1NPPA

Crystal structure of aquifex aeolicus nusg in p2(1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 53
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nppA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nppA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nppA01
3G71A 2KDSA 3CCLA 1VQLA 1VQNA 5IT9E 1M90C 1KQSS 3G6ET 3CMET 2L3RA 1W2BS 3CCLT 1QVGA 5J3BA 3P8BB 1K73U 3CC4A 1K73C 3CD6A 1K9MU 1UEBA 2G3RA 4TVRA 1VQ4A 1M1HA 1KC8U 2JUFA 3CCUT 1Q81U 1KQSA 3CMAA 1VQ6T 1VQMT 1N8RU 2KPPA 3H7HB 3CCVT 3I55T 1YITA 3CC2A 4X34A 3LPEA 3G71T 4QQDA 5LL6S 1KD1U 3I56A 1VQMA 2K06A 4RG2A 1Q7YC 3EWGA 2KVQG 3HKSA 2LQ8A 1X6OA 3CCRA 1YHQT 1YJWA 3CD6T 3PIPA 1QVFA 3CCMA 2XHCA 1EIFA 3J80E 1YJNT 1VQ9T 1IZ6A 2E70A 1VQPT 3OW2A 1YI2T 2QA4A 2JOYA 2QEXA 1VQKA 3J7AF 1VQ7T 1M1GA 1YJNA 1VQLT 3OYYA 1M1KC 1KHIA 4ESNA 2OTLA 3CC7A 1YIJT 3LGFA 2CKKA 1Q81C 1VQ7A 2OTJT 1NZ8A 3CCRT 1VQOT 4OBIA 3CPWS 3CCUA 3CCMT 1Q7YU 3CCQA 1NJIC 3JAME 3CCVA 1VQOA 1NJIU 2QA4T 2QEXT 3CCQT 1Q86C 3LD7A 2IG0A 5J26A 3QQCD 1Q86U 3LH0A 3CCJA 3PIOA 3DLLA 3CC7T 3G4SA 1M90U 1YIJA 3TREA 3CCST 5IAYA 3KBGA 1YJWT 1M1KU 3G6EA 1BKBA 1NZ9A 1QVGS 1XNIA 3CXCS 3OW2S 5A2QE 1JJ2A 1VQ9A 1W2BA 1RL2A 1VQ4T 3I56T 5FLXE 3J81E 1K8AU 1VQKT 1YJ9T 3A5ZB 3LGLA 2JNGA 1KD1C 3CMAT 1VQ6A 1YHQA 3CCEA 4YTLA 1VQNT 2E6ZA 2MWOA 1YJ9A 1YBYA 2DO3A 3CC2T 3G4ST 1VQ8A 5DLQE 3CCET 1VQ5T 2MI6A 1NPPA 3CC4T 4CRIA 2MWPA 2OUGA 1NPRA 3ER0A 1YI2A 2LVMA 4ZN3A 1SSFA 1VQ8T 3CXCA 1JJ2S 3I55A 1YITT 5HY6A 1KC8C 1K9MC 3CCJT 1XTDA 2OTJA 3CMEA 4ZN1A 2EIFA 1N8RC 3CCSA 1S72T 1QVFS 3DB3A 3DB4A 2OTLT 1K8AC 1VQ5A 1Q82U 5DM7R 1Q82C 1S72A 2EXUA 2JVVA 3CPFA 1VQPA 2LCLA 3CPWA
chains in the Genus database with same CATH superfamily
