1NPPA

Crystal structure of aquifex aeolicus nusg in p2(1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 53
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nppA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nppA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nppA01
1VQKT 2MI6A 1N8RU 2JVVA 1K8AC 3CCET 4X34A 2MWPA 1VQ7A 2K06A 3LPEA 1VQMT 1K73U 1M90C 5J26A 3CMAT 2E6ZA 3LGFA 2OTJT 1NZ9A 3CMEA 5J3BA 3CCSA 2KDSA 1M90U 1YJNT 1Q7YU 1K9MU 1YI2T 3CCRA 1KD1C 5DM7R 2MWOA 1W2BA 1KHIA 2G3RA 3OYYA 3CCLA 1Q81U 1W2BS 2OTLA 3G71T 1VQ4A 3CXCA 1Q81C 1YHQT 3CC4T 1QVGS 3CCJA 5IT9E 3G6EA 1VQ7T 1K8AU 2LQ8A 1QVGA 1YJWA 3CD6A 4QQDA 1NJIU 1NPRA 3P8BB 1N8RC 1YJ9T 1X6OA 3I55T 3A5ZB 2E70A 1YI2A 1YITA 1M1KU 1VQNA 1Q7YC 3G4SA 3CCMA 3CCQT 4ZN1A 2CKKA 2QEXT 1Q86C 2KVQG 3J7AF 5FLXE 3CPFA 2JOYA 3CC2T 1VQ5A 1YBYA 1VQPA 3EWGA 3H7HB 1VQ9A 1YHQA 3LH0A 1VQKA 2DO3A 4ZN3A 1Q82U 3CCUA 3LD7A 3OW2S 1VQ6A 3CPWA 1KC8U 1VQMA 1XTDA 3TREA 3CC7T 1RL2A 1S72T 2OTJA 2JUFA 5LL6S 3CCVT 2L3RA 2LVMA 3LGLA 1YJNA 3I56A 1YIJT 3KBGA 3CCRT 3DB3A 1JJ2S 2QA4A 2QEXA 1QVFA 1M1HA 1VQOA 1VQLA 3PIPA 1VQ9T 2EIFA 2LCLA 1QVFS 1NPPA 1Q86U 2IG0A 3CC4A 3DLLA 3QQCD 4CRIA 1VQ6T 5HY6A 3CPWS 3CCST 1EIFA 1YJWT 1KQSA 3CD6T 1M1GA 1YJ9A 1UEBA 3I55A 1NJIC 3CCLT 1XNIA 3I56T 1YIJA 1KC8C 1YITT 1VQ8T 2OTLT 1VQNT 1JJ2A 2QA4T 3G71A 2XHCA 1VQ4T 1IZ6A 1M1KC 3G4ST 2OUGA 3CCMT 1K73C 1SSFA 4OBIA 4ESNA 1VQOT 1VQLT 4TVRA 3J81E 3CCJT 3G6ET 3CCEA 3J80E 3CC2A 1VQ5T 4YTLA 5DLQE 3CXCS 1KD1U 3ER0A 4RG2A 3CMAA 3CCUT 1KQSS 1K9MC 3HKSA 3CMET 3OW2A 1NZ8A 1BKBA 5IAYA 5A2QE 3CC7A 2JNGA 1S72A 3CCQA 1VQ8A 3CCVA 2KPPA 2EXUA 1VQPT 3JAME 1Q82C 3PIOA 3DB4A
chains in the Genus database with same CATH superfamily
1Q8LA 3M0QA 2XCPA 2PN6A 5GMKm 2DHGA 3R97A 1HXDA 1NRKA 1ZYQA 2RF2B 3JCMJ 2AWZA 4WBFA 2EGCA 2YUQA 1OV3A 1QVGS 2G0IA 4I7FA 2QASA 2O88A 2E1RA 1KSWA 4G1QA 2EFIA 3K5NA 3SYZA 3KKFA 4WFNQ 4DZDA 1X7VA 3THTA 2E64A 1J5EF 2JSXA 3M8QA 1S9FA 1CSKA 2HK2A 5C2CA 2PNIA 4OF1A 4I0WA 1VBYA 4LDVA 2FLLA 4DR2J 2DIVA 5KG2A 2E3HA 1KLMB 4ECVA 4HT8A 3CDBA 1S76D 2VC8A 3OS0A 4OYIA 2XY7A 5KFFA 2AYMA 2YNFA 4MDXA 5DZ7A 4FYDA 3RR7A 2QSWA 4OI6A 1BUXA 2JEIA 2AKLA 4C8QA 3CD0A 4N56A 2C22A 4ELTA 4QQGA 1ZUYA 5KT3A 4DBHA 1U1RA 4BD3A 1SL1A 2K6DA 2WVBA 1IGUA 4F4XA 2OTLT 3CCEQ 1P6TA 1FEHA 3C14A 3M53A 4RUAA 4PXEA 4N0AC 4RKUE 2B8AA 5L46A 1ZBXA 4A8SA 1JIHA 2ZD1B 2A37A 2G2YA 5EX0A 4X9CA 1IKVB 4J9QA 3F70A 3B54A 3HRUA 2ZUGA 3KDNA 3UFCX 3B4DA 2EXUA 3JAME 1VQKT 5A0GA 2EYYA 2IA0A 3T19A 1FVSA 2NREA 2DEJA 1FJGF 2FD2A 4C5GA 1D3BA 3FBBA 3GIKA 2VBWA 4DLEA 1RKJA 2XZTB 1XWLA 3S6WA 1WSVA 1HNIB 5IC6B 3PR4A 2ZDPA 2LEPA 4XTZA 1SC3B 4OI3A 1K8AR 1YI2S 1S79A 2F8EX 5C42B 3BDUA 2CPDA 1EX8A 2XI3A 4JP8A 2XS7A 1V9OA 5GMEA 2IVMA 2GBQA 4JUVA 3ELHA 1A7GE 3TAMA 1RADB 5D3GB 4C0ZA 3M7VA 2RI5A 1CEZA 2YX1A 2HVHA 4F4KA 3FB9A 2LX9A 2HDAA 1YJ9S 4UTGA 1VRUA 3DRPB 3O6QA 3KBGA 3CCMS 1FXRA 1TKTA 5LXRA 5CR2A 3R1HA 3OMCA 3LWIA 3D9BA 4FL6A 2FC9A 3NHNA 5GAOn 2B9WA 1S1NA 2HRTA 2XGPA 5IT9U 3MUMP 1RTJB 4OYMA 5GMKi 2EQIA 3AT1B 1UEBA 2YNGA 2R57A 1TKXB 4W90B 5D77A 1SHGA 1IBLF 2CNKB 2RDIA 2KRNA 4B08A 2J6KA 4J9CA 3CC7Q 2B8QA 2DLPA 2X3WD 2CQ4A 4JI5J 5D4NA 3CEYA 1FK9B 2W9AA 3K5MA 3WIUA 1OYDA 4ZJQA 2YUOA 1TK5A 2K3YA 2FHOB 3LPEA 5ETOA 4ECSA 1Z9QA 5EWGA 3ILOA 2MZ1A 2MK5A 3PYGA 1BQMB 3M32B 1T9WA 4ZPDA 3PE0A 2OSRA 4N4IA 1NE8A 4IG0A 3CXCA 3E2EA 2OH2A 2MQNA 2D0QB 1HNXJ 2NUPA 4Y2MA 4C5EA 5KCOA 2F9DA 4FSSA 5KFCA 1J5OA 3NGUA 3CCQT 3UA7A 3N01A 4DMZA 4DV1J 4MYTA 4P2MA 2RS2A 4N7TA 1IVZA 4L76A 2ZJPQ 2CQIA 1UECA 3OXLA 4PK4A 1XERA 3G86A 5DGBA 1IBLJ 3W3SA 1OWXA 1XQIA 2HBRB 1S7IA 2EWHA 2ZC4A 5GAN8 1HWIA 3QFWA 3UN5A 3FZBA 2DK2A 1YFNA 2C2ZB 2CP2A 3VS1A 2FZKB 3AD9C 2WSFC 1N33F 4PZVA 2HAFA 4F4AA 1R0CB 2MEWA 3MUVP 2CADA 1KOHA 2RQKA 4ESNA 4OMQA 2K7JA 5MLCV 4MAKA 1YJNS 1WF2A 1SB6A 5MAOA 4OX9J 5ETPA 1HK9A 3RNJA 4USKA 4ZGDB 1RAFB 1XOVA 2KQWA 3TW0A 3J7AN 4DUYJ 8ATCB 5KFSA 2KFZA 1RSCA 4O3PA 5L9XA 2FJXA 4ED4A 3CXCP 3JB9H 1YWXA 2V8PA 3QRPA 5GANg 3DFEA 2BW2A 1URNA 4N0AA 3BQ2A 1S72S 5HJYA 2XI2A 1FWPA 4C6AA 5HROB 1M90R 1R8BA 1QMCA 1XK8A 1RP5A 2GJ2A 3HK2A 2SEMA 1HFEL 5A0YB 1ELOA 4RTVA 2JX2A 3TU4K 2RB7A 2PT0A 5GAHU 1KG1A 2NR0A 1SSHA 1OQ3A 4BCAA 4CLUA 5A2QU 2DNHA 3QQCD 5DM7Q 5DO2A 4RG8A 1UA0A 3GIMA 5AE1A 4IFYA 3V8LA 2M1HA 3R1LA 4D3GA 1HW9A 5K14A 3LYIA 1O5JA 2C2OB 3H90A 1DFDA 1X9MA 2LEAA 3SD4A 1FERA 2J5AA 1VIEA 4I69A 2P0KA 3M58A 4F04B 4HLBA 4Y2IA 2C2RA 2UVVA 3BPDA 2GMJA 3IR7B 3QXEB 2Z2LA 1UKUA 1E6GA 2KR3A 3LGFA 4BE1A 4PPZA 4DL2A 4OMNA 3PCOB 3EZUA 2Z2YB 4EGLA 4FBTA 5A8RB 2HRYA 2Q43A 1VQ7T 3KUHA 1LFWA 3KJFB 3RTVA 1VFJA 4R56A 2V1QA 4OMOA 5KYWB 2OELA 4F8RA 3HXMA 3M05A 1VLOA 3I0SB 4DSKA 4OZ0A 4DR4F 3DLGA 2VXEA 2GAHC 3HHTB 3HVTA 2YKAA 1RBLA 3CC2T 2HHPA 4QIVA 4AFUC 2R9LA 2B5JB 1GH8A 1RAAB 1HBNA 3VRZA 3MM8B 4MKYA 4B02A 1NKCA 2W9CB 2V26A 1UA1A 2U2FA 4R5PA 2QA4A 2HZYA 1UVMA 2AKKA 3OQ2A 1W2BP 1WKKA 2IM2A 3GE9A 5KFLA 3CMES 1HWUA 4XU1A 4YMEA 3QT5A 1AZEA 1LCKA 1QSYA 4ETXA 4UOFA 5J39A 4ZLPA 4FKYA 3LP0A 4I4BA 3I32A 2RD1A 1EKSA 