1NPPA

Crystal structure of aquifex aeolicus nusg in p2(1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
b'QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 53
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nppA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nppA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nppA01
1YJ9A 1NPPA 1Q82C 3J81E 3PIOA 3OW2A 2QEXA 2CKKA 4QQDA 3CXCA 3DB3A 3G71A 3CCMT 1SSFA 2MWOA 1KD1U 1VQ7A 1VQNT 1K9MU 2OTLT 1JJ2A 3LD7A 3HKSA 3CMEA 4OBIA 1VQ8A 1QVGS 3OYYA 1N8RC 3I56A 1NZ9A 4TVRA 2KVQG 5IAYA 1KQSS 2JNGA 3CCQT 5HY6A 3CC7T 1VQ9A 1QVFA 1Q86C 3CD6A 3CC4A 3CCJA 1VQ4A 1VQ6A 1VQLT 5LL6S 1YJNA 2LVMA 1VQPA 2KDSA 1KC8U 2DO3A 3DLLA 3CCSA 1M90U 1Q7YC 5J3BA 3CCEA 1VQ5A 1YITA 2OTJT 5DLQE 4RG2A 1NJIU 1S72T 3LGLA 4CRIA 1X6OA 2LQ8A 1QVGA 1VQKA 3CMAT 1YJWT 3TREA 3LPEA 1K73C 1KQSA 4X34A 3G4SA 1VQOA 3I55A 1Q81C 1YI2T 1IZ6A 2JOYA 1NZ8A 1M1GA 1YIJA 1K8AU 2JUFA 3CCLT 1RL2A 1YHQA 3G6EA 1XNIA 3P8BB 2OUGA 1KD1C 3CCRT 3CCVT 2MWPA 1VQMT 1K9MC 3LH0A 5FLXE 3CCUA 2QA4T 1M1KU 1YJ9T 4ZN1A 2QEXT 3G71T 3CCMA 3A5ZB 1VQ7T 1VQNA 1YBYA 3QQCD 2OTLA 5A2QE 3DB4A 3CMET 5IT9E 4ZN3A 1Q82U 1VQ8T 3EWGA 2G3RA 1KC8C 3I56T 5J26A 1M90C 3CC2A 1XTDA 3CCQA 3J7AF 3CC7A 1VQ9T 3CD6T 3CC4T 3CCJT 1VQ4T 1VQ6T 1W2BS 1M1HA 1VQLA 1NJIC 1YJNT 1VQPT 1N8RU 3CCST 3KBGA 2E6ZA 1VQ5T 3CCET 1YITT 2OTJA 2K06A 1Q86U 2IG0A 3CPWS 2L3RA 4YTLA 1K8AC 1S72A 3LGFA 1BKBA 1NPRA 1VQKT 3OW2S 2XHCA 3CMAA 3CXCS 1YJWA 1Q7YU 3H7HB 2E70A 3G4ST 2EXUA 1VQOT 3I55T 3JAME 2MI6A 2LCLA 1YI2A 3PIPA 1JJ2S 3CC2T 1W2BA 4ESNA 1YIJT 3ER0A 1M1KC 2EIFA 1UEBA 3CCLA 1YHQT 3G6ET 2KPPA 1KHIA 1K73U 1EIFA 3CCRA 3CCVA 1VQMA 3CPFA 1Q81U 1QVFS 3CCUT 3J80E 2QA4A 3CPWA 5DM7R 2JVVA
chains in the Genus database with same CATH superfamily
4MKVA 1AEYA 4GC7A 4FDFA 2CKKA 2EBEA 5HSPA 1PGZA 2Y9HA 2N3LA 1QKXA 3OLBA 3QJLA 1FWZA 1XR7A 1JXMA 2BJ7A 3KNGA 1SRLA 2K2MA 3P4UB 4I7FA 1HPZB 5LL6S 5IXFA 3GSDA 3BDUA 3ZXWA 3UF4A 4QR0A 3I35A 1VYVA 4DQIA 3NCQA 4MYTA 3HFNA 5IV3A 3KK1A 2QTVA 3ETOA 2C0OA 3H5UA 5SUHA 2X7IA 4DS4A 1AFJA 1UGVA 2CYZB 1HQUA 2OP5A 1YHQA 1HWJA 3GIIA 3PHTA 3LANA 5GMDA 2RD5C 3A5ZB 3ILLA 1T9VA 4KY3A 4WP8A 3R7SB 2E5QA 2GS8A 2VONA 1N5YA 4WWSA 2A6MA 2Q66A 4S0MA 5HK0A 2M16A 3L2ZA 2BRKA 2CJ9A 1X5SA 3PEHA 4FP9A 2IRUA 3M2UB 3HHLD 1OPIA 3ENVA 3IMQJ 2WBRA 4HHUA 3ENQA 2NWMA 4OX6A 4DBRA 3BGRB 1SC1B 3JXOA 3H5YA 3QUIA 3JS9A 3SI8A 5A8RB 3KUGA 1XTZA 1VHIA 2HG4A 3G6ET 4M63A 2H1YA 3MMCA 5J1PA 1O8BA 5KYNA 3RAXA 1S97A 3ZL7C 4JRPA 5A76A 5B7WA 2VL1A 1CEZA 2RHYA 3QGPA 1VLYA 3MM9B 1RDRA 3UWNA 1IBMF 4J9MA 1UG1A 3OXLA 4P2SA 2YPYA 2B9EA 3DLHA 3QGIA 4YY3J 2C22A 1G3TA 2F40A 1WDDA 3D66A 2SEMA 5KFQA 1IM6A 3LF0A 2DFUA 3H2VE 1S49A 2A6OA 3JCMc 4LE9A 2HVIA 2HVZA 1D1BA 1M1GA 5KFFA 2QI2A 5GMKj 1UFFA 3G6XA 1YHQQ 4CT9A 5A8KA 5E7OB 4YR3A 4ZVTB 1RT2B 3A8EA 3K2YA 1RWNB 1P9QC 1VJQA 5I3QA 1HNXF 3MEEA 1NSPA 1D1CA 1VISA 1Q81T 2IMOA 3IR5B 4LF1A 1M8VA 1EX8A 1FRIA 3QT6A 1VQ5T 3FZBA 2XCAA 4F2RA 2XO7A 5D0EA 4MIWA 4ED2A 3CXCS 1KHVA 5CO7A 4OMFB 1N32F 5KFZA 2WVEA 2LX9A 2EGCA 3EFOA 3RB0A 2DNUA 2I6WA 5GMKh 2R8KA 3CB4A 3FRZA 4WK3A 3DDNA 2BRLA 1FRMA 3CCMT 4X4QA 3EX7B 2KXHA 1UE9A 1NHVA 3QRRA 2BZ2A 1OPZA 3FK4A 4OHVA 5C42B 3QYHB 2ASLA 3FBEA 2GGPB 5GAN8 4E7SA 2DNPA 2PC6A 2XO6A 4KR0B 4Y28E 2LQ8A 2X3GA 4PWDB 4LBPA 3LPEA 4PYAA 2D41A 2ALZA 3GYGA 4CDIA 3CC2Q 4A4FA 3OSNA 1F2GA 3KJVB 2CWXA 4DUZF 5GAOn 1NH7A 2PZ1A 2KZZA 3ET6A 2EGAA 2QEXT 3KLEB 4RX6A 1QSLA 1NK6A 4J37A 2W9BB 3M9QA 3RRGA 1S7HA 4N4IA 3X3UA 2XS5A 5IT9E 4K4YA 2ZPFB 1S12A 4DFPA 4DR1J 2FY1A 1U25A 1E6HA 2RHUA 2HNIA 3GYNA 2FHOB 4L59A 4DEYA 3P5BP 4WU3A 1W26A 1RHJB 3CCVS 1MHNA 5CVIA 2K3XA 3LGFA 4EI2A 1NDPA 4FXDA 1FMKA 2MQ8A 1RU2A 1FRLA 3DYAA 2BOPA 3NKYA 2LQNA 3HHTB 2L2PA 4OV1A 2MGZA 1YQHA 1X43A 2E41A 3J80E 1IHWA 1X4EA 2R7WA 3DI6B 4J5YA 3DHXA 1Y5LB 2ALYB 5GAN2 2AEJA 1U4BA 1V5VA 2L41A 5KT3A 4ZK7M 3W66A 1AZSA 2Z2ZA 5KFEA 4OYMA 2ZBRA 4HHHA 1R77A 3OL9A 3VS7A 2DNMA 5DQGA 4X4NA 2KT1A 1Y07A 4C2MA 3ISND 4CRIA 3PHEA 2LCSA 2FJWA 1DFDA 4UQGA 2YWKA 4ECWA 2VFTA 2RUGA 5D15A 2CPIA 3MMBA 1PNJA 2J6OA 5HBMB 4KFBB 4M77A 3BPDA 4QVZA 3UN2A 1DLOA 2B4VA 2ACMA 2MKYA 5LMNF 5D8HB 1FVQA 3MWBA 1D0EA 2DJZA 3SQGB 3RTVA 4JI5F 4PG4A 1V76A 1KLMA 3FRYA 3EXYA 4WKRA 5SZTA 3SWNC 3S3MA 2CIMA 5IXUA 1XNQJ 1UL3A 1TFWA 2BIVA 1JQGA 2W2MP 1FWPA 1OULA 3CBMA 4LVNP 1YJ9S 2W2PP 4KH1B 1PILA 2ZPEB 3W9IA 4I2PA 2QL9B 4DPWA 3Q89A 4ESNA 1RHUB 1YIJT 1A0NB 5E3PA 1GFDA 2YNGB 2JLFA 4BC9A 4NOYA 2CQPA 4O3SA 3EGDB 3MO8A 5EWGA 5AE3A 2E7XA 3I31A 3TOQA 4EBDA 3C15B 4IURA 2AW0A 3CJ4A 4DV5F 1VQ7A 3OL7A 3C16B 4ECXA 3VS1A 2P4RA 3AXMA 1WUUA 5LT5A 1U0HB 1K73R 1BMQB 2C2MB 2DBMA 3I5AA 4OYXA 2IHR1 2RHQB 3BYPA 4B3RJ 4A8KA 1NXIA 2GO9A 5GADI 2W7AA 4M75E 2YNHA 1H0HB 1TR0A 1FD8A 1V5IB 3M7VA 3JTPA 4DG1B 3MEAA 3JB9D 2HEKA 4PPDA 4J9QA 3T9ZA 2LQJA 2MJNA 3RB4A 2AJ4A 3DLKA 4LF7J 3IS9B 4ZVHA 1PWTA 3KK3A 2H9ZA 4DPYA 2JEIA 1S1WB 4ZCIA 4WF2A 1NHUA 1FERA 1M1HA 1VQ6T 1WDXA 1UTIA 3WIUA 4K4ZA 2E7VA 4F26A 4F0MA 3CPWS 3L42A 1RADB 1X8DA 2IJNA 4OB1B 1JJ2S 5F8MA 4MKYA 