3T9NA 1CQNA 3X24B 2QLWA 3JTOA 1SL2A 1WJQA 1UEBA 2AEJA 3CCUT 3TX8A 2M4MA 4M5IA 2VC0A 3O8WA 4BHQA 3W9HA 2J7KA 3HVRA 3AOCA 3RTVA 4RTXA 3CCUS 4E6RA 5HMYA 2CP3A 2XHCA 1UVIA 2RPNA 3M8PA 4OI1A 3AAWB 5KFOA 4B3SJ 3CMAS 4AL6A 3HCXA 4DSIA 5KFBA 1X5PA 3J7AF 3C14B 3M1VA 5FU7B 4FYXB 5HAOA 3MJXA 4QIVA 1TKZB 2IY5B 4MMLA 4RW6A 3DOKA 4XTUA 4NLGA 3I31A 5CYMB 3BDPA 1S1XB 3GFXA 1VQ6S 2LXFA 4DR2F 1YHQS 1N8RR 2HK2A 2BZ2A 1CJVA 2MPXC 4DU8A 5J2MA 3CT9A 1VFJA 4LF9F 2OTJS 3G6EA 1SQFA 3M6UA 2PC6A 1VQKT 1XQIA 1YJUA 3FIFA 1UE9A 3P4UB 3UA6A 3KHHA 3UN3A 3HHLB 2EGAA 3EVOA 2BMBA 1IBKJ 1Q82R 2D74B 4WWSA 2XLIA 2J6FA 2UUCF 2ESWA 3QZ7A 2QGGA 4O3NA 3MO8A 2D6FA 3GP9A 4QYZK 4J7IA 1S6PB 2CQ2A 3HHLA 5ETSA 2NXEA 1WHMA 1VQLA 1N5TA 5DS7A 2E5JA 3AHUA 4C5EA 1A0NB 4PJOA 1S1UB 2GGRA 1DTQB 4RWXA 4O0IA 4CM0A 1I94F 4EMKC 4IQMA 2Q6CA 1H2UX 3NCPA 3Q8SB 2BYCA 2OI2A 3PO4A 1OPKA 5T7LA 5CYMA 3G6ES 3CC4Q 4W90B 5GMKj 4FYDA 3DOKB 4QW8A 1TKZA 4M75C 2GGPA 1SF9A 1HPZB 3M1VB 4RTYA 3JCMh 4OBIA 1OWXA 1WOOA 1R6VA 2F63A 4M5NA 5KFVA 3CCQT 2K5LA 3LD7A 3BGUA 2RDIA 2OGUA 3BB5A 3VKIA 3I0RA 4E7JA 4KBMB 3CMES 3AOAA 3JCMX 1RWUA 1N27A 4XTWA 2QFJA 1PG5B 3D6MB 1U0HB 4M77D 4FF2A 2DRMA 4CC4B 4EDUA 1HJDA 1R3NA 3GFZA 5IM0B 3M57A 5CXTA 3CCUQ 3ISZA 2MWOA 1HNZJ 3G6YA 4JI1J 1FDBA 3R3TA 2HD0A 2DNLA 1VQ8T 2VBZA 3M55A 3ZZRA 1HMVA 1JQGA 4DPXA 1M8VA 4LFCF 1DARA 1HWIA 5C25B 2A08A 4MYTA 4GKKF 2CQIA 4C92E 3QT7A 2WB1D 2LJ3A 1FRMA 1B64A 5HO4A 2GQCA 2CH4W 2KY9A 1KOHA 5FDLA 1FXXA 4DSEA 2MK5A 2CAJA 1KR4A 3FMWA 2HGMA 2BEFA 2E1PA 2RJZA 3BN7A 2OPSB 2K57A 2P4TA 4FSXA 4LIRA 2O9SA 3DLGA 4NZ7A 1RTJA 4JLIA 1BIAA 4O44B 4UW2A 2R7VA 2Z58B 4U96A 3Q8UA 3TU4K 4C8QC 3DHXA 2NZ4A 3SCIE 3FBFA 4B9WA 1FXRA 4LF1A 1MV0B 2C0IA 1HBNB 1R89A 4QU6A 3MM5A 2K2MA 2CP6A 2QN6B 1FRKA 3VZHA 4KY3A 4J9VA 1Q86C 4NEYA 5F8GA 3TEEA 5GAOp 4ZMMA 1IWGA 1IKYB 2C2KB 2EBGA 2GVZA 3IR5B 1T7PA 5AJ3J 3QGGA 2VJUA 1S9FA 4NXNJ 1O75A 3NGKA 1HBOA 1HNVB 