2ZBIA 3Q8QB 4ER8A 4DV7J 1T05B 4I6AA 2V2QA 3EH1A 2CP0A 2VC0A 3M8WA 3PVXA 1T11A 2X7IA 3JQJA 4HVWA 1N8RU 1VQ4Q 1M1FA 4KHRA 1G3OA 2NCKL 2EG1A 1FK9A 5HKCA 4ED2A 1PG5B 5SZTA 5L8RC 3CQTA 4ETZA 4B3TJ 2RQUA 2N4DA 3OLAA 3FSXA 1LOUA 1VI7A 5A8RA 1RT1A 1W2BS 4K4ZA 7FD1A 2K5IA 2NWMA 1S1WA 1S7HA 5ETRA 4NA2A 2P84A 1VC6A 3R5JB 4ZJLA 2PVDB 4CTAB 5L23A 4QU6A 2YLCA 2IYGA 1I4K1 2DM1A 2X9HA 2YRDA 5DM6Q 5T14A 1CJKA 2H5JB 3H2UB 1S1VB 1BC6A 4D8DA 2W0ZA 1MWQA 4CC2A 5M9OA 3ILLA 3Q83A 3LGHA 4QYRA 3DDIA 1VQOQ 3CCLS 1VQ8S 3FRYA 2JC1A 5LJ3Y 2BV3A 3DOKB 3HZGA 4RWXA 4DEZA 2DNNA 3QO3A 1NDCA 1S1TA 2LCLA 2CUDA 2IG0A 1NUEA 3PW5A 3FQLA 1X4GA 1Y0MA 3OSPA 1MWZA 5J2QB 4PWDB 4ED0A 1QVGR 1JLAA 2R4FA 1SH2A 1TELA 3L4BC 1JJ2A 3LH5A 3KK3A 4M5NA 3EICA 2Q6CA 1UJ6A 4Q5WA 4ANDA 2F1FA 3V7RA 4MMLA 4V2SA 5D6YA 3OL6A 1S72A 5AJ3J 1CJKB 3DGPB 4LBHA 3MKDA 4ZVGA 2ZH5A 1JMTA 4LF2A 1AEYA 1VQLS 5F9NA 4ANEA 2W7OA 1WQ7A 1VRUB 3DRPA 4DCJB 1WEXA 1CULA 1RWOB 4UOGA 3D2WA 2MWOA 2YKPA 1R43A 1WC1A 2QMXA 2AHOB 2E41A 3T9ZA 1BQNB 1KSPA 1P1LA 4OB0B 3MEGA 1GFCA 2CDRB 1R8PA 3CCVS 3MEDB 1GTHA 4KHPJ 2HBYB 4ZHRA 3MP8A 2BYCA 3H40A 3CJTA 3BO2A 4GBQA 2YWWA 1EP4B 4X84A 3UDCA 3AOAA 4C92B 2DIUA 4CLYA 1YBTA 4MT1A 4XO0A 1K47A 3MJXA 1SQGA 2K1RA 3UQSA 4DQ2A 1IR0A 3HHEA 4ICLB 3CJKB 4WJBA 3H5UA 1BI0A 3JCMf 3VGSA 3OYNA 4IO1A 1X0PA 2HHHF 3PEHA 3TUZC 4NL2A 1BD6A 1SVDA 4JI0F 5CAAA 5GAOq 2DNQA 2XDBA 2ZPBB 3FBFA 4I56A 2B86A 2ZPEB 3GPLA 2Y0BB 3M6WA 1NK4A 4Q44A 1FI4A 1PAUB 3KLFA 4KV8A 4C92D 1JLCB 2CA9A 5RUBA 3AQPA 3QFHA 3N9UC 1GXUA 3CVKA 4RUHA 5K9FA 3LWHA 3V6HA 3A8GB 4ITSA 5KFGA 1RI7A 4DX6A 3OA6A 3CJ3A 3FEOA 2V2KA 4MYUA 1U2FA 2RAQA 3RJMB 2ZFHA 2D1XA 5IWAF 2JDJA 4F36A 3I6PA 2V8JA 4EPCA 5D0RA 2X4JA 1VIFA 1KJWA 4XTTA 2CWKA 5D6XA 4G65A 1IRXA 4FS2A 3RW7A 3GIIA 2YNIB 4WTYA 2VOPA 2JM9A 3NBPA 2VG6A 2IHR1 2B7CB 3UR3C 3W63A 4J9IA 1VQ6A 1XIQA 4LIWA 2XDDA 6FDRA 3VS6A 4DN9A 3CDUA 4LT6A 3JYTB 3LQVA 1T03A 1VQ4S 2R7TA 5CYMB 3QBCA 4DU8A 3BO3A 5CO7A 3M4XA 4WP8A 2MQ8A 3M6UA 3N79A 2C0OA 4M4ZA 3P3DA 2J7UA 4HA8A 1H2UX 4AFFA 2DGXA 2R5AA 2RILA 2NXCA 3O44A 2QQBA 3UCGA 2JZ2A 3DLBA 4YB5A 1SUQB 2AZSA 2ZHBA 2VQEJ 2MKYA 5HK3A 3LP0B 4DF4A 3HRTA 4EO6A 4ZTFA 2YNIA 4PEOA 4OV1A 2Y1RI 5HP1A 1LWXA 3U27A 1N8RT 3G8QA 1QKXA 2DZCA 2DNUA 3LX7A 3AJ2A 1HHSA 2VGMA 3GP9A 4J6XA 2VUGA 1N6QB 2M88A 2GO8A 1FT8A 4KR0B 1T3NA 1NDLA 5KFZA 4USJC 4DL4A 1D3BB 3C14B 5C24B 4USVA 4DBFA 1T05A 3D3BJ 3EFOB 3N28A 2G0JA 2JOYA 3RIRA 3GYGA 3JV3A 4JJCA 1QCFA 1QWEA 3BGOP 2V2VA 2DPJA 3FGVA 1SRMA 4AXJA 3TUIC 4U96A 4C92C 2J6OA 2HQEA 3IM8A 1L3KA 2AV5A 3M30A 3PIPA 2J9EA 5LJ5e 4JYAJ 1PKTA 1RTHA 1LKZA 2Z0GA 4DXLA 3CXCR 1BXNA 3BM7A 4UW2A 2C3UA 1N33J 5EUHA 2QQ9A 3L2RA 4LFAF 3MWBA 3KXDA 4DL7A 3G71Q 1AZSA 1OI1A 1IBCB 4X4TA 2R7QA 4J37A 4PG6A 4HCCA 4ZITA 4LBIA 1T9YA 4RW8B 2ROTA 3I0SA 4PJOA 5GAMj 3MAHA 1ZOTA 5LT5A 2DD4A 2GTJA 3KK1B 4ZK7M 2P5VA 1GBQA 4DOWA 1L3VA 2K06A 1ZA1B 3IBFB 2RQMA 3T3FA 3HHDA 2DMOA 4CLWA 4HKQA 5IM0B 1VBXA 4AE5A 1M5Q1 3AB4B 5IXBA 4G1QB 1S99A 2I8EA 1D0YA 3PTWA 4FT4A 2AIRB 2F2XA 1S6OA 2LQ8A 5LXYA 3P49B 1RYRA 4NASA 1KR4A 4A4FA 5KH6A 1RT6B 2N7CA 2DRDA 1PD0A 1R77A 1RT2B 3A8IA 1SV5A 3HSJA 2YNHB 3M55A 4U67Q 4CC3A 4ILRA 5GAEU 3MFHA 2MKIA 3MAQA 3CCWA 5BJRA 3JQKA 3FIFA 3VUBA 2KL8A 3N5FA 3CCUA 4DJBA 3L2ZA 4ELZC 1H3DA 1P8GA 3S6EA 3DKMA 1FKPB 3KLVA 2MB0B 1BQMA 2M0YA 1SPKA 2DR7A 5KYXB 5LSRA 2LJ0A 4J9EA 3VRYA 2VPYB 2LX7A 2K1RB 3BKTA 4QU7A 1D1CA 4XTVA 4ICLA 3SWNC 1RABB 1F0XA 3MEGB 5J2MB 1NNDA 1HNXF 2UZAA 2HFSA 3RRKA 1VQNT 3UA6A 4OBIA 1GMVA 3JAMU 2I2LA 1LEOA 4E8UA 1E6VA 1SV5B 2VC1A 3KTQA 3RMSA 3KFVA 4TKTA 2OPSB 5CVIA 5FJ4A 2FPHX 1T0HA 1FE4A 2EKYA 4A8OA 2Y8YA 1YJNT 4NXMF 4OHZA 2MYSA 3LP2B 1S1WB 2MAMA 2BQ3A 1ZPWX 1MUZA 3O8WA 4DR3F 2RDJA 2VYTA 4M7AF 1GX6A 4AD6A 2IC3B 5J2QA 2L9WA 4C8NA 4CRJA 4EEYA 3INZA 1S97A 3W9IA 4EMKB 1ZTTA 1N5ZA 1U0HB 1VQKA 2V9WA 1EQMA 4MK8A 1VIOA 2N7YA 3TOQA 2DGUA 2WSFE 2LNVA 4JI4F 4IH5A 1RTIA 3UNGC 3CD5A 1HWJA 3TCJA 1BBZA 4ZNXA 4EMKC 3LGNA 2WCXA 3QIPA 1IR2A 3MAAB 5J2MA 1WI6A 4I2PA 2L3SA 2OPRA 4O3OA 5E2QA 2FHJA 3M0UA 2DJQA 3LP2A 4PXBA 3QT8A 3PVLA 3BZQA 1UPPA 1UCNA 4NCBA 5FD1A 3CCJT 3T9NA 3RYLA 4I1TA 4LSLB 3HFZB 4NYOA 2KHDA 3FVYA 1KQSS 1TMJA 3WVDB 4IQMA 3ZZTA 1NZ8A 2GVDA 4UUWA 3A8EA 4DR2F 3PM9A 1VK8A 2DYBA 2X1BA 2JVVA 1IQTA 1PNJA 2AGQA 1RISA 1RYSA 2FQQB 5GADU 4PJLA 4LF4F 3NGTA 4DQIA 4ZPTR 1RQ0A 1UGPB 3BY7A 4DQQA 4KPYA 4IG3A 2B51A 5GMKh 5GAN7 4B3TF 3HRSA 2GHVC 1B7YB 3LPYA 4DSIA 3A8OB 2XYPB 3QZ8A 2B9EA 1AA1B 4K4TA 1RHMB 2MZJA 3SWNA 3S7RA 1KC8T 1T7PA 2IBKA 3PRVA 3VS0A 4F25A 3VHQA 1GMWA 3C6TB 3V6KA 1V29B 2KI2A 3BF4A 2ZWPA 4NLGA 1TAQA 4F3QA 1UL3A 4M7AD 2OPPA 5K8MA 2IM1A 2PU9B 1QY7A 2RQRA 2LCSA 3G6ES 2E5IA 4I2PB 3C0CA 4B3MF 1YDLA 2ZM6F 3M8PB 2KNBB 5IHIA 2RD5C 1RWXB 1SKRA 3HJFA 5B0BA 2B4VA 3I55A 3GJSB 4ZKAA 1SKSA 4YHHF 3RKYA 4TU7A 2PZ1A 1VQOT 1DJ7B 1WG1A 4MZTA 5D6WA 2W01A 5DLQE 2A18A 3NNCA 1QP2A 2MDAA 1YKWA 5JUMA 3OYHA 1HPZB 2KXNB 2QTXA 5GAMd 3CC7A 1TAUA 1X9SA 2DITA 2JS2A 4Z7CA 1M1KU 3DB4A 1UEUA 3F0NA 2CPYA 3QRQA 4X4VA 5KFEA 2F63A 1LPLA 5CCAA 3L2QA 3CCSA 