1SJ1A 1YJWS 2ZZDA 3EMTA 2QSWA 1N6QA 2XMJA 1JLCA 3DGVA 3TEHB 3FRNA 4TYBA 5IHNA 1F5AA 1TL3A 3QLHA 1AZEA 1UPPA 2CT4A 1G2EA 5E0OA 2KJVA 4NLDA 2DL5A 2KFNA 2FHDA 4FW1A 3OQ5A 3H0HA 2CGHA 3ZZTA 2DNLA 3JSCA 4RUBA 3TANA 1AWXA 4CI0B 1FKAF 2CS7A 4A8OA 3SCLE 2VODA 2CNKB 3M30B 3AQPA 2DH9A 1QVGA 4RKUE 2HS3A 3CMAT 3QSYB 3NS7B 1H3ZA 3Q22A 2HMIB 4FZVA 4QKUA 4ID5B 3QO9B 2BTTA 2R7XA 3CJRA 4V19X 3EVWA 1LPLA 4IRDA 4GKJJ 4ANCA 1CPZA 2NXCA 4C92B 1I4K1 2EBPA 3P5TL 4USUA 3R5AA 3T5LA 4DSIA 3VUBA 2B5JB 5KYUA 2BBEA 1WHWA 3ZTPA 4DR4F 3PW7A 3A3NB 1S10A 1HYSA 3KXDA 5F41A 4OZ0A 1YBTA 2XU8A 3EE3A 2AKLA 1J5EJ 3HSBA 2KI2A 2P0KA 4DR2J 4I64A 2V67A 3NTHA 3ICLA 2DIQA 2HHHF 2IBKA 2GAHC 4M5IA 2JM9A 2ZE2B 4IOBA 3SCIE 2OI2A 4QCLA 3TARA 4AMCA 2DIUA 3LP1A 4DV4F 5DM7Q 2YX4A 2R5AA 2A7YA 2N4CA 1RTZA 3VAJA 2QQSA 7AT1B 2K3BA 4O23A 2CJKA 1Q81R 5JVHQ 2R7SA 5I42A 5A8WA 5KG6A 1S0MA 4F17A 3FJ5A 3MM8B 2AF6A 4X4PA 1AOJA 2HWHA 3I96A 3I55A 3GR1A 3SCKE 4OX8A 5F8IA 1T9TA 4CQ1A 4F7UB 4JZ3A 3CCRT 2R9LA 4K11A 4GMKA 2YNFB 4ATOA 4NLOA 2CG8A 2IVWA 4P7VA 3QQCD 5IH2A 1ZUUA 2RI5A 3C8YA 1WSVA 5HVHA 1NK7A 5AT1B 4DU7A 1RI0A 3MEWA 2OHDA 2RD1A 2A0FB 2Q3PA 1HPZA 2BE2B 3BYRA 1GXLA 2HS0A 4OP0A 1GBRA 2FVSA 2LTOA 2DNGA 2VFSA 3ZZZA 2XHCA 3KG1A 3QFWA 2D3OR 2DXTA 4Y00A 3A1YG 3PW2A 2D0NA 1ICEB 1MU2B 2D1CA 2QV6A 4Y2KA 5KFRA 5IM0B 3VAIA 4JI3F 1UCNA 4DMZA 2CPZA 2VBZA 1BUXA 3AHUA 5CKBA 3BB5A 2A2DA 1MMLA 3HSDA 3G71A 2AZSA 2FHJA 3JQMA 3GONA 5KFBA 3QJJA 2FZCB 3TEGA 1UUEA 1UECA 4C8QE 4F4ZA 1TUVA 2BV3A 2GQQA 2E64A 5L9XA 2KXFA 2VG6B 2VPYB 5J3BA 2DEUA 3M2UA 4CM2A 1S99A 1PJ5A 5RUBA 1TZ0A 1WF1A 1B7YB 5GAHU 2GQ2A 1JJ2R 3BGRA 3I55Q 2JTEA 3QJYA 3FSYA 4AL5A 5A8RA 3DGPB 1UGQB 4OLPA 3T1HF 1S0VA 4ZCMA 2FL7A 1KBRA 1M1KU 4ATNA 3MOJB 5KE2A 1JXOA 4R0KA 5HANA 2CRLA 4EPCA 4JI7J 2P9GA 2QG9B 4EUVA 3MP1A 1J5OA 3L09A 2VBYA 1FT8A 4Y2CA 4DL5A 2DF6A 2F2VA 3WQPA 2LT1A 5IFMA 4TLQA 3MM9A 4F0HA 4I6AA 1JLAA 4X1VA 2QSFA 4RW6B 1WHVA 4LSNA 3TJ9A 2HFVA 3EGUA 2XDDA 1RI7A 5HI7A 2DX1A 1BGXT 3RUXA 1NB7A 4ENOA 4QQGA 1LK5A 2ZCFB 4AL6A 1RI9A 1H72C 2Z57B 1VC6A 4OGEA 3VAHA 1FYNA 3CC4S 3UNYA 4J9SA 4D6WA 4B02A 4ED4A 4NL2A 4YB5A 4DN0A 1RT2A 2ZH5A 3G71Q 3CW2C 2G1DA 3RGIA 3GQCA 2MZQA 1R3NA 4P7TA 1WHGA 2WVCA 5FU7B 2NLUA 1SEMA 4H54A 2KDSA 2DISA 3IAS9 5LJ5f 1YITA 2YX1A 4M78B 2MQMA 1RT5B 3TX8A 5KFTA 1QY7A 2KYXA 3H5XA 2COYA 1F3VA 2YLBA 1FJEB 3OYHA 3RBEA 4LF5F 1ZETA 1GK8A 1RHQB 1C0MA 2WACA 1Q79A 2EW9A 2OH2A 2ED0A 1AT1B 3G96A 2DL4A 4F4AA 2EJ9A 4OYWA 1V3SA 4KHPJ 2QFIA 5G4DA 5GANd 4OIXA 4YHHJ 3D1QA 1BWVA 2QLJB 2DO4A 2E1PA 3WVDB 1PD1A 4ZNXA 1RB0A 1WKJA 2E70A 2RVJA 4RU9A 1RAEB 1VQOT 4PWDA 2GHVC 1LK7A 4DS5A 1MMGA 3UFCX 4Y34A 3M8RA 1N34J 2N7YA 1CJVB 5CCAA 3RMSA 2HAXA 4O4GB 3KJVA 1H2UX 1VQPS 1X4CA 2UUWA 1RBAA 3KLEA 4JV0A 2U2FA 3IC1A 1YJ7A 1FDBA 2ZNYA 3CC7T 3KXTA 2K79A 3RB6A 4HR2A 2ENMA 1HI1A 2F4VF 3PMTA 5LM7E 1IKWB 3N6NA 1XMQJ 4A53A 3C0CA 1FMWA 2GNKA 3TREA 2LNVA 5AJ3J 2R7UA 4RW8B 2RJDA 1HR0J 1GCQA 5F0WA 1FEHA 2DH7A 1TWBA 3PO5A 4G1QB 3RW7A 4IR1A 2CADA 5CQYA 3DI6A 4X66F 2V6AA 2WZ1A 2OELA 1VQSA 2BABA 4IUQA 5ETRA 5LJ3f 3CCLS 1WQWA 3RBBB 3P96A 4RBUA 2RKIB 2IBOA 4K2XA 4DV0F 3UPFA 2I1RA 1K8AT 3I5SA 2I5JB 4DL6A 4TNOA 3FKBA 1RYSA 1Q95G 2L3PA 3E19A 1B7FA 3TQ1A 1BQXA 4LRAA 1VQMA 2HVEA 3GNFB 4M7AC 5HBMA 4JUVA 4X64F 2GIFA 1R43A 2VDHA 2FZKB 1I07A 3OBWA 2BX6A 3CCSS 4I68A 2YQ2A 1WHHA 4X9CA 3HKSA 5GAMj 4E7JA 1PYTA 1NJXA 2GFUA 5LOQA 2MF2A 3SQGA 2X4XA 2CJQA 3NAHA 5HN0A 2VUBA 4RUGA 3NS6A 1RZMA 1Y5NB 4FIBA 2JN0A 2VC8A 1GXIE 3TAMB 2LXUA 4DSKA 1VIFA 3O5ZA 4MMKA 5KG1A 3AHPA 2IDLA 3AXKA 1HIYA 2DNYA 1QUPA 2QA2A 3PYDA 3ELHA 5KTQA 4J6WA 4L72B 2YNGA 4ES3A 4IOCQ 3EGDA 3JCMW 1H2VZ 1OOTA 1JLGB 3WXMB 4MH8A 3C15A 2F5KA 2CUDA 3E9FA 4H4KC 1HFEL 4C7QA 3V6HA 1ZUYA 2FYKA 5D3GB 5GAMh 3C16A 3DLGA 1TFYA 1UETA 3VV2B 1TUDA 1U0HA 4B6MA 2RHIA 1YJVA 2C2EA 3OBIA 1S0OA 2C42A 1Z2ZA 4DZ6A 2MKJA 1RUWA 2M9UA 3W64A 4P10A 1KQ2A 5GMKi 2CZ7B 3VYGA 1EJ7L 4X65F 1MV0B 3OUYB 1IO6A 1YHQT 4DG1A 2EQJA 1VQMQ 3ZFJA 4ZTJA 4TU7A 4JJBA 3MEDB 3JB9J 3EH2A 2W7PA 2GC8A 1SG5A 4F16A 3GFHA 5CYMB 1XQIA 3O5TB 3IS9A 1EETB 1GX5A 3FZ2A 5AE1A 1TOVA 2F4FA 2B7CB 3BO4A 1PAEX 4GC6A 1Q7YC 5HQ8A 3S6EA 3EZUA 1REVA 4NS5A 4YS2A 2F9DA 4CLTA 4DBFA 4LXCA 4YR0A 4OI2A 3C19A 4A63B 2W10A 3DRSB 3NRBA 2XC9A 1K44A 3HL8A 5F9NA 2C3UA 1JB0E 2HNZB 1S5ZA 1RT6B 1QM9A 2IVMA 3G1JA 2LQWA 1WHLA 4FT4A 3BSCA 1CQNA 3QGHA 1VCTA 3GCXP 5GMKl 2BUNA 2ZH6A 1I5LA 4DQPA 4ELTA 3SQOP 3PEJA 1S4EA 1GAOA 5BYSA 3FQKA 5KFGA 2VPXB 2OPPB 4IKFA 2R7VA 1PKUA 1K8AC 3M30A 3BBCA 4KB7A 4PFPA 3CJ8A 3M1VA 2C2OB 3TWZA 3CC2T 4DFMA 4BE2A 2HMIA 2A37A 3QO9A 3OJSA 1ZBXA 4E2FB 2DJQA 3F56A 4C92A 1NPPA 4LUDA 2L48A 4EMDA 2ASDA 4YUDA 3VTIA 3JYTA 4ED3A 2HWIA 4WP3A 1W4SA 1IR0A 4C0ZA 2KVQG 4K50A 4M7AG 4RNHA 2X35A 4AD6A 1I1JA 1HW8A 4Q7AA 3RKYA 2OGUA 1LWFB 3AJ1A 2FGOA 3TSZA 1KVJA 1TKTA 3EUNA 3MCOA 2J0WA 2CP3A 2OPRA 2K1RB 2OIHA 2FJEB 4ZPVR 2ZPHB 1IGQA 2B86A 1NU4A 1X2KA 3MUTP 1RKIA 2ZE2A 3J7A1 2R2RA 1CJKA 2D9PA 1F1BB 3IG1A 1NCLA 3OYAA 4OMFG 4UUXA 2F8HA 4LDYA 2MY8A 2OTLA 1UGRB 2DD5A 5L46A 2P9CA 3GFZA 4TQSA 