3TA2A 4LDYA 2VVKA 2NREA 3HK2A 1Q5VA 3US5A 2EFPA 3NG8A 3R7BB 2P0PA 3DB3A 2JXBA 2GF7A 2MAMA 4IQXA 2YH0A 1D3WA 2NLWA 4IRDA 3NGPA 2JJ9A 4M7AA 4IURA 5JVHQ 2MY8A 1H2TZ 5B0EA 2DNUA 1FEEA 4L76A 2BJDA 3META 2LQ5A 1FWKA 4YB7A 2WHOA 4YUDA 3D6HB 2UXDJ 4C0OC 1NKBA 2KT5A 4ICLB 2HHXA 1UVKA 4JYAJ 2W7OA 1PAUB 3DLJA 2Y4YA 2CKKA 5K8NA 2PI4A 4M77G 2C3MA 5E0OA 4CNZA 4EI2A 5IN1A 1SH3A 2GJIA 3A3NB 1RI7A 3P5TL 2P9GA 2QC3A 5HROB 3H90A 3QGHA 2V50A 2ZDPA 1KVJA 1K9MR 1T05A 1SI9A 2R8JA 1NZ9A 2HAXA 2E5GA 2AK5A 4FW2A 2YY3A 3GONA 1RL2A 4YR0A 2KJVA 4W4MA 1HW9A 1FO1A 5KYYA 2CIMA 2DTOA 3QYGB 1FWPA 1ACMB 4K11A 3CXCA 3GPLA 1HKAA 2I6WA 2APOA 3RMSA 3CCJT 1N36F 1MWQA 1FA0A 1QVGP 2Y8YA 2QDLA 1X4HA 2VBWA 4H4MA 3NNAA 1GRIA 3J80U 3VTIA 1AZEA 3THVA 4DCPB 5E2QA 4KGVB 4USWA 3OSSC 4UZCA 1QDUB 4CH1A 1WI8A 4LF6F 2YUPA 2CQBA 1N34F 5D3GA 3OXGA 4MJKA 2Y1JA 3HFOA 5KFLA 4XDCA 4WKYA 2HMAA 3LA0A 2LQNA 1R0AB 3F73A 3FDRA 1KQ2A 2P2CB 3MR6A 3OL9A 4L3NA 3KK1B 4G1PA 2NUPA 1FEHA 2DLPA 3CCMT 3MTJA 3J7YI 2V34A 5HVGA 1Q95G 2FPEA 2XMKA 4I2PB 2KM8C 5A8WB 2XO6A 4FW1A 1WHKA 3EFOB 4NX9A 2YUQA 1Y7PA 2H1YA 4I7FB 5LOQA 3ADAC 1U6FA 5AYFA 1AZSB 1UGRB 2DR5A 1TTHB 5IT4A 1XNQJ 3CJTA 4RUCA 2UXBJ 2B7BB 4NLTA 2UVWA 1IXKA 2RRNA 3Q8VA 4DS4A 2YNFB 4QWEA 3CMEA 3KLGB 3HHLC 1WOSA 1ZUKA 3Q8PB 4NLVA 2CKWA 4DZ6A 1UG1A 3QSIA 1RB0A 2BKNA 3TA1A 5IXFA 4TYBA 4OYZA 2LCLA 3MM6B 1T3NA 4K0KF 1TQLA 3VV0A 2L3RA 1XWLA 4KO0B 2R2SA 1K73U 4URSA 1KSPA 4DUTA 3HHLD 3TA0A 3DXSX 4V2SA 1KD1R 4BI8B 4DFKA 2XZWA 5CZXA 3IRXB 4LFAJ 2HBQB 3R6GB 5L38A 3MEDA 3TYTA 2RHYA 2EQKA 3O2IA 4EZ9A 3GIIA 5DJBA 2ACMA 4OMFG 1N6QB 2RHUA 1N56A 4M5DB 4KHPJ 2ZNYA 2FC8A 2FUG9 5B0DA 1YZ6A 1PKTA 1PJ6A 4MIAA 3GJRB 2V2KA 3GE9A 2VBYA 5E5NA 3HPOA 3BO2A 1VR6A 3MURP 2FO0A 4G1QB 1MMNA 4M7AG 1RTIB 4DFPA 1WORA 4M78B 1OQKA 1NU4A 1VK8A 1G5VA 3OQ2A 1VHIA 