2EKHA 3PY8A 3SQOP 1UW4A 2K9GA 1KN6A 2DPIA 4XDCA 4PG7A 3M2RB 3EJMA 3J7YI 3ZBDA 3ZZOA 1R8OB 3EDQB 1GNKA 4P73A 2QE5A 2MLZA 4NA1A 4OZ3A 4TVAB 2R7SA 1M5KC 5LOQA 2IPOB 4DR6F 1U09A 1K76A 5C6SA 2M9KA 2DR6A 2KRMA 3BR9A 4IURA 2DKGA 1TVRA 1YIJT 2AJ2A 2B7BB 1LFPA 1V1CA 3OYBA 4RUCA 2VKZG 3HL8A 2CVIA 2UXBF 4RW4B 2FY8A 2JL9A 3ITHA 3WQPA 2HVIA 3E3XA 1VS3A 3NP5A 2HK3A 3T6BA 5LJ5Y 2RQCA 1NXIA 1UFFA 4NLUA 1YIJA 4NMXA 1SUQA 4MMKA 1B34B 1HHQA 3ET6B 2VFVA 2HBWA 4E7LA 3J81E 2V94A 4LF8J 5C0MA 1DHMA 1OZ2A 2X3DA 1IGQA 3IGVA 1PJ5A 2GQ2A 3CEDA 3UCUP 3NGPA 2DO0A 4Y3CA 1N0UA 4F02A 1CQMA 2O9SA 1M27C 1MV3A 1PILA 1FJCA 5LJ5h 2UUAF 1YRTA 5HQLA 4LBPA 1U1PA 2RK2A 2ZPFB 3L9ZA 1ARKA 1N5TA 5GAMe 3ETMA 2ZHAA 1WJRA 3HMJG 3V81A 2PA3A 3TZXA 1C1CA 2JT4A 6FD1A 4DBQA 4AL6A 2RUSA 3BBCA 2B6AB 2XC9A 1ZETA 3BE3A 3ISND 3NKYA 2K5LA 2XZDB 4ED1A 3AQOA 4X64J 3DLJA 3NGKA 3ZNUA 1NEBA 1IXDA 1NYGA 3GIBA 2W7AA 4C8ZA 5FWBA 4O4GB 2NYSA 2DNRA 3MM5B 4K4SA 2DJWA 3EWGA 4F4WA 2RS8A 4B3MJ 2CRLA 2NZ4A 4M75D 3H0FA 1E6YB 4K7QA 4QYZJ 5B0AA 1N5VA 5A2QY 5KFVA 4MTPA 3N6NA 3IAS9 1VQOA 4H4KC 2YX4A 5KFOA 4K2XA 2DISA 2PC6A 5I11A 3L3CA 1VQ6T 2F40A 1K1QA 4RTYA 3CJKA 4DUZF 2O3DA 3D6HB 4OFZA 5DQGA 4DI6A 1Y5NB 3M8ZA 2J8SA 4G1PA 4NXMJ 5CABA 1U7LA 4CTAA 4NEYA 2YNHA 2G2ZA 4U9RA 1RXOB 2XMVA 4WKRA 2CP3A 4WK3A 3K0JA 1NK7A 3FLGA 1EX4A 3E19A 3U02A 3O5ZA 4RJVA 5J1NA 1T3SA 4B3RJ 5SUHA 2LA6A 1F3FA 2CYZB 5KOWA 2CJXB 4WZQA 2LMIA 4DV5F 1WJ9A 4CZCA 4J9FA 2HVDA 1X6GA 4CCHA 3EGZA 2XLJA 1Q81C 2CNNB 1JJ2P 3DOLA 2KFNA 2AKWB 1B0PA 3QZ5B 5B0FA 3MOJB 5GAMg 1Q79A 4QVCA 3JCMc 3G4SA 3VZIA 1DRZA 2CQDA 4TY8B 2DXUA 1R27B 3DU5A 3C8YA 4X66J 1FMKA 4E7KA 4C3MA 2KB2A 3JCMg 2DVIA 2CAJA 1HR0F 3JB9I 2QLXA 1OQ6A 3MR6A 3X28B 3MCNA 2G1HA 2VHGA 1S1XA 2RDDA 2IY5B 1NK8A 3GILA 2YKNB 1N32F 5CZXA 3LAKA 4U95A 2EKOA 2DNKA 2QFIA 1FYNA 1U3OA 5IQQA 1M5PC 4EBCA 4A53A 5HBMB 3H6ZA 1F1BB 3PHEA 3AJDA 5E33A 2XMKA 3CCRS 5CQYA 3MI7X 1UUEA 3DM2A 1WG5A 4IUTA 5K14B 4K4WA 2ERRA 1Q81T 3H59A 2ZUAA 3JS9A 4JJNK 1FJEB 1BHNA 5IZHA 2Q1LA 5G0RB 2DXDA 1K73R 4K11A 1HPZA 3MGJA 4AMCA 1JLGA 3V5RA 2V5HG 4CNYA 1KQ2A 2E7VA 1MU2A 2VF3A 2R42A 5KYUA 1B3QA 3EVMA 1ZQ1A 1KQSR 1JLFA 1XMOF 1LK5A 2QV6A 2HFNA 1XMQF 4HTJA 3C6UB 1NKBA 4USMA 5M2UA 4C8KA 1UGSB 2CZ0B 2FRWA 3I4HX 4UOCA 2PI4A 5CCMA 4Q0BA 3SSRA 4QWCA 1HARA 1OO0B 2DBBA 4UQGA 2VXFA 4NZ6A 1HSQA 1FKOA 2AP6A 2OI3A 2CP5A 5T41A 2HLTA 1YVFA 1Q7YR 1QAIA 4KBIA 3OSSC 5FLXU 2L41A 2KGTA 1DQAA 2FHMA 2MQOA 4U7UK 5AXNA 1Q82R 3PR5B 2PTKA 2YPZA 2JJ4D 1LXNA 3UPFA 4CLSA 4QW2A 3US5A 5ETSA 2LXUA 3R3TA 2AD9A 4A8KA 3KK2A 2ATCB 4CLPA 2J0WA 1NJIC 2RKIA 3W5XA 1WIEA 2LYVA 3WC2A 3UN2A 1OYXA 3DCAA 1QAYA 4DV5J 2W2QP 2HHWA 2DPPB 3ZEHA 4ESRA 4OX9F 1JLCA 4FF4A 3DHXA 4KKOB 3WHIA 2JNGA 4CQ1A 2HHXA 2I5JA 1G2EA 1I94J 4C5HA 4KUIA 1RU1A 2RSQA 1HQEA 3EGUA 3VWSA 1JLFB 2NPFA 1DQ8A 4Y0FA 2YPYA 4IFVA 1YSJA 1EIYB 4RO0A 3KJVA 3WZ0A 4E7HA 4EIKA 2MZQA 1OX9A 5GAN5 2UXDF 3CMEQ 3A3NB 3CMQA 1MNDA 4LUEA 2C28A 2KRBA 1PWTA 4AXIA 1K8AT 3W9JA 3D3CJ 3UF4A 3IS9A 4WFXA 3D0GE 3RR8A 3NBPB 4C92E 5I3PA 3UWTA 2EQKA 1G3TA 3OTCA 3QMQA 2R8GA 3TAQA 4QYZK 4ZCKA 1I5OB 4M7AB 3M8SA 4U7CA 1QTNB 3H42A 4EUVA 4XU2A 4AQYJ 3ENWA 1OEBA 1W25A 3SQGA 1LW0A 3JTPA 4BC9A 2E5QA 4ID5B 1FD8A 1KONA 1U25A 3W2WB 2KT8A 4OJ3A 2F3JA 4FVCA 3PIOQ 2OIHA 1XR6A 1VUBA 4LRDA 2JTEA 2XULA 5CQXA 1SJ1A 5F3TA 4LRFA 4EMGA 5KFJA 1IWGA 1OOTA 5DLGA 1UWBA 1IKYA 1TFWA 3PKMA 3L2UA 1C2PA 1G8XA 2MLXA 3V8KA 3OFHA 4ZPVR 2CH4W 1GFDA 3TR5A 4C0OC 3BS9A 2FVQA 1OPZA 3SV3A 2A7YA 1HD0A 2WBMA 2CQ3A 4B3OB 1GAOA 4C98A 1FRHA 4M7AE 2R7WA 1HNWF 4LQ9A 1SH0A 2VQEF 4NX9A 1KVIA 1FNMA 5IN1A 1TK8A 4J9LA 4RU2A 1JKHA 3BN7A 3ZTPA 1G7CB 5D7UA 4DBRA 5F8GA 1S6PA 3RB4A 3I5RA 3BSAA 2OPSA 2DT9A 2UUCF 2HNDB 4JI3F 1RWKB 3H0HA 1FXXA 3OYCA 4A8YA 2E29A 2BDPA 2EYXA 4ECWA 4IYQA 1VQMA 3PTAA 4OMFB 3CCVT 3H25A 3NGSA 5IQ6A 3J81Y 5CAIA 2G2OA 1O75A 5F9LA 1Y0HA 4HTIA 5FW9A 4L75A 1U2CA 4ENOA 1ZS6A 4HT9A 5IV4A 3K59A 3VALA 3IRWP 3TVZA 5IS2A 2XO6A 2OMOA 5HBMA 1PO6A 2LXIA 4ZHRB 2CQGA 2V4QA 2ZBQA 3AH6A 3QIIA 3G7ZA 1CVJA 1D09B 4PFOA 3EGNA 4RKUC 4TLQA 2JLGA 1XTZA 2W4CA 2XLKA 5F41A 1HWKA 4F7UG 4W4MA 3M5AA 2QG9B 2OLWA 4LRBA 1TUWA 2W2NP 2UUAJ 2EPIA 2VH7A 5ETKA 1BCMA 1RT1B 3TARA 3FKBA 4MH8A 2QC3A 4PJOC 5HVGA 2XSFA 1S9GA 3ZZZA 3DLHA 3ICLA 5GJVB 4P75A 3Q86A 2KZZA 1WOPA 3DM2B 4NLWA 2CIMA 5JMNA 1VC5A 1YJ9T 3QGPA 1DZ5A 1WOOA 3OR1B 4O4GA 2HNDA 4YN3B 4AFZC 4WYWA 5AXLA 2ZNYA 2U1AA 4UT4A 5A8KB 1FWZA 3BW1A 4QCLA 4B9NA 1RGVA 4IH6A 2BOPA 1M2VB 1U06A 3DGVA 2ZZMA 4IO9Q 2QI2A 2C42A 5GMDA 1OY6A 3LWMA 1VQLA 1PRMC 3QYHB 2EIFA 3R7BB 5EGYA 1V5VA 1NJYA 2CZ1B 5L9NA 4M5GA 3A8KA 1YJWT 4DN0A 1YGYA 1M1GA 1X4FA 1TKZA 5E5NA 3RKXA 2MQPA 2JH3A 2VPWB 4CDIA 2R5MA 1JXVA 2OEKA 3CGIA 4Q8EA 3OHBA 1YNZA 1RHQB 2LDYA 2DGQA 4L72B 1YI2Q 1APSA 4HEA9 3CBMA 4XDDA 3W60A 2V4JB 4DV2J 2AX1A 3F41A 1N52B 2DF6A 4A8WA 2QYZA 3GZ7A 5C25A 3KLHA 4PPDA 3QAEA 1RHKB 3CJ8A 1UGVA 1G4CA 4B3SJ 4M5LA 2FEIA 2Z8QA 1ICEB 1K4US 2DTIA 3FC3A 4J9HA 1KHIA 3QPHA 1CJUA 4L5GA 2CG4A 2V50A 2GS8A 1IM4A 1YHQT 3PMTA 3CCQQ 3IG1B 3OV7A 5C2GA 4NXNJ 