2PDAA 1X4DA 2E1CA 2KQWA 5DLFA 3F73A 5U47A 2ZBQA 2EI5A 1AYEA 2MLYA 4Z89A 1NPRA 3MM8A 2HHTA 4PJJA 1YI2A 1WA7A 4MZPA 1BU1A 1OSCA 2LP5A 3D1OA 4HKQA 2H48B 2EK1A 5GMKm 1Q0NA 4DX6A 4N8NA 3M59A 1P92A 4USMA 3T6BA 4KH0B 2O1PA 1VQ9S 2V34A 3BN7A 4F7UA 2FQQB 5IQ6A 2PUOB 2A28A 2YNFA 2VIHA 4LT6A 1E6VB 3ASKA 1EZZB 1IREB 4URSA 1TVRB 1U06A 3W3SA 3B78A 1U02A 1IBCB 4QW2A 3TZWA 1M1KT 1Z4UA 4USKA 4K4XA 1DTTA 2BE2A 4QIGA 2CAJA 5LJ3d 3QPHA 4F02A 1N0UA 5DLGA 2M0OA 1UGSB 2BYCA 5C5JA 4ANDA 5CQGA 5CK9A 3U02A 1OZ3A 2RNAA 4RBTA 4FVMA 4J6YA 1G8XA 2DK3A 1MU2A 4X84A 1FK9A 3TQEA 5IM0A 4IG0B 4FKXA 5HLFA 1N36J 3DM2B 1VQLS 2OTJQ 2R42A 1RAIB 2KHDA 4IYQA 4ELZC 5HCKA 2MDAA 4J9IA 2LCWA 2OTLQ 1BQNB 2OAUA 4YB7A 4PEOA 3QAUA 2QO3A 4OMQA 1HQEB 2YH1A 1DTQB 4DHVA 1SPKA 1NDCA 1ZAXA 1SKWA 1YWPA 1JJ4A 2VG6A 2ZEJA 2G2YA 5I2SA 2YQ1A 3OA6A 4EEYA 4Y92A 2ZH4A 1RUSA 1YI2Q 2HPUA 4G1IA 1X5OA 3QRQA 1LXJA 2ROPA 2DRAA 1S6PB 3V4IA 2I8EA 3DGPA 1OWXA 4QPTA 3M57A 2WVFA 2C3PA 1X2QA 1S9EB 2MMPA 3OW2R 3M9NB 1ZLMA 2IIMA 3QIIA 2VZ9A 1P27B 2MKIA 2CQ4A 3TO8A 1HARA 2HRTA 3MECB 4FYVB 4DX7A 4M75B 2QLFB 2DVJA 1HKAA 4RW6A 3CD5A 1BLUA 6FDRA 5EWEA 3DOKA 3FEXB 5DQIA 1K8AR 4DR7J 3HULA 4LMZA 2KBTA 3IO1A 2YSQA 2J6TA 1ZSZB 1JLFB 2BANA 2DGTA 1M3AA 3SSSA 2DPIA 2WSFC 3UPUA 2WB1D 3EG9B 4ZPTR 4D8DA 2KVIA 2QC3A 3E01A 1KIKA 1SCJB 2LX7A 2B4UA 1F6TA 1KJWA 1VQ7T 3VS2A 2LECA 2H4WB 3DRPB 2QZ8A 1CBKA 2BJDA 2V26A 3MD1A 1QD1A 1NZAA 3BKUA 3EICA 4XQ3A 2G13A 3M4XA 2XZTB 1UW9A 2HNYB 2NXNA 1QE1A 3B54A 4M78A 3GP8A 2LKZA 4P72A 4OI1A 3PW4A 5KG0A 5GAGU 1F5CA 3ZZPA 4IO1A 1U1SA 1G5VA 5HAOA 1VQ4S 2Z0WA 1KFSA 5AXKA 2Z4PA 5CH7B 4RTZA 1WI7A 3SSQA 3TA2A 2G0JA 3SEOA 1VFJA 2X51A 1KSWA 2ZDOA 3ILOA 3THKA 3OTOF 4XPEA 4M7DC 1WC0A 1FO1A 4W90B 3SDEB 3Q8YA 2M02A 2HBYB 1MMDA 2XMMA 4RW7B 2KYBA 2YKNA 1DJ0A 2J05A 3QDRB 1YBUA 1L3UA 3N79A 2CWKA 3NBPB 2ACYA 1IBMJ 3LAMA 4QYRA 4UOGA 1YBAA 1RT7B 3ZZYA 2R5MA 1K47A 1KVIA 5KT6A 2J6KA 2FY8A 4GKKJ 3CXCP 4JV5J 1K9MT 1APSA 3CJSA 1S1XB 2YWGA 3S3OA 1Q82U 2RQCA 2J7UA 1D0XA 3M8SA 2BJEA 4Y0FA 4EMGA 3AB2B 3CIZA 1KC8T 1UB4A 2B56A 1Y7PA 3B6BA 3KHRA 2ZJRQ 3BS9A 1HNXJ 2D8JA 3SFGA 1XR5A 5ADZA 2X3WD 1KP6A 2LC4A 4HXJA 1P1LA 3W2VB 4NEYA 4NRUA 4HCBA 1DQ9A 3JAME 2IIHA 2MIOA 4Q44A 1VQ8S 3IR7B 4KGKA 4KC5A 5H9EJ 5LJ5g 2MHEA 1X01A 3CCJS 3A8JA 2EJFA 5J2QB 2YUQA 4G1QA 4F7VA 3CXCA 5AYFA 4IDKA 2WCXA 1ZYQA 2CDRB 1N32J 3K5NA 4ZMMA 2H54B 3X26B 2LU2A 4A8MP 3VU3C 4WFBQ 4ANEA 3UDVA 3DKMA 5GAOp 3NL0A 1RWXB 4ZGEB 3AD8C 2DGQA 2D9TA 2RKIA 4M77F 2BKNA 1SL0A 2MLZA 3I82A 2I5JA 3BSNA 2HK3A 3OYFA 3BREA 2VFRA 4RCCA 1SQGA 3PJ9A 1OY6A 3OXFA 4MIAA 2LU1A 3UN5A 3M8PB 1SPBP 4DL4A 2ZOFA 3CWJA 2D74B 2NLWA 2OPSB 3K8WA 3BDPA 3AAWB 4ZIVA 1DZ5A 4NX9A 3NPFA 4JI0J 3QZ5B 3SMZA 4K4VA 4ILRA 5IWAJ 2KT8A 3RZAA 3TAMA 3GJQB 1RAJA 2ZBCA 3CDAA 2V4RA 1YGYA 1NO8A 2RAQA 2J0XA 2JW4A 4KV8B 3K17A 1OX9A 5LXYA 3IRWP 3I55T 2DETA 5D4PA 2ZH2A 3DOMB 4OI0A 3FCWA 4JYAF 2MTLA 2WB4A 2FJVA 3BF4A 3CCVA 1WHMA 3GG1A 3GWCA 1HNVB 3EM1A 3HDSA 1LVKA 2Y4XA 1FRKA 4ZP9A 4C8QB 1NNDA 1MNEA 4J9DA 4BWJA 4IIMA 3TA0A 1FRXA 2V63A 4XU2A 4OLOA 4F7UG 4O0IA 3AJ2A 4X4SA 1OQ6A 2ZVIA 5T7LB 5D3GA 2GJ2A 4DOWA 5C24B 2KT5A 4ZP7A 1TELA 4WFNQ 4HT9A 1UGPB 2L89A 4DSEA 4LF9J 2ZH8A 2B8QA 5CCMA 4PG7A 3FEOA 2DHXA 2U1AA 4LDWA 5LJ3g 1Q78A 2ZITA 4YDXA 4ALZA 2YUNA 3OUYA 1K9MC 3W63A 2NSCA 2GVZB 2YRDA 4J9BA 4OX9J 4WFAQ 4Y3CA 1RYRA 1UA0A 5FIIA 4AFQC 1HD1A 3G71T 1G2BA 3GJSB 4DV3F 2Q6BA 3MPWA 1VRUB 3UVJB 3SV4A 1KC8C 4JDSA 4RNNA 2XKOC 2V68A 1M90T 1PCAA 4DA4A 4ECUA 1ZM4A 4ICLB 4F14A 1M1KR 3W65A 3M0TA 3V8LA 5LMNJ 1HNWF 1HD3A 3MCAB 1FXDA 1M5HA 1RTJB 3FBCA 3VF0B 2J7WA 3MEKA 3W9HA 2XNQA 2ZBPA 3M58A 1WG4A 2VICA 3VWSA 1M5PC 2EBGA 2IVYA 3CCVQ 5CD4A 5D4LA 1YJ9A 1RT6A 5CD4H 4IUTA 3KLGB 2AQ4A 2ZH3A 1KTQA 3I4PA 4O3QA 2KRRA 5D0HA 3NCPA 3G6EQ 4A8WA 4J9GA 1C2PA 1R7IA 1PIEA 1UVKA 3TA1A 3D68A 5BXIA 5HO4A 3C94A 3LWHA 2YKQA 4D3GA 2VU5A 4PXEA 3R1HA 1XR6A 4RPFA 3MGJA 1R8HA 1ZSGA 1PBAA 3TCJA 3CPWP 1JEGA 4X62F 1WNEA 1GMUA 2Z30B 3NLCA 2UXBJ 1W7WA 5A0DA 2XZDB 3OSSC 5L8RC 4CO3A 2PN6A 4K5SA 5HQMA 3NGRA 1NJIC 3LA0A 4KPCA 3R7BB 2KM8C 1R6VA 3CJ5A 1Y0HA 1F3FA 4KTQA 1YITT 1Y11A 4FS2A 1LWFA 2AYMA 1F9EB 1M0SA 1QTNB 1HWKA 3S3NA 4M5GA 3W5XA 2HFNA 2K1RA 3H59A 3L7PA 1B4SA 3PV8A 4B9VA 3CD6S 3CPWA 1EHWA 1WC3A 1S0NA 3SBMA 1C1BB 1YJNS 4PJOA 1YJ9Q 2VV5A 4FU6A 3TI0A 1M2OA 4OZNA 3H6ZA 2RJFA 1PJ6A 2OEMA 4TXSA 1JJ2A 3DLEB 3FVYA 4RTWA 2XLIA 3L2QA 1SJ3P 3V8JA 2XIDA 2EW3A 5KT4A 4OI6A 1FX2A 5GANj 1LFWA 1Z9QA 2XI9A 3PFEA 2DJWA 1VBYA 1A9NB 1B3TA 1VQNS 1D0ZA 2IJRA 4CLUA 2EEYA 2K5IA 4ETXA 2DL8A 2P6SA 5B0GA 2CNOB 3CBPA 3NS5A 1G83A 3GG0A 4LSLB 3NOGA 3HHLC 1BD6A 3FC3A 4QR2A 4OMLA 2XMUA 1KSPA 3DB4A 1PSDA 1C1CB 2UUBF 1S72S 1E6VA 4U7UD 2B9WA 3DN9A 4BDZA 3QWYA 1VIOA 3LLRA 1M90C 1MG7A 1TVRA 4ECQA 1YWXA 3HVAA 3UDEA 4B08A 2GVDB 2H5EA 4CYUB 3MAAB 2JDJA 4F3OA 3OTBA 2NUZA 2QEXQ 4Z8AA 1UVNA 2EKHA 2MPXC 3I9V9 2ROTA 5GANh 2HQXA 2VA2A 1N5VA 4DLGA 4DR4J 1U24A 2AEMA 2YRVA 4N41A 5DM7R 2CQBA 5HK3A 4O6JA 1S1TB 4OZ5A 4Y91A 4X4VA 4IG0A 3J81E 3DM2A 4KHMA 3MR2A 2D3UA 2MWOA 3LWIA 3OYKA 