2DNNA 3GWCA 3MMCA 2QEXQ 1XOVA 3CMQA 2FDNA 3SDZA 1F9EB 1D09B 5H1SV 3K59A 1R8HA 1RWPB 3W1YC 2YWKA 1YBTA 1FJGF 3CXCR 1RT7B 2BJ7A 4CRIA 1VQ7Q 3RKXA 3V6KA 2KYXA 5J1PA 4QQBA 2A7YA 5IWAF 4ZVOB 5U47A 2L5QA 2PNIA 3PIPQ 1ZSZB 2KBTA 1OOTA 2O9VA 5SUHA 2LC4A 2BDPA 2J7IA 1X9SA 2G1DA 2ALZA 1LWCA 3CF5Q 4V1Ak 5AXNA 1RBLA 1RTIA 2YPZA 2GFUA 4G1QA 2L9NA 1NJIT 2RS2A 4NPOA 1I5LA 2YNIA 4M1KA 2OD6A 3DFEA 2KT1A 3QPHA 1CJTA 1VQNQ 2LQBA 1TAUA 2CDRB 2XTJP 2ZD1A 2DNYA 1FMVA 4XU1A 3M0TA 1AROP 1KFSA 1PKUA 1ZPVA 4Q45A 2J0XA 4RW9B 1IZ6A 2XGPA 3OYIA 3CCZA 1CULB 1AWJA 4DG1B 1TL4A 3P3DA 1XMBA 4ECUA 2VOPA 1KD1T 3LW5E 4F36A 4M77A 4ZKAA 2B8PA 2QG9B 1TL7B 1NJIC 4AFQC 3KLIA 1QAJA 2I0XA 5I3UA 2UP1A 1T0HA 3PEHA 4DSLA 2ENMA 1L3SA 2R7QA 1ZM4A 5IT9Y 4PXBA 1XNRJ 3M54A 2I1RA 4DPUA 2HSPA 1N9RA 4AXJA 1D1AA 2X51A 4DCOB 4O4GB 2ZE2A 5HL7Q 1SJRA 2CPIA 1YITT 3PVXA 1TFYA 1XTDA 3O44A 5HLFB 3DB4A 2QSWA 4I7FA 1WQWA 4FDFA 2C2DA 2XDBA 1S97A 3MAHA 2HNIA 2ALYB 1GXIE 2EC2A 1Q86R 2VUGA 4U9RA 2V68A 3C15B 1L3VA 1BY9A 2AJ1A 1VQ6T 4F7UB 2B43A 1NH8A 2OLWA 1WJSA 5CKDA 3F70A 1D8YA 1XNQF 1RI0A 3KK1A 2Y3YA 3QZ5B 3VAJA 5I3PA 3HZGA 3NBPA 4HHHA 1FFGB 1EKRA 4DFMA 1HYSA 4RBTA 3HVAA 1SJQA 1UVJA 1BYMA 1E6VB 3LGFA 4TXSA 4JS5A 2XS2A 4J9NA 4YN3B 1J5OB 2O67A 5KT4A 2HSEB 3CJSA 4LSNB 4XPEA 3T1YJ 3DRPA 2QL9B 4PKCC 4BS2A 2ZPGB 4WFNQ 1U5SA 2DGXA 2Y1IA 2G9OA 3EVMA 5H9FJ 1FCAA 2P8IA 4ZHRA 4M7DE 3QHSA 4PG8A 2V8PA 1JJ2A 2YQ3A 2RO0A 3OTBA 3KJQB 2I0NA 3DHWC 1W7WA 4EO6A 5J1EB 1T9YA 2FVQA 2ZBPA 3OQ5A 3BPSP 4Q7AA 2CZ4A 2QK0A 1GXLA 1JXEA 1XC9A 3PT9A 3I5BA 4R5PB 1T3SA 4OYMA 3QFWA 1XQHA 2WVEA 1P9YA 5HKCA 4F02A 3HL8A 3R97A 2W9BB 3RAXA 1M5SA 2IA6A 2PT0A 5ECAA 2QQRA 3MM7B 1EP4B 3CCRS 4X1VA 2LEAA 4RNOA 3CJKB 3LWIA 1RT1A 3BN4A 8ATCB 2C1EB 4UT4A 3PKMA 3MR7A 2MSSA 1KC8U 3A4TA 5L1KA 3W66A 1GK8A 2YBVA 3D6FB 4EK2A 1D0XA 