2QL7B 4OGEA 2KKHA 2RU3A 4R25A 5FLXE 3OS2A 3NS6A 2V8KA 1PYOB 2RI3A 3HO1A 1V3RA 4LUDA 3EFOA 1HQUA 4YFUA 2O5DA 4F0KA 4DQPA 1XTDA 2ILZA 3AD7C 3R5AA 1TXQA 1YCSB 3H5YA 4FYXB 3POTB 2HAIA 4ED6A 1S6QB 3SCKE 2MHNA 1RAGB 3K17A 2GFAA 1U1SA 4F0MA 2ZBCA 1WHVA 2CUYA 4AUKA 4RW6B 3E8OA 2PQWA 3KJQB 3G6VA 5LJ5d 1YBAA 2IIHA 2MIOA 2L2PA 2APOA 3SIPB 3G4SQ 3IWXA 2EQUA 5HQ8A 4R8UB 4HYKA 2CGHA 1M1KT 4J7IA 2LNHB 1BY9A 4PLIA 2QLJB 1KFDA 1V6HA 5DDOC 1IBMF 3NWGA 1TVRB 1LW0B 1Z9ZA 4Y2AA 4CYUA 1Y96A 2YQ0A 4WYLA 4KC5A 1KTQA 2WTFA 2BW7A 4MFBB 2FVSA 1GXLA 1TL1A 5FU7B 4QIWD 2QQSA 3VYHB 4USUA 1F9HA 4ELUA 4HDGA 3ULHA 3DDKA 3R6NA 2GIQA 1MHNA 3EGDA 4Q45A 4QQDA 4C8QD 4KSEB 1JBMA 1U1LA 4OI1A 3D7SB 2GNKA 3M9NB 3H8ZA 2HFOA 2ADCA 3KG4A 5FROA 4C4WA 4RPFA 1C4AA 4ME7A 5I4MA 3K8VA 3BV8A 2HBZB 3CDWA 4LFBF 5D8HB 3QGHA 4D6WA 3FEYB 3R6LB 4MKBA 4LDYA 1Q82T 4Z8AA 3VQTA 3LGLA 4B3OA 4ANJA 3IWLA 4USIA 2HGMA 5THWA 2KT3A 3DDNA 4ECRA 2A6OA 4IQXA 2EPDA 3DYAA 1EETB 1M5HA 2OJ3A 4A47A 1H2VZ 1UDLA 1OMSA 4CWBA 2XO7A 3T1AA 4IIMA 4K50A 1U1MA 1SSFA 2PVGB 2M8HA 3RG6A 3S01A 2EFOA 2K3IA 2ZVSA 2ZPGB 2CJBA 3GLJA 1P9YA 1Q86T 1TL4A 3MDFA 2QAZA 2W4PA 3HHLD 1YP5A 4OLOA 1FTCA 1E6YA 3CCQA 1WHYA 1M4ZA 4JV5F 3QDFA 3AD8C 2QA1A 2DYAA 5F8JA 3AY0A 2JS0A 2D1CA 1HBNB 4MIBA 4IFVB 4KE5A 3EAEA 3QLHB 1SC6A 4NLPA 3OVBA 1HYOA 1DTQA 2DXTA 3LO3A 1EQ0A 5FWCA 2QEXS 2E44A 3KLIB 3HD1A 2H8HA 2LECA 4C92G 2PIIA 3R7NB 3OTOF 2WOMB 4NLXA 4J90A 2CZ4A 3Q8YA 5GAN2 4QQBA 1U1QA 2HPUA 1N32J 1WLPB 4XTYA 3D68A 1LNQA 3SMZA 3LAMA 3H20A 2KT5A 4DQRA 1FDDA 1HNVA 1VQ9S 4ECTA 2LRQA 5F0WA 2EC2A 2V63A 1R0BG 3JSYA 1CJVA 3P4UB 1RUSA 2BE7D 2FVCA 2A10A 5DY9A 2DXEA 4WFBQ 3BGLA 4DV1F 3OL7A 1JJ2S 2FPEA 4E7JA 4M5DB 2B9YA 3CDAA 4A4EA 4CLZA 3DLLA 2JEGA 4E98A 4HACA 4NPOA 1WXTA 3L1AA 1RAEB 4R0EA 2RRAA 3AAWB 4HKEA 4YDDB 2FLNA 1BU1A 1Y7PA 1YHQQ 1WQWA 1K73C 3O3LA 1IKYB 1ZM4A 4LVNP 2IYIA 4MMOA 2DB1A 4RTWA 1Q81R 4GVBA 2XY5A 1VYVA 5IAYA 3EHRA 3EGXB 1X6BA 1NHVA 3TZZA 1FFSB 4PQUB 1B0TA 3GJRB 1K8AC 3C46A 3CCJS 2QDYB 4GVLA 4LR7A 5FRMA 1W2BA 2OTLA 2DL4A 2K2MA 2HBPA 2YT6A 3ENAA 3P5BP 2DNMA 3QZ9B 2RA2A 3DMJB 1Q8KA 4QKUA 3TANA 3AFGA 4J9RA 3D1QA 1L5UA 2EBPA 2CNLB 4I67A 5FU6B 2Z4PA 5DQIA 4RUGA 4HCBA 4ILLA 1U1KA 5KG6A 1CS4A 2FC8A 1S5ZA 2K3BA 1PSDA 1U6FA 5KFBA 4ZVQB 4C8OA 1NJIR 3DLKB 3SFUA 3C6UA 3MR3A 2CPXA 3W2VB 9RUBA 5AJ3F 2WK4A 4BY6B 4DFJA 4BE0A 4FS1A 4P10A 1IUJA 4DV0J 5HI7A 1XR7A 4XTXA 3PKYA 1KC8C 1WWHA 5IXFA 2K57A 2QA4T 3T6JA 1VQLT 2DTJA 2MXYA 5HMXA 4JB8B 1WYXA 2EJFA 2HQCA 4Y91A 2AGPA 5IHKA 4YOEA 3CE8A 3FEZA 1H0HB 2ZH9A 3MECA 2ZWOA 1RHRB 3RB0A 2BJ1A 1IM6A 1VQOS 4KRTA 4HVUA 3CCLQ 3R5CA 2PDAA 4P2SA 2KMTA 4O3NA 2ABLA 3MM7B 4C48A 2CQ0A 3DRXA 1CG2A 3MEVA 2OFGX 2CS7A 1PSEA 1X60A 1GQEA 2EJ9A 3CMAQ 3OL8A 5L1JA 3EG1A 2DR5A 1U0SA 3IRXA 4X9DA 2ROEA 2LXFA 1PBAA 1TKZB 1F5CA 1KQFB 2XIDA 1S10A 5FIIA 4IIOA 4IUQA 1C1AA 5A6WA 3QRRA 1WNLA 1DY3A 2LQJA 4F7UB 1YRXA 4PG5A 2Z0WA 2B0GA 3M8QB 1U1OA 5LMNJ 2GVDB 2VDIA 3IQLA 1F3VA 3EGWB 2QZ8A 3QIPB 2CZ7B 4IR1A 3FFIA 3MM9B 4ES3A 3OFEA 1FCAA 1ZBTA 2AYBA 2CQCA 4K2JA 2GAGC 2VQFJ 3EGDB 1X01A 2F5KA 4O0IA 5CD4H 3B4MA 4C8LA 3OR2A 2KN4A 3G82A 3KHRA 3RBBB 3HVTB 3WBZA 2KT1A 1BIAA 2BJ3A 4M7AA 4K4UA 1WF0A 4KYZA 4BDYA 1W1FA 5B7WA 2DNGA 1H6KX 4BI3A 4RW8A 1LWEB 3L7UA 1XNRF 1CPZA 4DSLA 5GANf 3TYTA 2XEXA 4IRDA 4O4RA 4RW7A 4XK8C 1Q1KA 5E3QA 2BE2A 1Q53A 3CMEA 2KXFA 1FNXH 4OZLA 2K8GA 3Q2SC 2FO0A 1ZM9A 2UV8A 4QVDA 3CCUQ 3BGRA 1U8WA 4C0DC 2Z2MA 2HNYA 3TI0A 3CCLA 2CQPA 2KDOA 1T3LA 3IG1A 1W2IA 1CC8A 5E41A 4LF7F 2CH4A 2HSEB 2JVRA 3CCMQ 1C1CB 2BIVA 3MD3A 2XG8D 3E1SA 4P6QA 4I2QB 2VG7B 1EZZB 3C15B 1B3TA 4KGMA 3BYPA 3QSIA 2CYYA 1NSQA 2UP1A 3A8MB 1DAXA 1N36F 4CO5A 4OYPA 4N8NA 4F3MA 3EG3A 2F5GA 2DH9A 2D8JA 4YB1P 5KFYA 2HHVA 5KYYA 3SSQA 3KLIA 2JJ9A 1Y07A 4WCEQ 2X1AA 5DGAA 3CBOA 4TQRA 3UVJB 1PKSA 1LVKA 3HVWA 3W66A 3M2VA 4ZCMA 1VQ8T 4NMLA 3LA0A 4L3KA 2UUTA 4RTXA 1E7OA 1ZUUA 1VHIA 2WSCE 3SXLA 2MKSA 2VB6A 3OQ5A 3CCVA 5HANA 3G71S 3VS2A 3I0RA 2E9ZA 1AOJA 3DXBA 3OW2P 2IM0A 2CT4A 1SIWB 4LREA 3A98A 4CO1A 3EFRA 5HAOA 3THVA 4HH0A 4GY5A 4RZRA 3K5OA 3TA0A 5LJ5f 1S9GB 2E1MC 4H4OA 2MMPA 5JXSA 4IG0B 2B3TB 4BC7A 3CMAS 2QMUB 1U24A 2WVFA 2OPQB 2GGPB 3NL0A 3GFXA 1Q7YT 3MEDA 1X4AA 2UUCJ 1TTHB 1OX8A 4DL6A 1IB8A 3UD5A 4OQJA 3SQGB 2QGFB 3JSMB 5GADI 3WVEB 4DPWA 2FJAB 4PG8A 2DR9A 4ZMMA 4C8QG 4IRKA 2KG0A 4J6WA 3MD1A 2AT1B 2A2DA 8RUCA 1D8ZA 1O51A 1RCXB 3KLGB 1QJHA 1B70B 3BH7B 3ZZUA 1MROB 3CJ5A 2OUGA 1JQQA 3Q89A 2RK1A 3FRZA 2MKHA 1Q78A 2MSSA 4JRKA 2EW9A 2V34A 2YDLA 2BA9A 1BE4A 3PFSA 3J7ZT 2L9DA 3KFWX 5IXUA 3MEUA 4DL0C 4AG1C 2ZJRQ 1WHHA 3SDZA 2MKKA 2EKNA 4AL7A 3O5TB 1U4BA 2QLBB 2MKCA 2NXUA 1S59A 2RJEA 1WHJA 5D6GA 2Y8WA 4QJVA 5J26A 3CMAT 3UWNA 2AYGA 3HP6A 3KLEA 4D8KA 2D8HA 2C0IA 4C0BA 2KZMA 2HMAA 3DOKA 4ED7A 3NAHA 2ZZTA 3W7BA 2O67A 3DNCA 4B9LA 4ZVFA 2FJEB 2QX0A 4J9PA 2YBVA 3MM6A 1DARA 1VQYA 4LSLA 4P2XA 3VGVA 4CT9A 1U8SA 2HQHA 5CQGA 1D8YA 2GMLA 2F1LA 1S9EB 2GFFA 3DHWC 1X75C 1N5YB 3GBQA 5HK4A 3HP9A 1Q82U 1FX4A 2C0TA 2LKZA 2QA4Q 1H92A 2YKOA 1LV5A 2RH2A 3OYFA 2DCLA 4A4JA 2L3PA 1JJHA 