1WHYA 1V1CA 4OB0B 2DBBA 1BQNA 3Q24A 1WG5A 2UV8G 4K0KJ 2RDIA 4N4GA 1ZZFA 2NSBA 5L1LA 2VPWB 4FYYB 1Y0MA 1U45A 1QVPA 1HQEA 1FXXA 4CCHA 3FBFA 1DTQA 5IXBA 3PE0A 4JV2A 4NLQA 5F0UA 1WACA 3Q8VA 3HMJG 2VQFJ 4RWWA 1U3OA 2MQPA 3PVQA 3VAGA 1OV3A 4RNOA 2MAMA 3HT3A 4MDWA 2BW7A 2CVEA 2XY6A 1VQMT 3NMAA 3HFOA 1FF2A 4USVA 1S9EA 3PVXA 2K5FA 1B07A 2DEIA 1JLBA 4NCGB 1NYGA 1HNZF 5HVGA 5J26A 1JWWA 2H3EB 2HQFA 2WW4A 3TNVA 5KYXA 5KG4A 2EAYA 4M75A 2ZPGB 4OHXA 5F9LA 2J5AA 2GA7A 1UFWA 4NXNF 4ES2A 4HCCA 4YDDB 1TK8A 4LF8F 2ZHBA 2DYIA 2OLWA 4DL2A 4E7KA 3OS5A 1ZSZA 1JLFA 3GLJA 4G3IA 1NSQA 3EG9A 5H9EK 1LWCB 3H0PA 4BWMA 1KDNA 1K1QA 2BW2A 3AJDA 3P3DA 3DRPA 4DR5J 5GAN6 4DF8A 1TK5A 4LF4F 2NZ4A 3FDSA 5E3QA 1ZM3A 1CJUA 1JK9B 2HNYA 1Y7XA 4O3PA 3JRZA 3JB9H 3M05A 4KE5A 2PU9B 2CJAA 2AD9A 1TL4A 5J2MB 1WHJA 1X5TA 1XK8A 5ETTA 2KT3A 3E2EA 2M70A 3AFGA 1KD1T 3FLGA 2JTMA 3TRGA 3GTYX 4J9PA 2FPDA 9RUBA 2C2RA 4B9WA 1SJQA 4KIAA 4DPUA 2KGTA 3UD4P 2RJCA 2AJQA 3NMZC 3HPOA 1U6ZA 4C0FA 3T1HJ 3TQ7P 4DSFA 3N5FA 2E65A 1I51B 2L9WA 2NYSA 4GY5A 1M4ZA 4IUPA 3OMCA 4RW7A 4KBMB 4RTXA 1RWWB 3G8SA 1N52B 5DQHA 3QFHA 1H7WA 3ER0A 1KR4A 1MWQA 2DB1A 3F41A 1HYOA 2D0QB 2IVFB 4EZ9A 1RK8A 1RT7A 5KG5A 3ZZUA 2FB0A 3I6PA 4Y2MA 3SWNB 1GBQA 2K7JA 4NMLA 4B9UA 3T19A 1YZ7A 3OMGA 1Q53A 2DR8A 3EZOA 1SJFA 4WFXA 2DYBA 5D0GA 1QAJA 3BQ1A 1H2TZ 5K5MA 3CC4A 4LF6F 4QWEA 1M90R 4ZJQA 1FNXH 4PJLA 3HK2A 3FFIB 3QBCA 2NUTA 3R8YA 2V94A 4HTIA 2B4OA 4N5SA 1NLPC 3FGVA 3CGIA 4I56A 3A8GB 2FVUA 2ZPIB 2M8HA 3D5MA 1M8MA 2XS7A 2V8HA 4X4TA 5KFWA 3UT1A 3W2VA 2ROEA 2ZJPQ 5L38A 2V9KA 2CUYA 1RWUA 4M5KA 1FJGJ 2KI7A 1P9YA 4CZCA 3SFMA 1UDLA 2M1HA 2CPHA 4HDGA 1QWFA 1X0PA 1RGVA 1PC5A 2YVSA 2ZH1A 3J81j 3J7Z5 4A8YA 3D0HE 1M27C 3P6YC 2ZUAA 2MXYA 3OSVA 4L3NA 3HZGA 1KTVA 3T1YF 2H51B 1QTMA 4TKTA 5GAMf 1ZPVA 4WXWA 1XTDA 4OX7A 5ETMA 3SV3A 4CLLA 3H5SA 3KK2B 2E6ZA 4RCBA 2IC3B 4MK9A 4WTYA 4F0KA 2LQ5A 1KHCA 2WSFE 2QT7A 2DR5A 1HI0P 2BJ9A 2UUAF 1G4CA 4M8LA 3N5BB 3EFSA 1RTDB 1Y5IB 4TY8B 1QVFS 4ED1A 2YDLA 1I5OB 2QLWA 4DUYF 3OQ2A 4X2BA 2OTLT 1PG5B 3FBBA 2V50A 2OFGX 3E3XA 1VQYA 3M8PA 4J90A 2CQ1A 3RB3A 1OY8A 2OPSA 2QQBA 3O1LA 3O3LA 2XNRA 3CC4Q 1ITPA 1VQPA 2KNBB 2F9JA 5BJRA 1X9MA 2HIYA 3ZZRA 1RISA 1OY9A 1SI9A 4EFAC 4A4GA 2QFJA 1RWMB 1YI2T 4KV8A 1VUBA 3A8IA 1FRJA 2VXFA 3DOMA 3R6LB 3JV3A 1MV3A 1KD1C 3H42A 3A8HB 4LFAF 4U8YA 4CLZA 4RLEA 2HHSA 1UEVA 1BIAA 2GHWA 2EFIA 3I5CA 4M7DE 4HVVA 1WSRA 1SSHA 2DTOA 4C8QA 4EO8A 4OJGA 5E2QA 1PAUB 3OR1B 3SDZA 2PQWA 4NLPA 1JXLA 2MZSA 3CNQP 2HFZA 3UCZP 1BYMA 5T7LA 1AB8A 4OHZA 4XPCA 1FRHA 4X66J 5C24A 2ZHOA 2NQPA 3B4MA 3UO0A 1HK9A 2MYFA 1T9XA 3RR8A 4ERDA 3PX4A 1JLQB 2E5HA 2F1FA 1T03B 4M77D 3CCLA 5LJ3j 4V19J 1TU0B 3LAKA 4IKAA 1VK3A 2HQGA 3HD1A 2DZCA 2CPJA 2GVZA 4C3LA 3Q8SB 4C6AA 2QDYB 4U6PA 4KSEB 1UJ0A 2E44A 3M0UA 1VRUA 1KNZA 4P75A 5A6PA 2BQ3A 1E7OA 1VQPQ 2HL5C 3J80U 1D3BB 1KFDA 4Q5WA 2JH3A 3CCSA 1X4AA 3HFVA 4ICLA 2PT0A 3JSMB 4K7QA 2R57A 3QZ8A 4PL6A 1YK9A 3CEYA 4M77E 4B3MF 4YY3F 1HMVA 2CQCA 1HW9A 2M2BA 2B3TB 1RTJA 3S8SA 3MEGB 4URGA 5KT2A 4BS2A 4J9UE 1XNIA 1WIEA 3CC2S 2KFZA 5LJ3h 4ZPBA 3BQ2A 5C2CA 1SV5B 4KT0C 2VPZB 4FL6A 4ZIWA 4QWAA 2RQ4A 4JI1J 5A2QE 1RHKB 2E3HA 2MZ1A 3J7AF 5CYQB 2B6AB 4OZ3A 4V1Ak 2ZJQQ 1W2BS 1FWLA 4RUHA 4DX8H 4JI4F 3INZA 5IQQA 5J1EB 1UEUA 4TY9A 3HF5A 3NG8A 4NYOA 1U1PA 4ECZA 1RLQC 4C92F 5KAKA 4M75G 4C0OC 1U1OA 3MF5A 1RCXB 4JJNK 1MROB 3THTA 2RHZA 3CCLQ 2VC0A 3UR3C 5BYRA 4EZ6A 1UFKA 3OVSA 4FW2A 3DRXA 1BI1A 3EGNA 4QR1A 1H6KX 4X65J 4JRIA 4NZ6A 2K3IA 3JCMb 2FLNA 3M32B 3PZPA 3CCSQ 1TMMA 3MMAB 2V8KA 4U7CA 1NLKL 5KFDA 2FEIA 2MOXA 3PG9A 4DV2J 3MFIA 4MKAA 3JB9G 4AFSC 1LWXA 1ABOA 4XTTA 3JCMV 4XK8E 1BI2A 5FLXE 3CMQA 4CO0A 1YRUA 2FPFA 3OR2B 4ZLPA 2AKKA 1C1BA 1RAGB 1ZH5A 1CG2A 3LGNA 3ZO7A 3I5BA 1LOJA 4ZCKA 4DPXA 2HGMA 3TEEA 1FDDA 3GPAA 3ZTSA 4J5OA 4DR1F 2E9TA 2VC1A 5GMKa 1Q4RA 4CTAB 2C3YA 2GO8A 3OFHA 2A1BA 3SXLA 1C0TB 4E98A 2LRQA 3W5ZA 4F7UF 6AT1B 2BM1A 3DXBA 2K9GA 4ZLJA 2RQVA 2VKZG 3OB9A 4FF4A 4L75A 3X28B 2EYZA 2G2OA 2PSZA 4RU2A 3KWMA 2GMLA 2AHJB 2KG1A 4LSLA 3ZTRA 1Y9OA 2FZGB 1R0AA 2QQ9A 4RW4B 3L2VA 1WNLA 3D7SB 2CPEA 5L9NA 5I2MA 2XLJA 1C1CA 1KQSS 3UATA 4RTUA 2GX8A 1S9GB 1I1GA 2DNKA 3MPDA 2UUTA 1ZM9A 5CKDA 2GVDA 4LSZB 4CYUA 3MAAA 4DFKA 2XM3A 2N4DA 4UC4A 4HDHA 4XO0A 2MK5A 1V3ZA 1K73T 1KS2A 4O0NA 4U8VA 2JUFA 2YKMB 3VUZA 4JLIA 2BJ8A 2YRCA 4DSLA 1NM2A 1XJWB 2RU9A 4PG8A 2P5VA 1S1TA 2XGPA 4LFCF 3JCMP 5A0LA 4RUAA 2MZRA 4EU0A 3QWUA 3EH1A 3M6WA 3BGOP 2DD4A 2KYMA 3CD7A 1NK8A 3GJRB 1WTFA 5B0EA 2IAJB 4Y6IA 1VDHA 2ZZTA 1B3QA 3FSIA 2HLTA 1Q86U 1B0VA 4DL0C 2HRYA 1AZGB 3W62A 1BKBA 2UXDF 4KRWA 4WYWA 3CJKB 1VC0A 3LALA 3NGPA 1XMBA 4WFZA 5L8RE 1LOUA 4ECRA 5KFMA 5J2NA 3PX0A 5LL6d 4QWCA 3CCES 1OI1A 3DDIA 3M2RB 2K3KA 3LGHA 3MFHA 3OYMA 4X4RA 4QVDA 1X4GA 3V7SA 4NCGA 2PGCA 3R97A 1VIXA 4M5LA 1VQ9A 2ED1A 2C2NA 3WVEB 2IY5B 1WORA 2BKOA 2JEFA 5BR8F 1M1FA 4B3RF 3OVAA 3M6VA 4FPIA 5LJ5Y 5CAAA 2GTJA 1VA7A 4EBEA 4M5DB 1TUGB 2QLXA 2EFPA 4F04B 3TZYA 2OUGA 3OPKA 5GMEA 3CCVT 4JLGA 2AYGA 2GFFA 2FHJD 1H7XA 2VG7B 4MIBA 2EPDA 3C3LA 1RSCA 4PNOA 1LWCA 