4AFUC 4VUBA 2OP5A 4P7VA 5DM6Q 3L2QA 2BE2A 2KQWA 3A1YG 2RDJA 3NTKA 2JLEA 3CD6S 5KFEA 3ULRB 4LF6J 1RJJA 1U1LA 4X2BA 2DFUA 3PGGA 3CCUA 4I67A 1JLFA 2V8IA 3A8MB 4N4GA 2FIUA 2V94A 3J7ZT 1WQ7A 4DR7J 1X4DA 1QKWA 1MHNA 2UUTA 2HGNA 3HRTA 2XLJA 4ZVQB 2BE9B 3B6BA 2R9LA 2EVRA 4U7CA 4UOGA 4WFAQ 4YR2A 1KTQA 5GAN5 1YJ9S 5GMKi 2E7XA 1K0SA 3CCET 4GKJF 1NPRA 3UD5A 3NFCA 2NXJA 2UUAJ 3AY0A 2ZDOA 2K6DA 1NE8A 4DN9A 5FROA 1YCYA 1HBOB 1HNVA 4HCZA 2FZGB 4A48A 1WXUA 4CC2A 5HN0A 4FXDA 4CP5A 1XK8A 1KVKA 3CPFA 3VHQA 2CZ6B 3FZBA 5L46A 3BREA 2CYZB 4KT0E 4USMA 2QMXA 3MCMA 1W2BS 3INZA 2E3IA 4PXDA 4OHXA 1RAFB 3D3BJ 3THKA 3PO5A 5AXKA 3EG9A 3H2VE 2QMWA 2WAQD 5F0WA 2WSEE 3MOJB 3EDRB 1HBNA 1V29B 2E29A 1PJ5A 2LVWA 1HQEB 4NXNF 1NK6A 3DLHA 5SZTA 3HHKA 4WFBQ 2JFDA 1OSCA 4JI2F 1RK8A 3N28A 1T3LA 2CJXB 4C8NA 1SUQB 3TCJA 3JCMP 5ETMA 4O3QA 2VJVA 5KFGA 1SJFA 2XNRA 1T95A 1S6OA 4PYDA 4LVNP 2EQIA 1IKWA 3M30B 2E65A 2W2QP 4USIA 3PNIA 3JSMA 3CC7T 2BUDA 1WDTA 4WU3A 4U7UD 1H3ZA 3PJWA 5KE3A 1CEZA 4CIOA 5EUHA 3K7RA 4FCYA 5GAN2 2DNGA 2JNGA 1KD1C 2V0NA 5B0AA 2J05A 1ZBTA 1ULRA 3ZZPA 1SHGA 2MI6A 1WJ9A 2EQJA 4CI0B 3SQOP 2XM3A 4DR6J 4DL5A 1VRUB 4OMLA 3QWYA 2N4CA 5JXSA 1EAYC 4IKFA 3HVTA 3JB9J 1FF2A 3G4SQ 2VFUA 3G6VA 2QEXS 4DA4A 4E0DA 4J91A 5AJ3F 1M5PC 2Z2LA 4WE1A 4BDYA 4LDXA 3GIMA 5BR8J 1EETA 5DQIA 4RTZA 3CCLA 1U1TA 4DV5F 2HNZB 1RAOA 3I0RB 2F1LA 2IDLA 2YKPA 2DNPA 2XMFA 2IAJA 2O5DA 1VQKS 4BWJA 2NPIA 4ANDA 1W2BP 3T6JA 3SWNC 2HHQA 4ZPBA 4FT4A 3P45B 1KBRA 4NS5A 5I4MA 2KH9A 4MKBA 3M5AA 1U2FA 1FT8A 4PCQA 2Z0WA 4RU2A 4HVUA 2UUWA 5KFMA 5T7LB 1WC4A 5AXMA 1RSCA 4USHA 2HWHA 4IDKA 4DPOA 3H9NA 4YQWA 4ZVTB 4QJVA 1RT4A 3T9ZA 2JEJA 4DX8H 2PSZA 3CJ3A 2K3BA 3AHPA 4ZP6A 2HVDA 2Z2ZA 3TOQA 3VAKA 1GFWB 1QD1A 1TL3A 2HQHA 1WSVA 2MZJA 3PV8A 2E7WA 2YKMB 4MK7A 4J9SA 5EC7A 1S1TA 5IXUA 3WC2A 2H3JA 4UUWA 