J8SA 2R7OA 1UHCA 1VMBA 4LF6F 2KFNA 4C5GA 2OEKA 3OHAA 3I87A 2L0AA 2ERRA 2ZZDA 4C8YA 3DB3A 3C6TB 3V2UC 5G4DA 2VPWB 3CMAT 1RZMA 4EK2A 1R0AA 1KK7A 2L3QA 3GILA 2V1RA 2YNGA 4OVAA 2PQWA 1NYGA 3S3NA 4ZVTB 4F3QA 4IR1A 2DRMA 1AVZC 4ZVFA 2ILZA 1WELA 1NPPA 3PW2A 1TAQA 1VISA 2P4RA 3PX0A 2NSCA 2NZCA 2VBZA 4LF7J 4WCIA 3CCWA 2BE9B 4LDWA 1IR2A 3J7AN 1YIJA 1HHTP 1S1XA 1W70A 3GIBA 4M77B 4QWDA 3ELHA 3ITHB 2KFZA 3ILOA 5KT3A 3KNAA 3T6JA 1VJQA 1TKTB 2DRDA 3CCSS 4IFVB 2AD9A 2HFOA 2CPHA 1I1JA 4DV2F 1VQ7A 5F8GA 4M7DE 2XICA 5AJ3J 3CMEQ 1N32J 5ETRA 1H2TZ 3E3XA 4IKFA 1HYOA 3CPWA 3HD1A 2SEMA 5GAOl 1YI2Q 2GHWA 1VQPS 2EPIA 3G8QA 4IURA 1Y00A 3N9UC 2XYHB 3DLEA 4MK9A 3HPOA 2C0OA 4NS5A 3CMAA 3OMCA 5BYQA 4WJBA 4XTVA 3GTYX 1WKKA 1SC6A 3TCJA 1GMWD 4EBEA 2O9VA 1M1KT 1I6JA 3P5TL 3V6DA 2EYWA 4JOUA 3C19A 4HTJA 4IUPA 4NLSA 3OYCA 3OYIA 3RDVA 2M16A 1UGRB 1AHJB 3IS9A 4LFBJ 4UY8T 3H6ZA 3EMTA 4TY8B 1ZBXA 2EK6A 3GP8A 3UCGA 5DQGA 2EGCA 1YJ9T 1K8AU 4DQPA 4X4TA 3IM9A 4JYAJ 5LJ3f 2ZC4A 4PABA 1RI7A 1U2FA 2JJ9A 2NUTA 3NNAA 3MKDA 4EMGA 4LDXA 1TP7A 1O5JA 5D0EA 3BDUA 3NCQA 1UB4A 2V8PA 2LX9A 4FF1A 3JCMb 1IBKJ 5J1PA 4XU2A 3BQ2A 1R77A 1WQWA 4OMQA 3M30B 3OR1A 1PGZA 4RTUA 4O23A 4DBQA 1CQNA 1VQ7Q 1JLFB 4DU7A 4P2MA 2H5EA 2N4DA 3TA1A 4CLWA 3AQPA 2V9KA 3CEDA 2IDLA 2CWXA 2LEBA 2HHTA 2YUQA 1KOOA 2CPZA 1PYSB 1RT2A 3BBCA 3X1LB 3GMGA 3MM9B 2VG5A 1VQ5T 3QATA 2LC4A 1NMEB 1X4HA 4LT6A 2KYZA 1YJ9A 2JJ4D 3KXTA 1NDCA 2IM1A 4BCAA 3QJPA 1E7OA 4HDGA 4LF8J 4G3IA 4DCOB 2MEWA 3W9HA 1BK2A 3DXSX 3KJQB 3QJYA 2MGZA 4BC7A 2YKMA 1O0PA 1MMNA 2P0KA 4I2PA 2DTIA 3M8QB 3QKJA 2ZZTA 5CAIA 1KVJA 1VQ6A 2NCKL 3URGA 1KKHA 3VTIA 1UVKA 2JW4A 1OQ6A 2LRQA 1IM6A 1P1LA 1RBOB 4ZCLA 4B3SF 1U1OA 2VYTA 1M1HA 2JEGA 3M5AA 2WOMA 5GAN4 4BACA 2Y4XA 3CC2S 2C3MA 3OTCA 3MZIA 4RW9A 1XERA 1FNOA 4UTGA 4PCQA 5J2NB 1VQ5A 5H9FJ 3AY0A 4WFBQ 1FRIA 3ZL7C 2KI2A 