4DFPA 1T03B 1CJUB 1NMEB 1S1UA 4NLRA 2M51A 3MOZA 4DG1A 1NPPA 5JVGQ 5I42A 3PEJA 3J7YU 5BR8J 3HPOA 2GTOA 1TKXA 3BKFA 1JB0E 3L09A 2MHEA 2RHYA 4ZPBA 3OTOJ 3PVQA 5GAMf 2IMWP 1VQ4T 4P72A 1IZ6A 2J06A 3L7OA 2ZOGA 3MTJA 1ZSZC 1OSCA 3CCEA 1WUUA 5HMWA 3HHLB 2QIFA 1PBUA 1TUDA 3TA2A 1WXBA 4RX6A 4O6JA 4P2FA 4OI0A 1M0SA 3TAPA 2VL1A 4DEXA 3OTDA 5AYFA 4LXCA 1RWVB 1WF1A 3M0TA 1Q82C 3DLLQ 4FF3A 2O01C 3MMBB 5GAOl 2ESWA 3D1HA 2XI9A 5HLFB 5J3BA 1RTIB 3BB5A 2GCXA 4ATNA 2VA3A 3GCWP 1NO8A 4IUPA 4IFYB 3HFOA 2V0NA 1SF9A 3FMBA 4TYBA 2ASLA 5ETMA 3TZYA 3TJAA 2Y1IA 2D9PA 4NXNF 1VQ5Q 3EFSA 3P8BB 1WEYA 3OPKA 3FCHA 1AD5A 5D78A 3DU6A 4YR2A 3DOMB 4KY3A 2D9OA 1XEZA 1Q86C 2J9DE 5KYWA 3ADAC 2WBRA 4WIIA 1KFSA 4M7DA 1ZX6A 2EBGA 4YB6A 1S1XB 2E9TA 2B5JA 4J9MA 4HDHA 2LVMA 2WVDA 4PJNA 1JXEA 4P7TA 5KFXA 3OYIA 4MZMA 4JJBA 4PG4A 3CC2S 4M78C 4OX7A 1YJ9A 4F16A 2M5YA 2H4WB 3OD2A 5L38A 1M1KC 3TVTA 2BEFA 4DQSA 4N77A 4WP3A 2COYA 3TJ8A 2FJWA 2CT3A 3CJQA 5GMKa 3VAHA 3GFZA 4ZP8A 4A4KA 3EVWA 4LSZB 3PNIA 1IBMJ 2DH8A 1UFLA 2AJ0A 5KYYB 3EVOA 2P6SA 1QAXA 3CO0P 2W8KA 1HYSA 4LUBA 2HWIA 2ZITA 3Q8SB 2RT3A 2HFVA 1RT3B 2ZCFB 5L8RE 3VGUA 2DGTA 2ZH3A 1Q81U 3D4JA 2XMUA 5HATA 2WVEA 2E5GA 2YTCA 3HX9A 3IRXB 3IFEA 3G96A 1WNEA 2PD1A 1UVKA 3LLRA 1CKBA 4WFAQ 3ZZYA 4CLLA 4RCBA 1RA7A 2E1AA 4F7UA 1TUGB 2DZ9A 1OIAA 1HJDA 1WTBA 3BSCA 2OFHX 3VV0A 2HNZB 1YIJQ 3I87A 2UU9F 1G6BA 3TREA 3OYMA 1RAHB 2VKNA 3H9NA 4QPTA 3I56A 1RWUA 3CJ0A 2DRMA 1SJ3P 1ROFA 5IM0A 1Y96B 2NZCA 4K59A 2VJVA 4MKVA 2KYXA 4N4HA 3RGIA 2F8MA 1FVQA 2MJUA 2AK5A 1RHUB 2QL9B 2X3XD 4F7UE 1WA7A 2R2SA 2RQTA 2IJRA 5K8OA 2DTHA 1NU4A 2DHAA 1YWPA 3OUYA 3MTKA 2GA7A 2QQAA 4B3SF 2CREA 4FDFA 4RWWA 2MCNA 1GBRA 5KFWA 4HXJA 2KPPA 3MR7A 4IDKA 2DHSA 4DFMA 4WF2A 4M75C 2VPZB 1U48A 3LALA 1JLQB 4TQSA 1ZLMA 1RT3A 2G0CA 2C2KB 3HHKA 2UVUA 2HNYB 4PJOF 1IJEB 1IKWB 5KFPA 2HMIB 1M90U 3NY0A 2WSEE 4DUZJ 2JFDA 3X24B 3V4IA 2BTTA 3FJ2A 2GQVA 2VFTA 2ZEJA 1WC0A 2QEXQ 4AL5A 4QR2A 2L48A 3MHXA 4GO5X 1HIYA 3QHSA 3C19A 1FRJA 4ECUA 3QWUA 2KXHA 1Q5VA 2M16A 5LJ5j 4NWBA 3ISZA 4JRQA 2EC0A 4A8XA 2EBEA 4P9SA 1U6BA 2QA4G 2KYBA 3QPIA 3K5LA 4A0TA 4ZS6A 2VICA 5M2RA 3QJJA 5LMUF 2Y1LB 4X4UA 2GW8A 4OX8A 3HT3A 4M5JA 4O3QA 3JCMQ 3SI8A 3MEAA 2H3EB 2Z57B 3R5DA 3G2XA 4DSFA 3VF0B 4OYBA 3OTBA 1AWJA 2NXNA 1K9MC 1RWWB 1S6PB 3MP6A 3VYGA 2YUNA 1BKBA 1YJRA 3C94A 1MNEA 2J0QD 2QA4S 2CP6A 2FJDB 3OFFA 2A08A 5L1KA 4UF4A 4YS2A 3HVRA 4C2MA 4ZLNA 3THPA 2HFZA 3DRRB 2LQBA 4NI2A 2DXCA 4FSXA 2DH7A 3G6EA 3MPDA 3A8LB 5A0DA 2DVJA 4IH7A 3NTHA 3SEMA 3M57A 3G9CA 3CULA 2SRCA 1HI8A 4OHYA 4M63A 1NJZA 2VBYA 1OY9A 4DR3J 4ECZA 2J6UA 3OVAA 3MMAB 1E6VB 3ZTQA 4NCAA 2HGLA 4ID8A 2JLEA 2QEXA 4PNOA 3ETOA 3O1LA 1E6HA 2FLPA 4FU6A 3MCAB 4DDFA 4DPYA 3HCXA 5CYQB 1Y9OA 3QJ6A 1BIBA 3FDRA 3L2WA 1JRIA 2GX8A 2FZCB 4E0DA 1VRQC 1CJTA 3G71A 1VQKQ 2KSSA 1ZPVA 1NK0A 2L3MA 4ZCIA 1I81A 3F56A 2PI5A 5LJ3g 5B0DA 3MURP 2M9UA 2QYCA 4BACA 2QTWA 5A0YA 4OJHA 2IAJA 4KKOA 4MZPA 4M7AC 1VISA 4JI2J 2DGVA 2BQUA 1T8EA 2COLA 2XICA 1OULA 3UDLA 4W98A 4RUBA 3NEKA 3OS5A 3CCQS 3ZNJ1 2W4DA 3BDPA 3BGFA 2BJ8A 1WJQA 1MGQA 4JZ3A 5I42B 2M0GB 3OR2B 3CD7A 1VQNQ 3PNWC 2DY9A 3OR1A 3BQ0A 2HEQA 3R27A 1DTTB 3LH2S 3W8PA 4R55A 4DV2F 4X65F 1N48A 3J7AF 1TG0A 2KI7A 1X31C 4NE9C 4NCGA 2K3XA 3BEGB 1WGSA 1MN9A 4ZCLA 2GCFA 1QCNA 2VG7A 3N4WA 2LFVA 3VQSA 2IAJB 3CJ4A 4S0MA 2HW3A 2UXCJ 1X0FA 1UVNA 3NPFA 2ASYA 3TO8A 4OYZA 2CQBA 5GAN4 1H2TZ 2JEJA 2NLUA 2N3LA 4JI3J 1P92A 1F5BA 2BQRA 3BREA 1CJTB 1R6VA 4GKKF 1RBOB 2DD5A 3NOGA 5BYSA 4DPOA 4M78G 3TUJC 3UCZP 1PM3A 3E51A 3ZC4A 3BSNA 4J83A 4JV1A 3THKA 2LC4A 3HFKA 1WDTA 1GCPA 1DTTA 1KNZA 2MY8A 2H5IB 2ZE2B 1KTVA 2ZPIB 1JLEA 5C25B 2QGGA 3X3UA 3W62A 4LF4J 2ZAEA 1DLOB 2W9BA 2KH9A 4O23A 3RB6A 4LF6J 3JCMP 5KCHA 1HA1A 1NK6A 1S77D 2QL5B 3QZ7A 2ZKTA 3CC4Q 1WDDA 4RU9A 3VS3A 3G71T 4P52A 3HKWA 5IV3A 2CQ2A 3CCJA 1UP1A 3RDVA 5IT9E 5EWEA 1JLBB 2RKIB 2CJKA 3EG0A 2WB1D 3QJPA 4PJOD 3S3OA 4HVZA 2HGNA 1N0VC 2B56A 3PW4A 4ED8A 5L1IA 3NGDA 3IM9A 5L1LA 3QATA 4ZOSA 1JLQA 2JM8A 3X20B 1ULRA 3MM9A 4FZVA 1T0JA 3FZ2A 2LLZA 2I9SA 4LF5F 3LANA 1ZUKA 1GMUA 1HBMB 1NSKL 1V76A 3PMIA 2PSZA 1VQ9T 4RW7B 2ED0A 5E3CA 3B82A 1FE0A 3A3PB 2LU2A 3M9MB 4PUOB 2F2VA 1KQSA 1AWWA 2XWYA 1RT6A 1IO6A 1YWOA 2K5FA 3MMCA 1M5SA 4F2RA 4KIAA 4HVVA 1CSJA 2HLUA 4I7FB 3Q0AA 1MROA 2HQDA 4HT7A 1VOMA 2PMWA 2XG8A 1HW8A 4NA3A 3JCMX 1BYMA 3MFIA 3VZHA 1N4LA 4WF9Q 2RB6A 3EGXA 4CC4B 4QR1A 4E7ZA 3PDNA 2DYIA 3D1OA 4X34A 1A6LA 2J6SA 2HHSA 5HL7Q 1QUVA 3MPYA 3KXTA 3PYEA 2PUKB 3CBPA 2AEMA 1KHWA 2PMZD 5K5MA 4OZ1A 1HD3A 1WX6A 2KROA 4DV3F 1P27B 1KVJA 2FIUA 3M56A 2YKMB 4YQWA 2QMWA 3EG9A 3CIZA 3SCIE 2HQXA 1UPMB 4KO0A 4RL1A 2KRSA 5I21A 2K2VA 1O9SA 4L3NA 3S1TA 1R8CA 2EYWA 4ZGJB 3J81j 4DHVA 4LD9K 4LF9J 4EBEA 1F6TA 2ROLA 5KFKA 2J6TA 1K1SA 3LOUA 4ORZA 1PCXA 3NS7B 1HBMA 3SZ2A 1Y71A 3PO4A 1TL3A 3CCJQ 3AB2B 3MPUB 1VQ5S 4NI2B 4X2BA 3EG2A 3MF5A 3LUYA 4RMOA 1VYUA 4X1VA 2M0OA 1U45A 2BXJA 3V4IB 4PKDB 3I35A 1RTDB 3PRBA 5FDLB 3BDEA 2MZRA 4DV0F 3U7JA 3VU3C 3G4ST 4DUYF 2LMJA 4AYBD 3EZOA 3J80E 1NSPA 3BDLA 1Y5LB 2WHOA 5ADZA 3MMJA 