3GFYA 4DHVA 3EGXA 3QRRA 1HWJA 4C3LA 4YDDB 4F16A 2DVEA 4LFBF 2EEYA 1WYXA 2QASA 2WW8A 4PPDA 2WW4A 1YSJA 2DGWA 4D6WA 2ATLA 2DIGA 2QTXA 4M5LA 3I32A 3X28B 2IVYA 4CH0S 3VAFA 3H5XA 4AG2C 3A8HB 1VQOQ 2DL5A 3MTKA 4DV2J 4DFJA 3FRNA 3QWUA 1WHWA 5KG4A 3MR5A 4ECZA 3W5ZA 5J2MB 2VXFA 3MAAA 2ZBRA 4DZDA 3ZZOA 2ILYA 2F1FA 2EBEA 2FPHX 3RR6A 4PJJA 1PKSA 1R0CB 2KROA 3TQEA 4CLTA 3TWZA 1HNWJ 1WHHA 2FHDA 4WP9A 3D0IE 5ETOA 4B08A 4EWTA 3X25B 4H4OB 3C14A 1X6OA 3CCRA 2JM8A 3CCMA 1IRXA 3AT1B 2D3UA 2HHTA 2IIHA 1TL1B 4LF9J 2X3WD 4JRPA 1K0XA 1OY6A 2HNZA 4IFYB 2DA9A 2FD2A 2BZXA 3GIBA 4PNOA 1S9EB 3OV7A 4P7TA 4OVAA 2OMOA 4WIIA 2V1RA 1L3KA 4ECRA 2HRUA 2BA9A 1KS2A 1WNLA 3I82A 1ZS6A 4FF1A 4F2SA 3CBMA 1WKKA 4C5GA 2DNRA 3IG1A 5ITHA 2AX0A 4DV5J 2FJDB 2FZKB 3KNGA 1X69A 4HVWA 2PO4A 2HW3A 4MKVA 4ER8A 2ABLA 1IKWB 1TKTB 2GTJA 2VUBA 2E5LJ 2LQWA 3TZXA 1M90C 2BOAA 1M1KR 1NLOC 4P2MA 8AT1B 1WA7A 2KM8B 1M1HA 4JI3F 3MP8A 3MPWA 1J27A 2VPXB 3WVDB 3W63A 4EBCA 5H9EJ 5DDPC 3WC0A 4ZVUB 1CKAA 1UGVA 3K0JA 3KUFA 5E3RA 3N6NA 4HEA9 5KOXA 3OL7A 4F3QA 4QW9A 2VBXA 2XYPB 2WOMA 2QE5A 3NOGA 3I6PA 4RNFA 2J76E 1G8XA 4NEZA 1SXLA 1RCXB 3K2YA 4CT9A 2HZVA 4B3RF 4FM4B 4X9DA 3PMIA 2P9EA 4QZVB 2MEWA 1MU2A 5E33A 3M7VA 4ZCKA 1S77D 3FGVA 4BCAA 3GYGA 4F7UF 4F4YA 1HNIB 7FD1A 2L2PA 4G1IA 4KKOA 2KL8A 3V81B 2DL4A 4HCCA 4UOHA 4C8QE 5LJ5Y 2CJQA 3CCEQ 2ZM6J 5CQGA 4F4ZA 1KC8R 2AHOB 2W4CA 4FKXA 2HNDA 3H25A 3HHDA 1I1GA 4OQJA 1ZTWA 1S9GA 5F9NA 4WFXA 2YXLA 2BBEA 5HP1A 3CE8A 1C6VX 3PFOA 2DPJA 3UFCX 5CQXA 2BR0A 4F7VA 1W2IA 2VPZB 4X84A 4QIWD 1JLFB 3EX7B 4BWMA 1RAAB 1SPBP 2EJGA 2KRRA 1VQ5S 4J90A 1MGQA 2W7PA 4DMZA 1T3OA 1I07A 2JUFA 4DR1F 2MQ8A 4NLOA 4UOFA 2W4DA 2DIUA 3PCOB 4YDXA 5IH2A 5IQ6A 3BO3A 3ZFJA 1M3AA 4TLRA 3Q86A 1M30A 3TNVA 4KUDK 2E70A 1G4CA 2O66A 3ME9A 1CJKA 2JOYA 4CLLA 4I6YA 1XIQA 1ARKA 4QVZA 