5ETNA 1PRMC 2XY5A 1TTHB 2O9VA 1KK7A 2MSTA 2NPFA 4PQUB 4M78F 2XMTA 4QIEA 2E29A 1VQLA 2V8PA 1ZTWA 1FX7A 4C8QG 4HL9A 4KGMA 4DQQA 4NXMF 2X1FA 2JFKA 4ZOSA 3D2WA 4DEXA 4IFVB 1OYEA 2EXUA 2LCLA 2EPIA 2FLOA 2KHCA 2RHXA 4NCAA 5J2MA 4BDYA 4CLFA 1EP4A 4PWWA 2OKQA 3US5A 4WCEQ 2AJ2A 1IKXB 2WK4A 4DCPB 3BPSP 3JCMQ 2KKHA 4W98A 5FU6C 3MDFA 3KUHA 2M0GB 1VQ9Q 2RMLA 3J7AN 2DTHA 2PNIA 5HJYA 2E5LJ 5DDOC 4M7AB 2VG5B 4ED7A 2Q1LA 2E7WA 4ECTA 4FCYA 3K59A 2EYWA 3C12A 1JMTA 2NCKL 1K73C 2O9SA 3FIFA 4FSXA 3TAQA 1WEXA 1NKEA 2MZJA 5G0RB 3EHRA 5FWCA 1YJ9T 2K3YA 3H20A 3W7BA 3UNGC 4GVBB 4ELVA 4F4YA 2DNHA 4WP9A 3QZ7A 2HL3A 1VQLQ 3IRXB 1OMSA 2ZNZA 3FFIA 1U2RA 4WCIA 2JS0A 4TVAB 4KULA 1YG0A 1J5EF 1TG0A 2OEKA 5HP1B 2W4CA 2KPPA 5D6WA 5HMXA 3ZNUA 3M8QB 1AXQA 2RF2B 2OSRA 2FRYA 1FDNA 4WE1B 2DGXA 3VCDA 2RQMA 4DR3J 1D9FA 3I87A 2XHWA 3DLBA 5IAYA 2CDTA 2RB6A 1LW2B 3W8PA 2B9XA 1VQ4A 3PM9A 2CP5A 2PI5A 4DZDA 4OI3A 2DO3A 3GMGA 1KOHA 3EXCX 2C3MA 1LV5A 4HT7A 3KK2A 2HZYA 3KHHA 4RW9B 4DV7F 1Q1KA 3AA8A 4DXLA 1JLEB 3TJAA 3OTOJ 2GGRA 1B0TA 2HWTA 4L6V3 1L3VA 3VGVA 4MAKA 1RTDA 1K1SA 2M51A 4FF3A 4TY8A 1PYSB 3VQTA 1IKYB 2M5YA 1PSFA 1D3WA 1B7TA 1OPLA 2D1XA 5KFKA 3G8TA 3NWRA 1SQFA 3BEGB 1NG2A 3TSWA 2DXUA 4OHWA 3SZ2A 1NLOC 1RBOB 1R8PA 1JB0C 4E7HA 3MR7A 2I2LA 2YNIA 2Q79A 1VJWA 1HJDA 4DR6J 2ESWA 4R5PA 3GV7B 5DG8A 2ZC3A 2EQIA 3BGFA 3L2UA 3F0NA 1HBUB 3PMIA 3QIPB 2IM3A 1QKWA 3MI7X 4ECYA 2BDPA 4PUOB 2AP6A 1VQ8A 4UY85 3S7RA 4B3TJ 5FRNA 3CCJA 3OR1A 1VQ4Q 1N33J 3GNGA 2ABLA 2ADCA 1YZ6A 2DEQA 6FD1A 5GAMg 1Q81C 2HGLA 4E7IA 3MJXA 4Z7YA 1NKBA 3NAIA 5EG2A 2LQKA 1X31C 1UVJA 4PKCC 4RTYA 3JSRA 3CSKA 3H2LA 4IH5A 1FJCA 1NRKA 4N0AA 3HVTB 4FVCA 2J0SD 3O6QA 1XIQA 3M8ZA 1A7GE 4MFBB 2AEFA 4NLRA 2FO0A 1QLYA 1VRQC 1HI8A 5KFHA 2LJ1A 2CQ2A 4OJHA 1IWAA 2GHPA 1F9FA 4NL3A 4I2QA 4UZCA 4IR9A 3M0QA 1YJRA 3PKMA 2R8IA 4ED8A 1Y10A 3RBDA 2E66A 4CH7A 1D3BA 2LFVA 3NGTA 2JRSA 3H9NA 2XYHB 3PFOA 5I22A 3UCUP 4KGZB 5T14A 4OMPA 4PJNA 2V5HG 4E7ZA 4WIIA 3MEGA 3M54A 3N28A 1BB9A 2AX1A 1EKSA 3POTB 1BK2A 2QL5B 4B9SA 3CXCR 2NYIA 1B64A 1SV5A 1SSFA 2YUPA 3PYGA 5EWFA 4EMKA 5D6GA 5J39A 3RJMB 4DJBA 4U95A 4JYAJ 2DEJA 4N4HA 5B0AA 2NPIA 1X0FA 2EWHA 1VQ8Q 2R7RA 4TU8A 2LQBA 3F70A 3NTKA 1N8RT 3CCJQ 3M55A 2PVOB 4AXIA 5J1EA 5ETKA 3WDOA 1QP2A 2FHKA 2HKQB 1NDLA 4DPOA 1GMWA 1N5YB 4C0DC 2C06A 2XK0A 1KKHA 2FUG9 3NWGA 5EX0A 2E1MC 1Q5YA 1QAIA 5GAOm 1MROA 4PJOC 3MM5B 1BE4A 2C1EB 2BXJA 1X27A 1JNRB 2IM2A 1X4BA 3W5YA 2B51A 2R3VA 2KFYA 4WXOA 4KHPF 1FKPB 2ABYA 4BBYA 3MMCB 1MWYA 2JWNA 3I9ZA 4B3SJ 1GTHA 4GO5X 3CDUA 3M32A 4RZRA 1AUSL 2KSSA 2HHWA 3LYIA 3QT8A 4IO9Q 1VQ7Q 3RKWA 4FXVA 5GANf 3TZXA 4XAXB 3QJPA 1T94A 2D6FA 5KYWB 4PJOF 2J6UA 4PLLA 3PIPA 2XI2A 4JJCA 3AY0A 1XMOJ 4L74A 4JV1A 4QOTA 2HFOA 1N34F 4M5JA 3TYTA 3PKYA 3U1MA 3J7YU 2O67A 3DB3A 4KBIA 3W8GA 4UOFA 2HBQB 3MD3A 3ENWA 3OR2A 4ZVOB 2VB6A 4XAKA 2CPYA 4DLEA 2CQIA 2XBPA 3VAFA 1VQKS 4RTVA 4KJIA 2RB7A 2XYGB 1QSSA 3QPIA 2W4DA 5A8KB 2J9DA 2KXNB 3SIPB 2RUSA 1HBNB 1FWKA 3KDNA 1ELOA 3U23A 4CTAA 2VBWA 3T6JA 1XMQF 4ZVGA 2KRNA 4TQRA 1U6BA 1TUWA 1C0TA 1XNRJ 3IR6B 3LWMA 2UUCJ 4ZCLA 4CWBA 2YKAA 2DXFA 1WOSA 2L3MA 4C92D 2G2ZA 1HR0F 5LMUJ 1N48A 2VOPA 3CCQS 4DI6A 1Q86T 4EK2A 2LVWA 1RT3B 2GNCA 2JZ2A 1Q16B 3BQ0A 1KFZA 1BQMB 1NEBA 4RW4A 5EX3A 5JXSA 4HVUA 1CJTA 3META 2HHPA 5DZ6A 4D8KA 3CC4T 4ZPAA 3PGGA 3EVOA 1I3OB 2L3SA 2UZAA 1S9GA 4BI4A 3RRKA 5LJ5e 4Q5VA 4F25A 3VRYA 2DR7A 3TVTA 1JJCB 4C92E 2RHSB 3G8QA 4IUUA 1X9SA 3ETMA 4NLUA 4KT0E 2V8GA 2WW8A 4PYDA 2A36A 3PIPQ 3M4YA 5LSRA 2UVUA 4RNMA 1QP3A 4JOUA 3CE8A 2RM4A 5IC4B 1GFWB 3WC2A 1S6UA 2YKMA 1C1AA 2ZKUA 3R6NA 2HK2A 1RXOB 2L0AA 5DY9A 3DFEA 1G3YA 3QSIA 1PBUA 1R31A 4FPRA 3QSUA 2RQTA 1ROFA 2LT4A 3N6LA 1N8RC 1R8AA 3CD6A 1BXNA 1YJNA 3EGXA 4JZ4A 3ET6B 2IAJA 2YY3A 2LP4A 1FNOA 1K1ZA 3QGGA 1FFGB 2B9YA 2H8HA 2W25A 5FRMA 4F3MA 4X34A 4CLSA 4MKBA 4QIWD 1ZBJA 3SHWA 1O6XA 2L9NA 2QYGA 2DXBA 3CJKA 2AIRB 5CZXA 1NUEA 3UDLA 2DERA 1QW1A 1Y00A 2Z2LA 3I0RB 3KJNB 3GPLA 4M7DB 4ZN1A 3GJTB 3JB9k 1J2VA 2P6TA 1FX4A 1KWMA 4DQRA 2WSEE 2ZD1B 1VQNA 4M75F 1PHTA 4M1KA 3OTCA 4NA3A 5CR2A 3EVMA 1RE1B 3K89A 1VQPT 3KYLA 1YCYA 3RNJA 1Y96B 1T3NA 4K4WA 3CUNA 4CRJA 1CSJA 1S72A 3GOXA 3QJ6A 2KN4A 2ATLA 1VHFA 2F2XA 1X7VA 4PFOA 2HEQA 3OSPA 3CPWR 1Q8KA 5KFUA 3ZTQA 2MB0B 2OFHX 2VG7A 1MGQA 1WJRA 3JB9F 3T5JA 5L23A 5EDWA 2DNQA 3W9JA 4NLWA 3PTWA 3ZNJ1 3CD6Q 4PQUA 1EQ0A 3PR5B 3RAMA 1DRZA 3EGVA 1YJNQ 3RYLA 5LJ3e 4OYZA 2HVDA 3B8HA 3EPIA 2FVRA 4XTUA 2ZBIA 3V5RA 2FJDB 1T9YA 4XTYA 2ILYA 3KUFA 2R8HA 3CCLT 1WD6A 1N5SA 5B09A 2VA3A 2FPHX 1I0CA 4L73A 3KNAA 1G7CB 3TW0A 3TVYA 2F7VA 1VQNQ 1VMBA 1IKXA 3KHLA 2JX2A 3EWGA 5GAEU 2H5IB 3Q23A 4F50A 2KO1A 1TP7A 2GFAA 4Z2XA 2FVPA 3BZQA 4J9FA 1R8CA 4Z02A 3CCST 2XMFA 3KBGA 3P45B 4E7LA 4M7AA 2VG5A 2WONB 3D28A 5IHIA 2DE0X 4OL8A 1S72Q 2AGPA 1HNZJ 1CQMA 3QO3A 3BBBA 2HZVA 2D8HA 4CLKA 2DMOA 5G0RA 2YNHB 3HSJA 2JZ5A 4FNHA 3REAB 4NXNJ 4QQDA 1MMNA 4AE5A 3KFVA 1R27B 1S59A 2GCXA 4LFBF 3QG1A 4P2MA 3GIKA 1PC0A 4DFJA 3GILA 4GVBA 1RCOB 3G4SS 1F9HA 3Q8PB 2DVEA 2DITA 1X75C 4IFYB 4M78D 3V4MA 3DLKB 4JI6J 1X4HA 4RUCA 