2LJ3A 4DCPB 3OW2A 3JSBA 1ABQA 2ILYA 2F2WA 1P1TA 1UAWA 3JB9D 4M75E 2R8KA 3A1PA 3EH2A 2ZH6A 5BYQA 3PIOA 3HSGA 4NOYA 2CZ6B 3UW1A 4WXOA 1Y7XA 5EDWA 2FZGB 3GIRA 1D3WA 2OSQA 3M59A 3CCRA 1KD1C 1REVB 1NM2A 4JV2A 3GOXA 5J2PB 2CJQA 2GVZB 3I5AA 1Z1ZA 1X2KA 3KWMA 1BGXT 2E3IA 1FJGJ 5GAGU 1YZ7A 4CH0S 5F0UA 4MK9A 4M7AG 1S1VA 4RCCA 1NM7A 2KVQG 3GB0A 2G9OA 3H7HB 5KT2A 2J7KA 1VDHA 2DNLA 2V2ZA 3TEEA 5CXTA 3CD6S 4Y2KA 4MK7A 1EARA 1HQUB 3GU0A 1TKTB 1AFIA 1KQGB 2O2OA 4XPEA 3NTIA 2AW0A 2MQMA 3POTA 3FFIB 3CDEA 2HZCA 4A4GA 5EWFA 3C95A 2XM3A 1YITT 2J9CA 3QJLA 1BWEA 1BI2A 1N56A 3ONQA 3VS5A 2ABYA 4ZPAA 1NK5A 4C0GA 1Z4UA 2D6FA 1PKUA 3IC1A 1Y4ZB 1OYEA 4DR5J 1S9EA 4OJ1A 4JI7F 1YQHA 3NGRA 1WDXA 5FU7C 4XK8E 1VQPT 4YR3A 5HJXA 4RBUA 1UVJA 3JTOA 1VR6A 4L6V3 3I56Q 2AZVA 3GQCA 4DR6J 4FYVB 1DLOA 2AEJA 2YQ2A 3OTEA 5EG2A 1R0AA 5IT9Y 1W26A 5DM7R 1RJJA 2CUBA 3W2VA 1N27A 2OAWA 1H98A 4RTTA 2VD3A 4OYWA 2CKWA 1TMMA 2I38A 3SEOA 2O1PA 2YH1A 2VIHA 3T1YF 2OMLA 3KJNB 1S0OA 3QO9B 2DR8A 2KYMA 1U0HA 2BVZA 1YBUA 1X4EA 2V8HA 3BPSP 2EFGA 3FK4A 1N54B 3EPIA 3FCVA 2DK3A 1NEEA 4Q43A 5HP1B 2A3LA 2KVIA 3TQ1A 4ILMA 5CZVA 1MV0B 2AX0A 1KC8U 1ZAXA 3H5SA 4OHXA 1N6QA 2IJFA 4GLMA 4DX7A 3M2UB 3OMGA 1MMNA 2HQIA 3RRHA 1VQ6Q 2OPRB 1UB4A 2ZH1A 1TUVA 4C9DA 3N0VA 3BYRA 4YHHJ 2QLFB 4IOBA 2DVEA 2D3OR 1V3SA 5J1PA 2V6AA 3RUXA 2GQIA 5HO4A 2IRYA 4DUTA 1Y10A 5J1EB 1B34A 3ET6A 1WACA 1WTFA 4N8OA 4L6V5 1JQGA 1QVGP 1RLCL 1EKRA 4OJGA 2IDEA 1Q16B 3FDSA 1SHFA 2RNAA 4KGVB 2NXJA 5I3QA 4OYAA 2D74B 2GNCA 1REGX 1VQ4A 5LJ3j 4CLFA 4OZNA 2BJ9A 3TVKA 4DEYA 3QO9A 2YHTA 5KFDA 1W70A 5CK9A 2J05A 2M2BA 2DX1A 2MQLA 2JRSA 1N9SA 2E66A 1SQEA 4K0KF 5HQMA 4XIUA 1NJXA 3HSDA 2GZOA 5B09A 5C7PA 5CCLA 2P9EA 3L95X 4FP9A 1VHFA 4B9SA 3UO0A 4I68A 1A0OB 3W9HA 1AFJA 3HD2A 1Q86U 4M75F 1D9DA 1KOOA 3PYFA 1YX2A 4FYYB 4V19J 1JJCB 2MGZA 5DLOA 1HNIA 2DXBA 2HD0A 3JRZA 2W2PP 5M2PA 2RH3A 1RTJA 1PC0A 4J9BA 3R2DJ 1RB0A 2BOAA 4KHMA 4DV3J 3Q8RB 3M6VA 1GT8A 5GAMh 1SKUB 1HNVB 5DRKA 1CLFA 3OS1A 1JB0C 4OB2B 2DL5A 3JCMh 4AG2C 4JI4J 4ELVA 4LF1A 3AA8A 4X65J 5I2SA 4A46A 2VV5A 1MLAA 1JXLA 3OL9A 4DWIA 3KJVB 1OZ3A 2ZC3A 5CKDA 4A48A 1NZ9A 2FLOA 4OYOA 4EWTA 4M77F 1FRIA 4I6YA 4HH1A 2XB2D 2F8HA 1R89A 5AE2A 2O01E 2ZH4A 4O44A 2MGZB 5E3RA 3RUBL 4C5IA 3GSDA 4ZP7A 2WVCA 3FJPA 3BBFA 3DGPA 3VAGA 2IRUA 1QQJA 3CIMA 1YZ6A 1RI0A 1IJFB 1G83A 2XMFA 5DDQC 1X5OA 2ZKUA 4HCZA 4JRPA 1PHTA 1TR0A 2C3YA 5KT4A 1OPKA 4LDWA 1OPIA 4C8MA 2FVUA 2D3ZA 4C7QA 2E1HA 3GTYX 3J81U 2VOOA 1BQNA 3RESA 5HN0A 5ETTA 1D9FA 4JS4A 4BWMA 5I3UB 2HRUA 3G8SA 4OX6A 2MKJA 4AFSC 3HHLA 3CPWP 1H7WA 1T9UA 4ZLJA 2P8IA 3QUIA 4KFBB 3QYYA 2CPIA 4M78F 5DG9A 5K8NA 1NPKA 4DR5F 3EHQA 2NUHA 1C1BB 2XTJP 4O3SA 1VYAA 3OYKA 1WC4A 1KFZA 3E9GA 3H2VE 3IMQJ 2RQWA 1FFGB 4TLRA 5IT0A 1YITQ 3ZFVA 4QWEA 3IBCB 2DFUA 3NLCA 3D6MB 3GP8A 1KVKA 1WG4A 4F26A 3KLFB 3OJSA 1YHQS 4J9DA 3KLHB 3I9ZA 4NLVA 2RMLA 1TL3B 4PYDA 1VQNS 2DRBA 1TOVA 4DF8A 2VODA 4DPTA 1WHWA 2I1RA 1AB8A 2EFPA 1HBOB 4XAXB 4IR9A 1FDNA 2XMMA 4C0DB 4HL9A 4DR4J 1TU0B 2ZM6J 4CI0B 1UVLA 3M8PA 1SJRA 4LRAA 1XC9A 4LDUA 5F8IA 2C3MA 4LVOP 3BBBA 1VMBA 3RAQA 3FUYA 3P8DA 3VGTA 3EX7B 4F7VA 3LP1A 5A2QE 2M3DA 2RO0A 1TL7A 3HI9A 4GC6A 5HVHA 2WACA 2DA9A 2XK0A 2VFRA 1R3NA 1H38A 2OKQA 1K73U 3AHPA 1G1XA 3RBDA 2BZXA 3TEGA 4J9SA 4DV6J 1FFWB 2BKDN 2BACA 4JUZA 4Y00A 1YJNQ 2LT1A 2W2OP 3ILJA 4PYAA 2EFQA 4X64F 4M75B 3HM9A 1VQMS 2FB7A 1RT4A 1KLNA 2DILA 1KP6A 3CCMA 4JLIA 3ILIA 3VCDA 2ZZNA 2RUGA 2RNEA 2RHQB 1VQ5A 2W10A 5LJ5g 3A1YG 2HKEA 1SPBP 5HSPA 1LOJA 3I9QA 3TRGA 2K2PA 3F44A 1PRLC 5KG4A 1UFWA 4FXDA 2PVOB 4FM4B 3AOBA 2L5QA 3VAIA 3HLUA 3W2WA 4E7SA 4C8QB 2DGSA 1O6XA 3G8TA 4IG3B 3QSYB 4LR8A 4MDWA 3RB3A 2GIFA 4BS2A 4Y2CA 2FJVA 2F4VF 3BKUA 1SL0A 2W8LA 1RCOB 3M8RA 5ECAA 1YJWQ 2DKOB 4YTLA 4PR6A 2UUBJ 4RG2A 2NYHA 3VAFA 1TP7A 3W61A 5LSOA 1MU2B 1B7FA 3CC2Q 3MMBA 4M95A 2Y90A 2N3OA 1CC7A 4OIXA 1AHJB 1SCJB 1VQMT 2GHPA 3VAKA 3MM7A 4GMKA 2HS4A 4KT0E 2O4XA 2BRLA 2JZ5A 1W6XA 3QWYA 2UXDJ 2VGNA 3OYYA 1RA6A 2FVPA 1VBKA 4KHPF 1OQKA 4RW6A 4BY6C 2V68A 1IHVA 1EHWA 1URRA 5DZ6A 1X6OA 9ATCB 4Q7AA 1YI2A 1T94A 2CPFA 1B4SA 1R31A 2Z56B 1S72Q 1IWAA 3OYJA 5J1EA 4C8QE 5D0HA 1I6JA 3SFGA 3H0PA 4GLKA 4BDPA 5KE2A 3LH0A 2ACYA 3UD3P 2R7RA 3RZAA 3M54A 2UUBF 3GONA 1WELA 2LQ5A 3KMQA 5KT6A 4IKFA 2CDQA 3OSNA 2AHJB 2L08A 4RNFA 4TY9A 2QRRA 3MCSA 4KQZA 5ETLA 4JI0J 1WKJA 2DAQA 2EJGA 1M1KR 4J9KA 3JCMb 3CCLT 3LWLA 3R7SB 3D66A 3FSIA 2H65B 2R2RA 4RLEA 2OP5A 1IKXA 4CM0A 1DURA 1VQ5T 2F7VA 4FN5A 1SI9A 1KD1U 3GV8B 2AZ3A 4B9TA 2YWGA 1BLUA 3QNWB 3RBXA 1YLXA 3URGA 1S57A 2BE2B 4JI7J 1A0NB 2OX7A 3UPUA 1Z2ZA 2LCWA 4NYZA 2HHUA 4O3RA 2KJVA 2LU1A 1Q7YU 2YY3A 5GAHI 1WEZA 3PX4A 3ZTRA 2QA2A 2CG8A 4CH7A 3WDOA 1JLBA 3C16B 2RE1A 5GMKl 5KTQA 3K58A 1RT5B 5KT5A 4A8QA 1YIJS 1ZSZB 4OB3B 2DNOA 5LMNF 1VIXA 1Q7YC 1RDRA 2XZWA 4FPRA 3I4PA 1AUDA 1PC5A 1X5TA 1Q95G 3VS4A 5A76A 1JXOA 2E10A 4NLOA 1C0MA 1KBRA 1D1AA 1IKVA 2DL8A 2BBEA 2O66A 4M1KA 5A8KA 1WSRA 4R5PB 1RL2A 1HWLA 4C92A 2FHJD 2OTLS 2LQWA 4M5MA 1VQSA 1M3BA 5GANe 1KS2A 2BJDA 3PFEA 1I1JA 4F14A 3MO8A 2AGOA 1X9WA 