2LYVA 2VDHA 4ER8A 4EU0A 4TQRA 1X69A 1RQ0A 1S72Q 3OYFA 1WEXA 3F0NA 2KH9A 3BH7B 1NK4A 3HVWA 4ED0A 3GZ7A 4J9DA 4DOWA 2GNCA 5KFIA 4BI3A 3H8ZA 1JRIA 4RW4B 1N5ZA 3D1OA 1OY6A 2GFUA 2G2ZA 4PQAA 4Q2MA 1RADB 1HYSB 3LGNA 3D6MB 4TLRA 3EHQA 1YSJA 3BREA 3A5ZB 2EWHA 3M7VA 1VQ6Q 3CCQT 2AGOA 1JLBA 2ZE2B 5GAMg 4LF5J 3DU5A 2LEPA 2JOQA 4Y91A 2DY9A 4M5LA 2K6DA 5B0EA 3QAEA 2P5VA 4KUDK 3CW2C 3SQOP 1IBLJ 1LWFB 1M5Q1 3BDLA 2D1CA 2RSQA 3ILIA 1QWEA 3CMES 3CJ3A 1J5EJ 1FDBA 2OO4A 2X1AA 4YR0A 1YI2S 3OBIA 1NBEB 7AT1B 1S4FA 3JB9k 3I96A 1WGSA 2B8AA 2XMWA 2DEQA 2PMWA 4Q8FA 3RERA 2B3TB 2QQAA 4QW2A 2J7UA 3KK3B 2ASLA 5LJ5f 1VQ9T 4OHWA 4I56A 1Q86T 4LQ9A 2P84A 4JI3J 1WZOA 3O8VA 3GB0A 1WNLA 5KYWB 1TKDA 2W7OA 4TU9A 3CC4A 1ZSZA 3KBGA 2D41A 4X4UA 3X28B 3CPWR 1LNXA 2X3WD 1WUUA 4MMKA 3DRPA 2BM1A 4KSEB 2OX7A 1RUWA 1M8VA 3I0SA 2B5JB 5FW9A 3VVTA 2CZ7B 3N28A 4TYBA 5KH6A 1M3CA 4MZPA 1V9OA 2UUTA 3J81U 3R97A 2DMOA 1FXXA 2DEUA 3EDRB 3P5BP 3CCMT 2K2PA 2R9LA 3U1LA 2O01C 1PCXA 2CJ9A 1TL3B 3DLMA 1X6GA 3G7ZA 3JAME 2FVUA 1OU9A 3CIZA 3A8LB 1SRLA 2NPFA 1VQ7S 1NPRA 3FZ2A 5KOWA 1NB7A 1XNQF 3DLGB 2CVIA 3LO3A 2Z2ZA 2C2MB 1SXLA 1TVRA 1IB8A 2CZ1B 4DSJA 3CSKA 2I1RA 4JJBA 1GBRA 2C3PA 5I3UA 4NLRA 3CCVA 3AD9C 3G9CA 4DDFA 2CZ0B 4R8UB 2CWKA 2MJUA 2YX4A 4IUQA 3M2UA 4YDXA 2Z8QA 4HT8A 5ETNA 1IREB 1M3AA 1SV5A 3IXQA 1C0UB 4J6XA 1RP5A 5H1SV 1FHTA 2YKNB 4YEAA 4JI2F 4F50A 2GIRA 4LMZA 4J5OA 1LW0A 1HPZB 4K4UA 2HCKA 4LVOP 1YJNT 2J6OA 3TZYA 1RTIA 4EBDA 3CC4Q 1QAIA 4QCLA 4J9SA 3HCXA 5C25A 1M1KR 2YXLA 4Q5WA 2Y0BB 3M2VB 1N33F 2MMPA 1MMAA 3FUYA 1HNWF 3AHPA 3M05A 4DLGA 1RU1A 4YP3A 3BPSP 4Y92A 2HS3A 1JLAB 1X4CA 4RW6B 4J9FA 5BYRA 1PSFA 2QMWA 4NL2A 1VQNQ 4ZP9A 4C98A 1RT3B 2JVOA 2FRWA 3BGOP 4UY85 4F0KA 5K8OA 2C2ZB 1XN9A 4TN2A 3W3SA 2L3SA 4ZIVA 1OSDA 1HWKA 4PG5A 4CRJA 2DL8A 2MZJA 5DDQC 2RF2B 5GAOr 4CYUA 3NXZA 1YVFA 3X26B 3D6TB 3QZ8A 