4CO4A 3HTRA 3KK3B 2LEBA 1JQQA 4CT8A 3TUPA 5F3TA 2ZM6F 5C42A 2BQUA 3DHWC 2GGPA 5HP1A 2MHNA 4P2XA 5GAN4 4ORZA 1EX4A 1VYAA 4P52A 3M8QA 2RF2A 2OTJS 5EN1A 4UZBA 1ZHIA 4IUVA 1NK0A 3JCMX 2A3JA 4M78E 3OYIA 2QASA 2LMIA 3RESA 2HNDB 4HVWA 2I0NA 4DV6F 1PKSA 1PD0A 1ARKA 2XQCA 1N8RR 1JLCB 3HKWA 1LW2A 2EVZA 4F2SA 2CJBA 2RN8A 1G3OA 3TUIC 1BCMA 1TL3B 3LP2B 4FXWA 5IOLA 2W9BA 4QBUA 1KQGB 1HSQA 3BO3A 3EAEA 2Z58B 1IN0A 4CNZA 1U47A 2QTWA 4CC3A 3DKDA 2KK4A 3CMES 1NB2A 1JLEA 2JMAA 1RWKB 3GE9A 2EC2A 3WIVA 5KOXA 2ASJA 3MP8A 1T9UA 4O4RA 1YITQ 3QIDA 3R2CJ 4FM4B 2LNHB 4XTWA 1IKYA 1IWGA 1U6FA 5J1NA 2K2VA 3H41A 2CQ0A 3C14B 3CTRA 3O8WA 4PQAA 5K14B 2IJFA 4NLYA 2BJ1A 3JCMf 3MZIA 1M5VC 2CSIA 3ADAC 2CZ6B 5ETVA 3IBFB 3CCUS 2UU9J 2PMWA 2IRXA 5C2GA 2V9WA 3H40A 4C8QF 3BE3A 1HYSB 2CFXA 1U1RA 5CQXA 1N36F 4OYPA 3E1SA 2CJYB 1F2HA 1WYXA 2EYXA 2RJZA 2M88A 5KFIA 2Y8YA 3QDFA 1HBUA 3QIPA 3C46A 1QVFP 4OYBA 4L3KA 2RDJA 1BI0A 1KN6A 4Q2MA 5IT9Y 3MUVP 4KFBA 2JMCA 4K2JA 2QA4S 2YLCA 2DPPB 1V29B 4QW8A 2QX0A 3OFGA 2PFFB 4QYZJ 2RE1A 2FDNA 1SQEA 1OS5A 4ZPWR 2EYYA 3IBCB 4ZVQB 3OYBA 3I56S 1Y71A 1YRTA 4J83A 2VD3A 3D6TB 1Q86R 2KM8B 1OX8A 2OD4A 2BZYA 2UUAJ 3HVTA 3R6GB 3KDOA 3OYGA 3IFEA 3CCZA 3J80Y 2R4FA 4MFBA 2V1RA 2V4QA 4YFUA 4J9KA 1AWWA 1QVFA 4WYLA 4NEZA 1KVKA 2XMVA 4IH7A 2HHUA 1WLPB 2XTJP 3M9OB 3C6UB 9ATCB 2JXBA 4QPXA 3PYFA 3OYLA 2EFQA 2F1LA 3T5KA 4JI2F 3L3CA 4J9OA 1GFCA 3RRHA 4YQWA 3SFUA 3KHGA 4DR7F 2AZ3A 2IPOB 3MPVA 1WG1A 2RI2A 1QQJA 3ILJA 2YWWA 3HHDA 3POTA 2XWXA 3UI3A 3NNHA 2MKCA 2W2NP 2D7SA 1J3TA 2LXIA 2G9OA 1IR1A 4A46A 1VQ9T 4LFAJ 5THWA 3BGUA 4UTGA 3MAQA 1AROP 3HHLB 3VGUA 4FT2A 3BFMA 4LD9K 2PO4A 1LKZA 3HHEA 3IM9A 3CJ0A 1K0XA 5JJBA 4PXBA 2W9AA 2FLLA 1S1WA 1B70B 1M3CA 1C4AA 4JB8B 4FBUA 1IM4A 3D9BA 2EC0A 4P2FA 1SL2A 4P5NA 5L1JA 2M4MA 1G3WA 3MM5A 4M5MA 1ZA1B 2COLA 1NK4A 1NJWA 4RO0A 4NLVA 1RLPC 2ERRA 4WFYA 2DY1A 2QN6B 3R7NB 2LDMA 3NFCA 4BB7A 4FSSA 1T11A 4C11B 2V4JB 3ULHA 2DCLA 3M2VB 1VQLT 2LA6A 1BIBA 1GQEA 1FKPA 2WSCC 4N76A 4FN5A 3A4TA 4ED0A 1WC5A 2GTOA 4R55A 2YWEA 3RDVA 2KRBA 2V2QA 2YKPA 4DV1J 1GEHA 4AG2C 1J5OB 4C0GA 2CPXA 4LQ9A 3VRZA 2KRSA 1W2BP 1UFLA 5KG3A 3HI9A 1D1UA 5KYWA 2ZZMA 3VVUA 5H9FJ 1TKDA 1GH8A 1JLAB 5GMKe 4RJVA 1TL7B 2VFVA 5FWBA 4LSNB 4B3MJ 1SRMA 5GJWB 1RWOB 4GKKF 4JV5F 1MN7A 4MT1A 4LVOP 2XICA 4OYOA 4I67A 1M30A 4BDPA 3CC2A 4ID5A 1HBOB 2HVHA 1M5KC 5B0DA 1GX6A 1OQ3A 5J2PB 1TH7A 1HBNA 2XD0A 2ZOGA 2HQEA 5KCOA 4WF9Q 2B5JA 2JEJA 3CO9A 3TU4K 2MI6A 1RAHB 1W2BA 2RPNA 3BM7A 4JI4J 1GNKA 3KUEA 4U9RA 1R6YA 2XLKA 1JKHB 1RT3A 2UXCF 2LA4A 3HSZA 2COZA 4DX5A 4OBIA 1BQMA 1WGSA 1BY9A 5DZ7A 2HFSA 2AWZA 4NWBA 2YUOA 3OL8A 1OYXA 3NNCA 1AWOA 2QE5A 3MXHP 2HBZB 2L3QA 2V8JA 1RTHB 3NEKA 4C5IA 3Q2SC 2HQ3A 5KFJA 1H73A 1QUVA 4PJOD 4LRDA 1K0VA 2G4BA 3PNWC 1WF2A 2MJUA 5GANg 3NGDA 4AT1B 1I8FA 3R5DA 1LNXA 1N5ZA 3LTOA 4M94A 3TAPA 3AODA 2KMTA 2VQEF 1YJUA 3C66A 2ZDPA 2VKNA 1VQ4T 4C8MA 1HBMB 1NKCA 1U49A 4JI0F 3JCMd 1C0UB 5IWAF 3V81B 2RIJA 4PJOE 1FEEA 1KQSP 3FQLA 1VYTA 2LLZA 3RERA 3IA0A 2FJBB 2AK5A 2PI4A 4K5RA 2ZWOA 3I0RA 4M7DA 2FHMA 4MMOA 3OJUA 3JQKA 2HAFA 2GQCA 1NHKL 1D1AA 2ZD1A 5DG7A 4TU9A 3RG6A 1V6HA 2EKOA 2N3OA 2QYZA 2B7BB 1GCPA 4LD6A 4KYZA 1TL1B 3G6ES 4C97A 1FFSB 1B34B 2EYQA 1Y96A 3MOZA 1FXRA 1KQSA 2F5TX 2RRNA 5D78A 2CQ3A 4LF9F 2W0ZA 3ZC4A 2PUKB 2MKKA 1H38A 4C0BA 4USJC 4XTXA 2FC9A 4GLKA 2UVWA 4KUDK 2VYTA 4F4KA 3R3TA 1WKLA 2BJ3A 4OX9F 4DDFA 3M8WA 2GMJA 3MPYA 1VQ8T 3JTNA 1CS4B 3GP9A 3D54A 2GQIA 1UVIA 2XG8A 3CCJT 1IJFB 2P8IA 4DOVA 5HKCA 2BZXA 1PRLC 2LJ0A 4RR5A 2YQ3A 2P0QA 1U1LA 2X1BA 4LFCJ 3C6TB 4A4HA 2O01C 2F8EX 1OPKA 5ETQA 3UE2A 3BDLA 1Q7YU 3H7HB 1NM7A 4ZLLA 3RW6A 5CKFA 2GZOA 2Y3YA 1SC4B 5GADU 1EIFA 4LRCA 2O4XB 3PIOA 4ETZA 2C2ZB 2UXDJ 5ECAA 4QVCA 2BKPA 1VQ5S 1LCKA 5GVQA 5C7PA 2RH3A 3KLIB 4C8ZA 4OQJA 4XDCA 1GL5A 4M75D 3G7ZA 1M5SA 2RS2A 4AQYF 3CJTA 4K4UA 4B17A 1FI4A 2VKRA 4Y65A 5K20B 3CCEA 3J81U 4E8UA 8AT1B 4MK8A 1EARA 4UUWA 1HHTP 1EKRA 1EFNA 2WONA 3CF5Q 4K4SA 4CO2A 3SB2A 2HBWA 3CCMS 1UA1A 3DLGB 1K8AU 3DU5A 3PACA 3UQSA 5BR8J 2F3JA 2DKGA 1FDAA 2ZOMA 4KKOB 1X9WA 2RK2A 4PG6A 1RT5A 3L7OA 5HMYA 2ROLA 4G6VB 2UXBF 2DVIA 2QMUB 2HZCA 1N56A 2DLPA 3ILIA 4A0UA 3A12A 1SC3B 1FESA 4JBCA 4YEAA 1E6YB 2GIQA 3QYGB 2MKSA 1MW7A 3NOCA 4G1PA 3KOAA 4OB3B 4IFYA 4MTPA 1SKSA 3BH6B 4BI3A 2PD1A 5L1IA 2CZ1B 4B9NA 2QEXS 2HQCA 2Y90A 4CO1A 3H8YA 1DAXA 3W1YC 1M1KC 4GO7X 5D6XA 2CT3A 4PPZA 3MR3A 2N7CA 4QYZK 5JUMA 2ZFHA 2NR0A 4A4JA 1REVB 4NXMJ 1ZOTA 4BY6C 5IT4A 3PIOQ 1P6TA 2R8GA 1QVGP 3I32A 4ZP8A 2CH4W 4PRFA 1ZTTA 3ZZOA 2M0YA 3LOUA 5C25B 2DCUB 5DM6Q 2HNDA 2E1AA 1RT4B 1CJVA 5GAGI 3M5AA 1NMEB 3DLJA 3ISZA 5GJVB 4O4GA 3CCEQ 3TVKA 4BC7A 2XDBA 2LDIA 3HFZB 3LP2A 2MCNA 5KYYB 2IM1A 1UMJA 1T8EA 2X1AA 3MM7B 3VJPA 1JBMA 1TV6B 2P0PA 2X1GA 3IWNC 1WOOA 2CNNB 5HL7Q 3FC9A 2DZ9A 2MQNA 4DN9A 2V2ZA 2HYIB 1IKWA 4PABA 2DRDA 4Q8FA 3M1VB 2F65A 1X60A 4JI8F 3BW1A 1U48A 4EWTA 1MMAA 4Y2AA 1U26A 4RW8A 5LXRA 4M77C 2XI3A 3C14A 1BI3A 2VASA 1MUZA 5E3RA 4CLYA 1T05B 2LMJA 5K14A 1C4CA 4KGXB 1YKWA 2UV8A 2ZWPA 1M9SA 3OYNA 2QRRA 2RA2A 3HZEA 4AFFA 3JYTB 