2ZHOA 4KGZB 2QDLA 2LJ1A 3CCUS 2BM1A 5HY6A 3M2VB 3PZPA 2NUPB 3RERA 4IUUA 1SL2A 3PV8A 2HEKA 4L59A 5E7OB 3VR1A 2NUZA 3DI6A 1TWBA 3T1HF 1AT1B 1NJIT 3QGGA 3C16A 4N47A 4UZBA 2B6AA 4H4OB 2WSCC 1YJ7A 4J7FA 2JOQA 2A6MA 5KYNA 3Q22A 2C2NA 1I3OB 1YJWS 4OMMA 3MR2A 3W5ZA 5GAOp 4TU9A 1NDKA 3S8SA 1SRLA 3CCRQ 3D0HE 1KDNA 1FEEA 1EB0A 1U6ZA 2JHEA 1G3SA 4UUXA 3VKIA 2BANA 1VJWA 1T02A 4UC4A 3DKDA 4IOAQ 5A0LA 1N9RA 1RE1B 3TP2A 2AMCB 2X1FA 4KB7A 4DA4A 2UXBJ 4WU2A 3E01B 1F9FA 1UJ4A 4XPCA 4X4QA 1NB7A 4DS4A 4B3RF 2R7UA 3MP1A 1M9SA 3DOMA 4DU7A 3PYDA 5HROA 2UUWA 3EMTA 1SXLA 3VV2B 4PWWA 3FC9A 1WI7A 5AXMA 3CC7T 2VG6B 4DV7F 5U47A 3DB3A 1VBZA 2BX6A 3QSUA 2E12A 2EGEA 4ZA1A 3NCRA 3GYNA 2MZTA 5ETVA 4JJDA 4Q0BB 2HZVA 2NXEA 1RTZA 3QGIA 1HNZJ 2EFNA 2IDLA 4YP3A 4DV6F 1JU5C 3QT6A 1UJYA 1LK7A 3NG8A 4GVBB 3FJ5A 4KGKA 3L7PA 1JEGA 4NRUA 5A8WA 5GAGI 4LJMA 2V1RA 3J7A1 3QIDA 1N5SA 2ZH8A 4ATOA 1M30A 1SG5A 1UETA 1UFKA 3FQKA 2KXDA 3NCPA 3IWNC 2FHDA 2ECZA 4WIQA 4F2SA 2PUOB 2XCAA 2FPDA 4OB1B 1KQKA 1U5SA 4CNZA 2ALYB 2H9ZA 1D1BA 4PJJA 3IGNA 3JTNA 3NMZC 1TKDA 2ACMA 4DZ6A 5LMUJ 1JNRB 4C97A 4URGA 1HBUA 2DHXA 1QUPA 1FDBA 1FESA 2ZH2A 4PXCA 2CSIA 2QJ3A 4ANCA 3VJPA 3M1VB 3LD7A 1AW0A 3OVSA 2AF6A 4XTUA 2V4JA 2JUFA 3HDSA 2BZ2A 3MM8A 3CCRT 5F8NA 1M1HA 3N5BA 2OTLQ 3G87A 5HLFA 1R6YA 3M30B 3U1MA 1OY8A 1X4HA 2HHHJ 3GF5A 3JCMd 4PCQA 3OXFA 2ROGA 3M0SA 3GLXA 3N6MA 2LTOA 3CC2A 4NRTA 4B17A 1HD1A 2KM8C 5IFMA 4HT5A 1RWNB 4K0KJ 1NHUA 3SWNB 1J2VA 1B07A 4ZVPB 1PJ7A 2ZDOA 3D28A 1X43A 1FKAF 2MYFA 3I5SA 2JWNA 3K57A 3KHHA 5KT7A 1RT7B 1KK7A 3G6EQ 1RWPB 2E6ZA 4J9UE 4EBDA 1EETA 3VVUA 4RNHA 2HS3A 4OHWA 3NMRA 2EFVA 3RU0A 3M2UA 2EEYA 1LWFB 5GAN3 2V4RA 3CC4T 4LSNA 1KIKA 5F8LA 2CPEA 3MR5A 4EYHB 1FKOB 2H1YA 4GRSA 3SCLE 2N82B 4DR1F 1RAIB 3C6TA 1VQPA 1V3ZA 4JI2F 2GF7A 3OXGA 2V8DA 2CPZA 1D0ZA 1SBRA 3SSSA 3ENQA 3B6BA 4WE1A 3TUPA 3M4YA 4DR7F 5LL6S 3PG9A 2KY9A 3HFNA 1G3YA 4TYAA 1KHCA 4Y28C 3PW2A 2R2TA 2VONA 2BM0A 4L74A 1W2BR 4HR2A 1S1TB 3FBEA 3FSYA 1Z2LA 1UZDA 1FMWA 3NCQA 2XD0A 3G6YA 1RK8A 2GGPA 4EFAC 4J5YA 5I3UA 3JB9J 2P4RA 3K89A 2CQ1A 2OI2A 3TAMB 3V7CA 3H4BA 4JI1F 2ENMA 3I31A 2DNZA 4XAKA 3HT0A 1BB9A 1HQEB 3KUEA 4J9OA 3EPGA 3CC4S 3VUZA 3FMWA 3I9V9 2JTFA 4ZP6A 3ULRB 4HHHA 3A13A 2G4BA 1NH7A 5KFHA 4DX5A 2DNYA 1BMQB 4D3HA 2JXBA 4R0JA 3C3LA 1Q7LB 2L0AA 2H4YB 3T1YJ 5DG7A 1AUSL 2NUUG 1EFNA 3A4TA 5D4LA 3SBMA 3KMSA 1HMVB 3BN4A 1SC4B 3GR1A 1KQSP 2QLWA 4KJIA 2UVRA 1SQFA 3WIVA 3JAMY 2FJBB 5D4OA 3QWXX 3DRSA 4FNHA 2KT2A 4OV6A 2FG0A 5KG1A 1ZSGA 3ME9A 5FLXY 3NNAA 2HQ3A 3UT1A 3MEWA 4JZ4A 3I0RB 3H0IA 2E7XA 3H41A 4BHQA 2Y1JA 1JNZB 1UTIA 1HLWA 4K4VA 4MIAA 3QLHA 2XMAA 3OYEA 4TXSA 1MSWD 1QVFP 3GG1A 1WHXA 2HQFA 5F8HA 1BI1A 2RI2A 3I82A 2F65A 2R3VA 1T9VA 2I2YA 1PIEA 3VVTA 4TY8A 4B9XA 2E1PA 2DBMA 4OZ5A 2FY1A 3D6FB 1WORA 3KNAA 2RJCA 1F9EB 3HHLC 1YITS 3M8YA 1UGQB 1TL7B 4HHJA 2RHSB 2CDTA 1S49A 3AODA 3GMGA 1YN8A 2HMIA 1X4DA 4QT7A 1QAJA 4PXDA 2DTOA 4CH1A 4A54A 3JB9F 1D1UA 3FBCA 3REBB 4LN2A 3FEXB 3UNYA 2J76E 4C11A 1LW2A 1T9TA 2VFUA 2XQCA 3PGGA 2JLFA 3KG0A 1HQ2A 3QG1A 3PHTA 1WI8A 1ZSZA 2DEQA 4PKCC 5BR8F 1U47A 2PEBA 1VQPQ 5DJBA 3HSBA 1NH8A 4KAIA 1BWVA 4QBUA 2G6FX 2FYKA 5DS7A 3ZZ0A 4B9MA 4K4XA 3BR8A 1QW1A 5CKBA 4JI8F 5DETA 1R0AB 1K0VA 4DPUA 2VA2A 3M9OB 3W65A 3T41A 2HHTA 1AXQA 1SJ4P 4QWAA 4TU8A 1REVA 4A8MP 2IA6A 2QO3A 3KYLA 4RW9B 3G6ET 4M78A 4O5VA 2YWEA 3CXCS 1RLQC 4LF6F 1M8VA 4DV4F 1VRTA 4X4PA 1C0TB 4U8YA 2FRYA 3NS5A 1X4CA 1AWXA 1N5YA 1HI0P 3BFMA 3REAB 3CCTA 1FO1A 3J80Y 1WJSA 2EK6A 4XQ3A 3BGUA 5GMKe 4PJOE 1BQXA 1NLKL 1LW2B 3PT9A 2LDIA 3GSIA 4QW8A 1QP3A 1ITPA 2YXLA 2V8VA 3BGRB 4ECQA 4KUDK 4KBMB 1XMOJ 3MHYA 3JQMA 4DSJA 1MMLA 1SIZA 3Q2TC 1LWFA 1W7WA 2P9GA 2XWXA 4ZVEA 4F4YA 4K5RA 4EU0A 4ZPCA 3CD6Q 3T1HJ 3TA1A 4RW9A 3X25B 3HF5A 1S0MA 3CJ2A 3ZFJA 3PXGa 2POKA 1IREB 3M0PA 2PE8A 1LWEA 4Q5VA 2JN0A 1M2VA 1UGRB 4PFPA 5IHNA 5DDRC 4FF1A 2DO3A 2K7KA 1M5OC 3CPWA 2ZGWA 3HHNB 4H4MA 2HKNA 3HJVA 1RKIA 3GNFB 2E9RX 1GK8A 1YJTA 1YRUA 2NUTA 3MAAA 3HSZA 4BDZA 1H3HA 1UHFA 1RHJB 2JMCA 4LFAJ 1GRIA 2WZ1A 5DDPC 3UVJA 2BUDA 1QCOA 4RTZA 1PC4A 1GL5A 2JVOA 2QSFA 2XS2A 4Z2XA 5H9EJ 4DS5A 2C3PA 4NZ0A 2EG2A 1NAQA 1QWFA 2BKPA 1S4EA 3SB2A 4LFCJ 2A36A 2R58A 1RT4B 2VU5A 1VJQA 1K73T 4B6MA 2Z30B 2MOXA 4FNIA 4IKAA 2VG5A 2LDMA 4J9VA 2EYQA 4M5IA 1MWYA 3SFMA 2AYEA 3I55Q 3BJYA 4RW4A 1Q8IA 4GO7X 2OPPB 4IUFA 2YQ3A 4OMPA 2NUTB 3Q8PB 2X4XA 1AYEA 3NWRA 2GV1A 2DJZA 2XKOC 2IJNA 2DY1A 3UR0A 3AXMA 2W7PA 3UE2A 1VQKS 1LQ9A 3NOCA 4UY8T 1VQ8Q 3R9LA 2D3O1 1NJIU 2NPIA 2COZA 4BE2A 1FRKA 1TUCA 4ED5A 1AVZC 1HL6A 4ES1A 3V6DB 2OPQA 2MY7A 2EVZA 2AU0A 3NAIA 5K8PA 2B4OA 2QK0A 4HCKA 4BUGA 1RI9A 3S3MA 1IKWA 2XMWA 3OJUA 2PFDA 2CJAA 4BI4A 5B08A 2Y4YA 1B64A 3V8JA 1M5VC 2IMOA 3HVAA 4FXWA 4CI0C 3QJYA 2LP4A 4FW2A 4M77G 4Z7YA 1VQ9Q 4LDXA 2HQGA 3X26B 5DG8A 3SV4A 4PRFA 3OBYA 5GANh 2V8IA 1H8KA 2KU7A 2WB4A 2K79A 1WZOA 3CCMT 3MPVA 3QT7A 1IN0A 4WK1A 1K9MR 3SHWA 1Y3JA 1S0NA 3GPAA 3PW0A 2R7OA 4C3LA 4TN2A 2RU9A 3CCUT 3HKSA 1VQ6S 2JFKA 3W64A 4H4KA 3EZ5A 3QKJA 2WSEC 3CW2C 3UI3A 3C15A 1HYSB 5B0EA 1U26A 1KQ1A 1MN7A 