1WC5A 2RQWA 4ECTA 3ZTPA 3CCVQ 2GQQA 2GS8A 2DD8S 2F8HA 2K5IA 1O75A 2HIYA 2KT3A 2DH7A 1S9EA 1WC1A 1S72S 2XM3A 3OJUA 1VQ4T 2PO4A 4N7TA 5DG8A 2DEJA 5GMDA 3K2YA 5L1IA 1GXTA 1YX2A 2YHTA 4FNHA 3MEAA 2ALZA 2Y0SD 1FE4A 1PM3A 3M9OB 1CEZA 2MCNA 3IQLA 1S79A 4J8OA 5D6XA 4X34A 3FBCA 1D8YA 3HFOA 2F5KA 3M6VA 5KFBA 4C8NA 3I5SA 1U02A 1VQ6S 4DR2J 4JI5F 1W2BA 4BY6B 3QT8A 3GFHA 4OGCA 1CVJA 1WIEA 4ILLA 2WSFE 1B4SA 1S10A 3JCMQ 1RTJA 4RBTA 3A8MB 3OTOF 3C15B 4M5DB 3E1SA 2G2OA 4A8YA 3H59A 2AEMA 1CS4B 4M77F 2XZDB 3FJ5A 1HHQA 3FEYB 4W90B 3HHLA 1M2VB 3AXKA 3DCAA 1E6HA 1DAXA 2VFUA 3DLHA 5CYQA 1KFDA 8ATCB 4CZCA 1EP4A 3BY7A 2M0YA 1AWOA 1QUPA 1PBAA 4YB6A 5LMUJ 1QQJA 3IRXB 3OYDA 2BQ3A 2KZZA 2C28A 3KLIB 3VJPA 2RIJA 4NL5A 3EH1A 2VODA 3SD4A 3AOAA 2R8KA 2PFDA 2DL3A 2F2WA 5CKDA 3ZZOA 1ICEB 3E01A 1W26A 1TOVA 5CQGA 3LX7A 2XI3A 1UGSB 3RKYA 4X62F 3BKUA 1S48A 2AF6A 2NYIA 1U06A 3JB9G 3ZZUA 2RU3A 3MECA 2FG0A 1FERA 4C8QC 2F69A 2K1RA 2B7BB 3MAQA 1S9FA 1VQPT 2CH4W 2WBMA 4JB8B 3JCMW 3QGIA 2XY7A 2R7SA 5IHNA 4EMHA 2ZUAA 1RHKB 3ZTQA 2GGPB 1RWMB 2V2ZA 4F7UB 3PRBA 1C6VX 2XMVA 4ZP6A 2IVFB 4DX8H 1RKJA 2D6FA 4C8QG 1UJ4A 3GV8B 4GC6A 5HROB 4G1QA 5L9XA 3C95A 3PM9A 3D68A 4OLOA 3HSJA 4DQ2A 1GK8A 1RXOB 3KMSA 4N4GA 1TUVA 1D0ZA 2LA4A 5BXIA 2UUAF 3GONA 3VRZA 3EGDA 3QIPA 3D0GE 4HHJA 3AOCA 1R8AA 2OPPB 1GXUA 2MYSA 1OJ4A 1WSVA 4XIUA 2C3OA 4OYZA 1XOVA 4LIRA 2CP3A 4BDZA 1X0PA 3AD7C 2CA9A 2RQ4A 3MWBA 3M8PB 1I94F 1RGVA 2E12A 3AXMA 2DYBA 3ENQA 1H72C 1PIEA 2GQVA 4BDYA 1KFSA 4V1Ak 2F40A 3HK2A 4WFAQ 4B9UA 2X9HA 2XK0A 4C0FA 4XTZA 2VGNA 2CUYA 3CC4S 2L48A 3QYGB 2OAWA 1R8OB 4ECVA 2IAJB 3BJYA 3W5ZA 2XDDA 2H3JA 4EIKA 4CH0S 2HFVA 1TL5A 1XTZA 2DL5A 2HVHA 4PPZA 4B9VA 4DL5A 3GV5B 1FDAA 3MMBB 2HBQB 4GRSA 2MZ1A 3OSPA 2FJDB 2P8IA 5D3GA 2A36A 3RBBB 2QDLA 1XBWA 1RISA 5HN0A 3SSSA 1VQNS 2QLJB 4JI4F 3PVXA 5ETMA 1HNXJ 3UF4A 4OX8A