1JX4A 2V1QA 1FA0A 4UW2A 5H1SV 1U1TA 4QU6A 2RQUA 4WZMA 3OYCA 3BO2A 3LP0B 3TVZA 1WPYA 4LDUA 4N0AC 2B0GA 1F0XA 5EC7A 3X24B 1VYUA 3DNCA 4KAIA 1TKTB 4OHYA 2XDPA 3OXGA 5K8PA 2OPRB 1Z1ZA 3U1NA 1RKJA 5CIUA 1WELA 4P74A 1UVLA 2FG0A 3G82B 2DGSA 2LZ6B 1X6GA 3URGA 3D3BJ 2R7TA 4K0KF 3FMBA 1YIJS 1U1KA 2LVMA 1CJKB 1LEOA 1ZQ1A 3L2RA 2PVGB 5CYJA 3IG1B 1C6VX 1ZPWX 3GIJA 2NUPB 3TUJC 1UVMA 4F8RA 3M9MB 4IQMA 5KFOA 2NYHA 1AHJB 4RTTA 1JU5C 2LQ9A 2VQFF 2O31A 3AD7C 2EVRA 3L4BC 4DUZJ 3IM8A 2P84A 1TK0A 1WXBA 2OI3A 5H9FK 4EMKC 3LQVA 1L5UA 1AD5A 2E9ZA 2FRWA 2DNZA 5HROB 4DV7J 2AT1B 1PJ7A 3K5OA 1YP5A 2DT9A 2DXEA 4IQXA 2ZZNA 2NREA 3CD6T 3LH2S 2DA9A 4KUIA 1YJNT 3GIBA 4XU0A 1SH3A 4OV6A 1WKKA 1B0PA 2L8DA 1S4FA 1OIAA 1Q5VA 5DGAA 3C6UA 3PRBA 4Q43A 1JLGA 4PZVA 3LW5C 1T3LA 3KTQA 1WOPA 3OBYA 3DMJB 4XK8C 2HKEA 1TXQA 5E3CA 3VYHB 2JJ4D 2CQDA 3OY9A 3D6FB 3JCMg 4ZVUB 4NCBA 3V7RA 3L9ZA 3E9GA 1DTTB 2DY9A 4LJMA 1VQ6S 4U96A 1JJHA 4C8QD 5HQLA 4FYXB 1VQNT 2J0QD 2G1HA 4I69A 1KQ1A 2R2TA 3KMQA 4DR5F 4M7DG 1FK9B 5HLFB 3GFYA 1RP5A 5BYQA 2DAQA 3R27A 3M6UA 1W70A 4NPOA 4EYHB 5GAN5 4YB1P 3MEDA 3HHLA 4AFZC 1S72T 2RILA 1Y3KA 3PT9A 3NHNA 3A8MB 1NEEA 4EYIB 5CYMA 1BHNA 5FW9A 1EETA 1FD2A 2Y4YA 1T0JA 1OEBA 1MNDA 3MCSA 3LH0A 3IQLA 2PIIA 3BGLA 1NPKA 2O3DA 5CXTA 4R56A 1R0CB 4LIRA 4JI5J 2FIUA 1FHTA 5AXNA 3CMAS 5KT5A 2HBPA 1T02A 3V4IB 4C5EA 4C11A 3DRSA 2V4JA 3ZTOA 3M2VA 2HNZA 3IBWA 4K59A 3IWXA 3AB4B 4ZPCA 2E5KA 2BOAA 3T1AA 3HVRA 4WK1A 1KRPA 3L95X 1K0SA 5B0FA 2KB2A 4EIKA 2FC8A 4MZMA 1SHFA 1VBZA 4M77G 3PR4A 1IBKF 2DBKA 1VGYA 3MP6A 4USWA 3JTOA 2G0CA 2BEFA 5I3PA 3QWXX 4YR2A 2AYEA 2L9DA 5KG2A 2KROA 3MURP 1I94F 4DV5J 1TL7A 2OPPA 3R6OA 5I3UB 3DOKB 1QWEA 3GIMA 3B82A 2KY9A 2I38A 2BANB 1OU8A 4F3QA 2K7KA 2F69A 5L1KA 3LGMA 1Y4ZB 3HXMA 2DR9A 5DDRC 1HBOA 3E01B 2Z2YB 3VGTA 2XWYA 2X3DA 3RR7A 2C2DA 2XCPA 1N88A 4G65A 2HHVA 4WBFA 3ZFVA 2E10A 5J2PA 2OJ2A 2XULA 2Y8WA 3RR6A 1DHMA 1VIEA 4TN2A 4HH0A 2DILA 3MCNA 1XBWA 1NH8A 3EG3A 5FDLB 4ZHRB 3P8BB 1AVZC 4DF4A 4ER8A 1QE1B 1E6GA 3UW1A 4HH1A 1N9SA 1WJSA 1FJGF 2VGNA 3QMQA 1YRXA 2ZC4A 2N82B 3DCAA 1BBZA 4I4BA 2Y1RI 4F4XA 1JKHA 3RBZA 1ABQA 3AT1B 1SXLA 2FB7A 4UF4A 3O44A 2VBXA 1LW0B 2W8KA 1PYOB 3CCRS 1RTHA 3MTJA 5IHKA 3REBB 4M5NA 3KJQB 5A2QU 5C0MA 1YJWA 2K8GA 3V6JA 5A0YB 2DXCA 5A0GA 3GYXB 4II1A 2DTJA 2V8DA 1NDKA 4C48A 4I6WA 1JRIA 1IRXA 2YKNB 4HCKA 2BR0A 3M8YA 4TLRA 1MSWD 2KG0A 1X5PA 4LUBA 1NZ9A 1WDTA 2JNGA 2EG1A 2JL9A 2C0TA 4UT4A 1UJYA 1HBMA 1IBLF 4CLPA 1SL1A 1C0UA 1VQKA 5IV4A 2CA9A 3V81A 1G6BA 5ETOA 4C8YA 5FU6B 2HBRB 5ETSA 1Q7LB 3HSGA 3OHAA 4O44B 2J06A 1S79A 3Q2TC 5E41A 2DRMA 4W4MA 4ED6A 3GF5A 1HNIB 2FTRA 1VRTB 2WSCE 2RH2A 1Q7YT 1N27A 4MYUA 5HMZA 4NLSA 2QQRA 3K7RA 3CCQA 2QMXA 3GBQA 1U0SA 3VAMA 4HLBA 2MPUA 3VS4A 1SVDA 5FLXU 3BN4A 1SJ4P 2Y1JA 1CKBA 1TL1A 4IDKB 2ADBA 2VF3A 4YTLA 1B34A 2EFVA 1URRA 3EDQB 1YJWQ 2HHHJ 1QLNA 1UJ5A 1F60B 4F67A 2GF7A 5AXLA 1ZS6A 1YNZA 5KFCA 3CULA 4DV4J 2QLBB 2I9SA 5M2RA 4NYPA 3KG0A 4EGLA 2D9OA 2PFDA 5CZVA 1S1NA 2LJ3A 3ITHB 3MAHA 3A3PB 3U7JA 5DGBA 1K9MU 3OTDA 2R2SA 2CXEA 4OZ2A 5GAMe 1UP1A 5HY6A 1DBDA 5EHHA 1CS4A 4PXCA 1S6PA 1KC8U 2BE7D 1PKTA 3A1PA 4HACB 4MK7A 3K8VA 3C6TA 1S48A 4ESRA 1VQKQ 3FJPA 4QQ6A 3O2IA 4A8XA 1HXDA 3G6VA 3K57A 3MECA 2HGNA 3VS0A 4L5GA 4DPTA 2H5JB 1O9SA 3Q8RB 1O5JA 2KYZA 2RQWA 3QT5A 4NYZA 5KFNA 1PC4A 2O4XA 4JI1F 2RK1A 4M7AF 3QWPA 4OI4A 1TS9A 3HPWA 4ZTFA 3KLIA 3CCQQ 1U2FA 4C5GA 3QATA 4J9HA 2HMAA 2AHOB 4N47A 3DRRB 4USHA 1NEGA 3K5MA 4N8OA 2EWNA 4JI3J 1RJJA 2R7OA 2HS4A 2RSQA 2RI3A 4U67Q 3HHKA 5K8OA 1D9AA 3QRPA 2XSFA 4FS1A 1U5SA 4KKOA 1GT8A 1Q82T 1MN9A 2KJWA 4DEZA 3LD7A 4ED5A 4N56A 3W60A 1YN8A 5F8LA 3RMQA 3HO1A 5K8NA 1VQOS 1Q8BA 1BCOA 2RMOA 3G6YA 5FD1A 4NA1A 3UD3P 1I81A 2VWFA 1OZ2A 2Y1LB 3IGNA 1E6YA 4B9MA 2AMCB 2QGFB 4OVAA 4Q0BB 3BJYA 2DHGA 1NJIU 2Z2MA 5MAOA 3CD0A 4KGVB 5KFPA 3EGWB 2AJ0A 4RG8A 2EKNA 3OHBA 1SC6A 2JOYA 4DOZA 4DV2F 1SF9A 4GVLA 1QAYA 4QZVB 3R5BA 3CC7S 1KHWA 3FSXA 2EFGA 1R8BA 1W25A 2RS8A 3SDEA 4CP5A 3WC0A 2XSJB 1FMVA 1GCQC 1XWLA 2LCCA 2JVOA 1D8ZA 1QCNA 3NBPA 4HHJA 2RQRA 4HVZA 5C25A 3J7ZT 2NXJA 2BM0A 1RT4A 2DO0A 4BACA 1S76D 2YTCA 5CAIA 3OW2S 1IKVB 2UVVA 4MDXA 3SD4A 1S1XA 3K5PA 3BR9A 3HFKA 4QU7A 5KYYA 1K76A 4QW9A 4FBTA 2EIFA 2EQKA 3MM7A 3I9QA 2XMWA 1TV6A 2A2CA 3IGVA 2PVDB 4J9VA 4Z7CA 4O3RA 4A8FA 2E1RA 3CJ3A 4HA8A 1NAQA 2J76E 2CP6A 3V6KA 2ZPBB 3UCGA 5LJ5d 2JVRA 5CKHA 3P8HA 2O01E 4JRQA 2WVDA 5DO2A 2EQMA 2MLXA 1M90U 1T05A 3ZZ0A 2DNRA 2PE8A 5J2QA 1LWEB 3PJXA 4LFBJ 3GSIA 1WJQA 3ZBDA 5KH6A 4LF5J 5F8NA 2A3LA 2QTXA 3QBYA 1ULRA 3G4SA 3GU0A 2J9CA 4E47A 1YLXA 5K8MA 3DXSX 2M3DA 1YFNA 3HCXA 3LP0A 2BVZA 4F36A 2XS2A 1NE8A 3UN3A 2BMBA 2ZM6J 2HSEB 2HD0A 3R2DJ 1ZZNA 4IG3B 2G3RA 1IHVA 3ENAA 4C0DB 2L08A 3G82A 5JVGQ 4FKYA 2AJFE 2O88A 4MJKA 3TP2A 2YH0A 4PJOB 4LF2A 2ZH7A 4JUZA 2OTJA 2AGOA 4ZVRB 2G6FX 2FGCA 3AH6A 2O5DA 5KFXA 2FVQA 2NUPA 4J7CA 2JFDA 2JJ9A 3VZIA 4BCAA 1SB6A 4DV6J 1TKXB 2KTQA 4P73A 5F8JA 1IR2A 2KU7A 3DDKA 3F44A 3BKTA 3JAMY 2XEXA 2DGVA 1Q82C 1TUCA 2E1HA 1SJRA 2QA1A 5FJ4A 5KFYA 1KQKA 3CMEA 1K4US 5HROA 2K7AA 3CDWA 