3KG1A 2UV8G 3WX8A 4ECYA 4K5SA 1TS9A 2Q3PA 4RTUA 4ZPWR 3ZZRA 4HHUA 1GCQC 2G3RA 2YNGB 1CULB 4IOCQ 2FTRA 1JLAB 1Q0NA 4F4ZA 1CQNA 2YRVA 2PMHA 1N88A 3D6TB 2L9NA 1F5AA 3A5ZB 5H1SV 5E3PA 2ZNZA 4YDXA 2BR0A 4WCIA 1I8FA 2D41A 2GQQA 4DOZA 1XQHA 2EQMA 5KFIA 2W9CA 2J6FA 4DPXA 2FVRA 4YY3J 2XU8A 3JSRA 1C1BA 5KAKA 3PIPQ 2J0XA 2GO9A 2VJUA 1QVFA 1SEMA 2ZOMA 3DRRA 4JLGA 1S0VA 2XSJB 4F50A 3T5JA 4HI2A 5HK0A 4EI2A 2QT7A 3C66A 4A4HA 3Q24A 4CP5A 5K20B 4JI6J 3JCMV 2MPUA 3JB9G 3IR6B 4C0FA 2M02A 4KH0B 3CC7S 4EZ6A 2FPFA 1RU2A 2HWHA 1UJ0A 4BB7A 3UATA 4OHVA 5F3ZA 3GJTB 2KFYA 1MMGA 3MMAA 1NEGA 1SJQA 3GFYA 4EO8A 4FPIA 4PLLA 5GAOm 2RHUA 1ZM2A 2XLIA 1NG2A 2BJEA 2B8PA 2EGAA 2AQ4A 2HYIB 2E5KA 2OGUA 3LP1B 1VYTA 3TX8A 1QM9A 3RKWA 3A12A 4DV4J 2M52A 1FKPA 4NLYA 4UQTA 2ASDA 4ZVTB 4NS5A 4Y34A 1N6AA 1RUWA 4J9NA 1WFWA 4E2FB 1RAOA 1D0EA 2CVEA 1C0UB 1S48A 4KT0C 2B43A 4OVAA 4I64A 2O9VA 3MEKA 4M75A 3U1LA 1VA7A 3ZZPA 5CA5A 1PGZA 2CKKA 1XNRJ 2UVWA 1R8AA 1V5IB 1YBYA 4CO4A 4QR0A 3GV5B 1HBUB 2H48B 2XHWA 3ZO7A 3H8YA 1WXUA 1S72T 1BK2A 3AA9A 1RACB 3CCSQ 1NDPA 1WHMA 4JV0A 1OU9A 4U6PA 2VQFF 1RTDA 5T7LA 1IXKA 3UDVA 1EIFA 1M3CA 3T5LA 2E6NA 4N5SA 1SJFA 2LQKA 4CC7A 3KK2B 1UZHA 2VZ9A 1LXJA 4Q8FA 3DXSX 2IC3A 1VQMQ 4FXVA 4OZJA 4NCGB 4DL3A 2CZVC 4M7DD 3ER0A 4AT1B 2ADBA 2BKOA 4RR5A 4KFBA 4WFYA 1Q86R 4H4MB 2D9TA 3OFGA 5GAN6 4C8QF 5JJBA 5KE3A 4OZ2A 1WHLA 2M4MA 3ZTSA 3VAMA 2D7SA 2Y3YA 2OTJT 4LD6A 4ALZA 2GVZA 1R8HA 3VS7A 5EHHA 1C0UA 4QZVB 1CKAA 2DEUA 3M0RA 1Q4RA 2KO1A 3E01A 2KHCA 2JNJA 5LM7E 3HZEA 5C24A 1FXLA 2I0XA 2C06A 3LGMA 1ZAVA 5HCKA 3PACA 3P96A 2GGRA 2OHDA 2DE0X 2I0NA 2P0QA 1QDUB 1VRTB 2A28A 5G4DA 3R6OA 1SKWA 2A2CA 3EDRB 4WTOB 4WE1B 2C2EA 4OI2A 2KAFA 2HIQA 5KFTA 1VGYA 1A9NB 2QXFA 1T0TV 4Y92A 3MCOA 5AXKA 4DFKA 2CZ9A 2YUPA 4UOHA 4QPXA 2IBOA 1TH7A 4EMHA 2H54B 4M78D 3JCMW 2KBTA 2YLBA 3CMET 1MW7A 1I5LA 3DC2A 5GVQA 5D0GA 1B99A 3TEHB 5EX3A 1JXMA 5CH7B 2P4TA 3M1VA 4Z37A 3WX4A 3RRGA 2ZJQQ 3JYTA 3ITHB 3IA0A 2R2UA 3PJ9A 1QSSA 2FHKA 2YXYA 1LWCB 2CFXA 2DRAA 3MMCB 2IIMA 5KFMA 4EZ9A 4VUBA 1K8AU 1KHVA 2YWFA 1AZSB 2CPJA 3SDEA 1OJ4A 3H2LA 1JX4A 4B9UA 4F3OA 4O44B 1OU8A 3JSCA 2OD4A 4PJOB 4M7DG 4BWJA 4P5NA 1UVIA 2HL3A 4AFQC 4LIRA 1VQ9A 5J2NA 3G6XA 4X4SA 2RQVA 4PWUA 5KG7A 2OTJA 1CJVB 1GTEA 3GFHA 3META 1UG1A 3TSZA 2VG5B 3V7SA 1WOSA 3TX0A 1O0PA 5GANj 2CSQA 3P6YC 4M7DC 4X4OA 1GFWB 5DQHA 1XR5A 1OSDA 3P5TL 1JK9B 3DLEB 2MMYA 3O2IA 2LA4A 4M5HA 2P6TA 2KTQA 2H3JA 2E4HA 1TFYA 4GC7A 3DI6B 1ABOA 1TL5A 1YG0A 1AZGB 4ZJOA 2OEMA 4C0HA 2I5JB 2DRKA 1XJWB 3PFOA 1U49A 4NL5A 5IC4B 1RT7A 1MG7A 1ZAWA 1QVFS 4QIGA 3OT9A 2NSCA 2HZAA 5DLFA 1LNXA 2CJYB 2RF2A 4PL6A 1H641 2J7IA 1AWOA 4V19X 1QVPA 4LSNB 3M32A 5CKFA 4GKJJ 4WZMA 4ES2A 3GG0A 2XNRA 2BMBA 3ASKA 3V6DA 2ED1A 2H51B 2NSBA 4LE9A 1IKXB 5KG5A 4CIOA 1NK9A 3LW5E 3CPFA 1YJUA 2E1CA 4QWDA 5D4PA 3TWZA 1I94F 1TV6A 2DETA 2F69A 4M94A 3OYLA 2HURA 2E5JA 4ZIVA 5H9FJ 2DCUB 2GFUA 1TQLA 3FCWA 2E5HA 2RF0A 4LQ3A 3DLEA 4EDUA 1X8DA 3ZTOA 1U8RA 3CSKA 3EUNA 4B9WA 2O31A 2VDHA 4DG1B 2K3KA 4JDSA 5D15A 3OUYB 3FRNA 2ALZA 5I22A 1FWLA 2LEBA 1UWBB 4ZVOB 1N34J 3CMAA 3WC0A 2DIQA 1PSFA 2BJ7A 2HNIA 5A8WB 3B78A 2MQQA 1EAYC 1FMVA 1G3WA 1ZA2B 1NLOC 2VBXA 2C2DA 2IVYA 1YI2T 3JB9k 4QWBA 4BBYA 3C12A 2CQHA 2DIGA 4UZCA 5B0CA 4C8QC 2XYGB 3KLGA 4NOHA 4NLTA 1JJ2R 1XN9A 4Q2LA 2IVWA 4ELYC 4QIFA 2Y4XA 4FF2A 4RNMA 4F0HA 2F4FA 1R7IA 2HAXA 1JLGB 3NFCA 2QFJA 5BYRA 3IR5B 3GNGA 3D0IE 2DGWA 1C6VX 3TQEA 2XSJA 5KYXA 1NJWA 1H74A 4BLGA 1N34F 2NS1B 5AE3A 1J27A 3IO1A 1G5VA 3V2UC 4V1Ak 3IXQA 1N8RR 5J2PA 1ZZNA 3QDRB 2J8AA 3UD4P 1LJOA 2GJFA 2DL7A 2FYXA 2F9JA 4NLDA 1HI1A 2V67A 4KGXB 3G82B 1FWKA 4URQU 3I5BA 5HMZA 1QLNA 1J5OB 3AJ1A 3M4GA 5I2MA 2HCKA 3KUFA 1HR0J 3MUTP 2AJFE 1H7XA 2PGCA 2UXCF 4WPAA 1NLPC 2COWA 2F4VJ 4CYUB 4W92B 1YTYA 3NNHA 2EW3A 5IWAJ 2A1BA 1F60B 2R7VA 4N41A 1ZBJA 1NZAA 3DOLB 3RBEA 1HBOA 1WC5A 1LWCA 5E3AA 3LW5C 1FRMA 1GXTA 4WKYA 3KDOA 3G1JA 1QSLA 4KULA 1UWAA 2BZYA 4CT8A 3MEEB 1XNQF 2FUG9 2RRBA 5BXIA 5C5JA 2QN6B 3P8HA 3PJWA 4FW1A 3PW7A 3KUGA 4NLQA 2FGCA 4NL3A 5J2NB 4NYPA 4X66F 3M6XA 4Y28E 4MFBA 4QOTA 3PX0A 2HSPA 4ZIWA 4ED3A 2N4CA 4M77C 4QIEA 1HHTP 2A3JA 2KE9A 1WPYA 1ZZFA 2XMJA 4X4NA 2M7SA 2CPHA 4IRCA 3K5PA 3BO4A 1U02A 4CLKA 2ZVIA 4OP0A 4J8OA 2BRKA 4P74A 3S3NA 3L42A 2OTJS 1K9MT 1C0TA 2H5EA 2IVFB 4OI4A 4KV8B 3MEEA 4LRCA 2OAUA 4YR0A 4NEZA 5GANd 1KLMA 1UE9A 3LTOA 3C4SA 2SXLA 2HBQB 4OMFG 2MI6A 4MJKA 2C1EB 2ZH7A 2J0SD 1VQ7A 2HG4A 2YH0A 2PEHA 2BE9B 2YSQA 4RNOA 1I51B 3U23A 1MMDA 1S6QA 5ETQA 4Y6IA 3R8YA 1Q8BA 3P45B 1DTQB 3Q1JA 8AT1B 4CO0A 1KC8R 1DQ9A 4O0NA 4JRIA 2ZZDA 2ASJA 4WU3A 4OMLA 3CD6A 2ROPA 2YKMA 2ZOFA 5CYJA 2YWHA 2Z2ZA 4I6WA 3KHLA 3Q8UA 5ITHA 1B7TA 2BABA 1RWMB 2QEXT 3ENVA 5KFNA 2RMOA 4ZVSB 1IQZA 1NBEB 2RN8A 2E5LF 5C42A 2V69A 1FD2A 3TVYA 1FDAA 2CJ9A 4J7CA 2AZ1A 3E2UA 2MLYA 4ECXA 2FL7A 2FGOA 1FX2A 4TNOA 1WHKA 4G6VB 1TV6B 2CWXA 2DO4A 1XNQJ 3MXHP 1UJ5A 4Y65A 2BZ8A 4M78E 2XBPA 1VLYA 5FU6C 3ZXWA 2XY6A 1GMWD 4CRIA 2V9KA 1WD6A 3U1NA 2IFXA 3KHGA 4DR1J 1FRLA 1JKHB 3GV7B 3EXCX 2VVKA 2OO4A 2AJ4A 1S12A 5FDLA 4R8UA