4HT5A 5EUHA 4USIA 3HD2A 1SIZA 3P49B 2F4VJ 2IA0A 4XTZA 1BWEA 3OT9A 2B43A 1YHQS 4JP8A 3S01A 1R89A 5CHCB 1NK5A 1HNVA 3OFEA 5AXMA 1W1FA 1L3TA 4LR8A 2AGQA 2EFOA 3H25A 3G4SQ 3DMJA 2X4WA 3VS3A 2RT3A 4B3OB 2QDLA 1X69A 3FUYA 2JTFA 4PG5A 3CCUA 1IJEB 2YQ0A 4M5HA 5DRKA 3HHNB 3G2XA 1JIHA 3NP5A 2AZ1A 2JS2A 4K8RA 3MPUB 1M5OC 1UJ4A 5IT9U 2GW8A 3H90A 1FFWB 1T3OA 2CYYA 2W7OA 3M53A 3GV5B 2YPZA 4ITSA 2DGWA 2DKOB 4O3OA 4CC4B 4DV0J 3TX0A 3JSYA 3PDNA 2HQHA 5DDQC 2M8DB 3KKFA 4ZS6A 2FYXA 3HVWA 4IH6A 3UVJA 4H4MB 1FE0A 2JNJA 4J9EA 2ASYA 4X64J 2RJEA 3JCMh 4CI0C 3W2WB 2XB2D 4E0DA 2QA4A 2XMKA 3B4DA 2RRAA 2JVVA 1S1UB 1WI8A 1Q7YR 3CMEQ 2SRCA 1H92A 3OD2A 4L6V5 1TAQA 5ETLA 3I56A 4UOHA 7FDRA 2M52A 2GQVA 4OJ3A 4C9DA 3AOCA 1CULB 4C92C 4YB6A 4A54A 4ZKAA 2RDDA 3PTAA 2KH9A 4DBQA 5JMNA 3DLLA 1N0VC 2CUBA 4C8NA 2E5LF 1ACMB 3MHXA 1S57A 1JLBB 1X6OA 1LFPA 2UVRA 4JS5A 3KLGA 3NGKA 4XIUA 7FD1A 2NXEA 4NASA 2YT6A 2PEBA 2AX0A 1YTYA 5KYXB 2HAIA 4DCJB 4M95A 3IAM9 4B9LA 1RT1B 3RAQA 1SUQB 2EGEA 3VHQA 2K57A 1N4LA 3CCUQ 1RWVB 1JXEA 4JI2J 2CNLB 2BKDN 2X9HA 2E5GA 1AWJA 1IXDA 2IDEA 3OYJA 5I3UA 1KEKA 3FMWA 3N0VA 4PCQA 3TZZA 4A8QA 4MMLA 4R8UB 3VVTA 1H74A 1NJYA 1M2VB 4H4OB 3CCET 1UPMB 5HATA 1N9RA 3E2UA 1GMWD 1VS3A 1CLFA 5IT0A 3I0SB 4HYKA 4PJMA 4KO0B 4I0WA 1RAFB 4KRTA 1ZAWA 5LSLA 1WC4A 2G0IA 1WXTA 2GCFA 5B08A 3CBOA 4BUGA 2KT2A 4AUKA 2L5QA 1UWBB 3CT9A 4NE9C 4XDDA 2WSEC 3CQTA 4NLGA 5FDLA 3VR1A 4IRKA 4ZHRA 1CJUB 2QA4Q 5M2UA 2E5JA 2BE9B 4Z37A 2W2OP 1DQ8A 3V8KA 2FLPA 4DR3F 1WC6A 3I56Q 3LW5E 1QVFR 4C8KA 1Q8LA 2ZKTA 3DLLQ 2HSPA 1LW0A 3LO3A 2J7KA 4NMXA 4D3HA 4ECSA 5DETA 2V0NA 3M6XA 1SIWB 2WOMB 2A18A 4J7FA 2DHHA 2DHSA 3DLEA 1ZM2A 3GCWP 5A0YA 3GIRA 3UWTA 1FKOB 4LREA 2JC0A 2JM8A 3HRUA 3DOLB 1PO6A 3CCWA 1H98A 4DBHA 5I4MA 2HLUA 2DXDA 1H3HA 1U09A 1Q82R 3CDEA 1UJ6A 4OYIA 2V8IA 4ZLNA 1CKAA 2CP2A 3VS6A 4EMHA 3G87A 1S1VB 3TR5A 4OZ1A 4V2SA 4LUEA 4YMEA 3KMSA 1Y57A 1NSAA 1U8SA 4LIWA 3D6HB 4OYAA 2CQHA 4NLTA 3EG0A 3H98A 5GAOr 2QXFA 3TUZC 1YCSB 4P71A 3PCOB 3OL6A 4VUBA 5FROA 2AZVA 4M7DF 4Q45A 3MEUA 1FNMA 3V6DB 1T0HA 3Q0AA 2NUTB 1D8YA 4DR6F 2J9DE 1VBXA 2XMAA 1IVZA 4O44A 3OFFA 2POKA 4YN3B 1KD1U 1HNIA 2X4YA 2J8AA 1VRTA 4OB2B 4GRSA 3IP0A 2HHXA 2B4PA 4FF1A 3H0IA 5KT7A 3KG4A 1A6LA 4B3TF 2H4YB 3WBZA 1WEYA 2F5GA 1N33F 4WTOB 1OU9A 4NA2A 5ITHA 2UXCJ 1SBRA 3LGLA 2JSXA 3JB9I 2OEJA 3GR0A 2DL7A 4ECVA 1VR6A 3EZ5A 4AFUC 2PA8D 4DL7A 1RTIB 5M2PA 5ETPA 4AL7A 4C92G 4ZGJB 2CKWA 2E3IA 3CVKA 2CP7A 4CO5A 2MQQA 1HD0A 1TAUA 2OAWA 1XNQF 5CKEA 3FB9A 5T41A 3HP9A 3ITHA 2VDIA 4JJDA 1N6AA 4OZJA 3SYZA 1I6JA 4ZVFA 2CZVC 3PVLA 2M9KA 1HWUA 1ZA2B 4ZGDB 3KJFB 2DM1A 4RBVA 3NTIA 3V7CA 1V9OA 1RA7A 3C95A 4R25A 1WC1A 4KQZA 4HACA 2VQEJ 1WI6A 1VQ7S 3I4HX 1W2BR 4C5HA 3RKXA 5AE2A 5FU7C 4RMOA 3S6WA 1WHKA 4LQ3A 4R0JA 4M78C 4GBQA 1NJIT 2MYSA 3BH7B 2DRKA 1QJHA 2E5IA 1Z9ZA 4L76A 2O66A 3N4WA 3HKZD 2E12A 2OMOA 3J81Y 5CCLA 3JCMJ 1KG1A 1SKRA 2W1BA 3EG2A 1VLOA 2R58A 1PM3A 4A47A 1GRIA 2P2CB 1RABB 4C8OA 4CLWA 2Y1IA 2BA9A 4ZDNA 2YXYA 1WHXA 3BSOA 3OYEA 4J8OA 4HI2A 4LF7F 4LNPA 3DRRA 2CREA 1K0TA 5D6YA 2VJVA 5GAOq 2CPDA 3G6EA 2HCKA 4HI1A 2RU3A 2KL8A 2C2KB 2CJXB 2DK2A 2HRUA 1DURA 4NRTA 2R8JA 2ZAEA 1UKUA 2JC1A 3Q83A 3CJQA 3MEVA 1WF0A 4JS4A 4DUTA 4CH1A 4I6YA 3D67A 3MCMA 4X4UA 1HL6A 1YVFA 2GV1A 1F5BA 1RLCL 4B3SF 2WBMA 2WVBA 1UTAA 3KLFB 3PW5A 4QWDA 1S6QB 4Q0BA 4LBHA 2RF0A 2NS1B 1AFIA 3WX8A 3KLHB 4ME7A 4YP3A 2P4TA 1MWZA 2W01A 1FTRA 1SH2A 1IB8A 3NMRA 2KRMA 1XMOF 4LRBA 4PLIA 2MQOA 1HMVB 4URQU 4OFZA 1UWAA 2DRBA 3EG1A 2KXDA 1S6OA 2DD8S 2JEGA 2A10A 2XSJA 2QA4G 1QVGS 2K4YA 4OF1A 1QCOA 3FCHA 1YWOA 5KE3A 4J6XA 2HZAA 2VH7A 1FCAA 3VKIA 4M7AD 4GKJF 3IN5A 3T3FA 1Q8IA 1VQ5A 4ZVEA 3SWNA 2GMHA 3CCTA 2PEHA 3NY0A 3RUBL 3HRTA 1AUDA 4C3MA 1Z2LA 2YBVA 1KQSR 1XN9A 2VJUA 1IKVA 1CC8A 2DL3A 1XNRF 4AQYJ 1H8KA 1RHMB 3CEDA 2UUCF 2CZ0B 2ZHAA 4QJVA 2C3OA 2CP0A 3MM6B 1EQMA 4RNFA 5LMUF 1T9WA 2WAQD 2DTIA 2KVQE 3CCMA 5LJ3Y 4X9DA 2K5LA 1CC7A 4M7AE 4HCZA 3EGZA 3EDRB 4PXDA 2HKNA 4XU1A 1XEZA 3R5CA 4WJBA 4DR2F 2V2KA 3X20B 2WTFA 1VI7A 4ES1A 1LQ9A 4ILMA 2NUHA 4ILLA 2YHTA 4CC7A 1JJ2P 1EAYC 1LWEA 3U1LA 2RQKA 3Q1JA 2EG2A 3OTEA 1OSDA 1BC6A 2F63A 2XY7A 5KCHA 2E6NA 3GFXA 3NCRA 2IA6A 1H3DA 2F8MA 2QEXA 2KAFA 3UA6A 2IC3A 4C8LA 4J9LA 1O51A 2W2QP 1G1XA 3EHQA 2DYAA 1K9AA 2PMZD 3PRVA 3N5BA 3I55S 4IG3A 3I5RA 4M78G 3QYYA 3K0JA 4Z88A 1VQ5Q 4JPBW 1O75A 4HKEA 3PX6A 2QMWA 1PCXA 1VK8A 4UY8T 1B99A 2Z0GA 1YJWT 4R0EA 5GANe 1UZHA 2VOOA 3HJFA 2HDAA 1TKXA 3K5LA 1DQAA 4X4OA 2MWPA 4PR6A 3M56A 2PA3A 2Z8QA 2D3O1 4LN2A 1OO0B 3CCMQ 2EKYA 2QQAA 1V3RA 2R7QA 1WTBA 1P1TA 1HWIA 2VXEA 3QHSA 4ZN3A 3RBXA 3A8OB 3OV7A 4EO6A 4HTJA 4QQBA 2W4PA 3C2PA 3NGSA 1R0AB 4BE0A 1VBKA 1TKZB 2COWA 1EIYB 2DNNA 3ONQA 4CM0A 4JI8J 2APOA 1VQKT 2AV5A 5GAOl 3G71S 4UQTA 1D0YA 2RO0A 5IN1A 2JLGA 4PK4A 1A0OB 3D0GE 1REGX 2W8LA 1TSFA 5E3AA 5DLOA 1RAOA 2Z56B 3BR8A 2EQUA 5KFAA 4B3OA 5F3ZA 3T9NA 5KOWA 4AYBD 2EJGA 2AJ1A 4W92B 4OMMA 1LJOA 1XQHA 2MSSA 3CCQT 4A4EA 1JLQA 4DQ2A 1T03A 5B0CA 3EPGA 3H4DA 4TYAA 3H4BA 5I21A 1QSYA 4NI2B 2OPQB 1K9MR 2VFUA 4EDUA 4CH0S 3LPYA 3KFWX