1KHCA 1C0UB 4JBCA 2MHEA 3M53A 2ZH4A 2F7VA 2B0GA 3D1HA 4Z02A 4DR5F 2JZ2A 3IO1A 1S0VA 1BQNB 4ATOA 4F0HA 3FUYA 2ZH1A 1RISA 1K1QA 5E3CA 2CQGA 3IAS9 2VONA 1JLAB 3UO0A 3HFZB 4WZQA 1YWPA 4KH1B 3T5HA 1U0SA 1OPZA 5KG5A 4A54A 5BXIA 2ZH6A 5J1EA 3BZQA 4GLKA 1VQ8A 3W65A 5LJ5d 3PYFA 2J6SA 1FNXH 2ZKUA 3ZZUA 2CQ1A 1TMMA 1WJRA 3MXHP 1OYXA 2QLFB 1QQJA 1F3FA 2FPDA 1ZM2A 4PLLA 3QZ8A 1B70B 1UVMA 3V6DA 2RUSA 3R5JB 2ZC4A 3ISND 2J0WA 1W2BR 3R9LA 3NS6A 3DM2A 3CTRA 4IO1A 4ME7A 3ONQA 4JV0A 2UXCJ 4OHYA 2G3RA 3GZ7A 3PW4A 4NYPA 1VC0A 3JS9A 2EFNA 2M9KA 1NJYA 4HL9A 2ZM6F 5MLCV 1QCFA 5A8KB 2L3SA 4LUEA 1YJNT 3OTEA 5KG6A 1TK5A 2QEXA 1WEXA 4XTTA 1KNZA 4BACA 2B4OA 1X8DA 2OFHX 1KRPA 1DTTB 3I35A 2PE8A 2FY1A 4Y34A 2YLBA 2G6FX 3KUHA 4NOHA 2JVRA 3ZNUA 4M7DB 4DPYA 1WWHA 1TSFA 2R8KA 2CA9A 6AT1B 4OI6A 1NEGA 5HLFA 1WDXA 1RABB 2NQPA 5KFNA 2B8AA 1WF1A 4Z7YA 4HHJA 3WX4A 2VKRA 4O4GA 2DXBA 2ZZTA 2YKAA 3MEGB 1FRXA 1IGUA 3MUVP 4M75A 1SIWB 3SV4A 3JSYA 5L1LA 3HULA 3EGZA 1EIYB 5ETTA 3JB9H 3T1YF 4N56A 1YCSB 2JNJA 4JS4A 2GS8A 1U7LA 3MCOA 3UATA 4C7QA 2MMPA 1RTHA 3BBBA 4HCBA 2ZUGA 1X2QA 4JV1A 4Q5WA 2WRMA 1NKEA 3WVEB 4BY6C 2VC1A 1WTFA 2K3IA 2VA2A 2IVFB 3A12A 3U1LA 2IJFA 4CLKA 4DG1A 1VQ4A 4QKUA 4J9BA 1Y0MA 2YT6A 3AA9A 2NWMA 5LL6S 1RAJA 2X35A 2RHIA 4RG2A 2DD8S 1QE1B 3EAEA 1VJWA 3NL0A 5G0RB 4RW4A 5FU7C 3V6JA 4LFCJ 2QQBA 4PKDB 3H0HA 1Y0HA 1S4FA 1PSFA 4JI5J 7FDRA 1RHUB 2OTLA 3T5LA 2HAFA 4KR0B 2Z56B 2QGFB 2BJ3A 4ENOA 3DRRA 4FXVA 1G3WA 1LVKA 2ZFHA 3IMQJ 1E6YA 4A4GA 3IWXA 3AOBA 3TUIC 2Q3PA 5HMZA 2FLOA 3ZZYA 4C8QF 2VASA 1KQ1A 4Y2CA 2YRCA 4QR2A 3SD4A 1RUSA 4XK8E 5CKHA 1W70A 4KFBB 4ZJLA 1Z9ZA 2DR7A 2KJWA 2B9XA 3PEJA 2HQIA 4M7DF 2XMUA 1K9MC 1CSJA 3MWBA 1FI4A 3OYEA 1NNDA 1MMGA 1VK3A 1QVFR 4JPBW 4OF1A 1QP2A 4L59A 4ZTJA 4ED6A 5IQQA 3DYAB 3T6BA 2VG5A 3JB9k 1U8RA 3CPWR 4M5DA 2CP0A 3M4XA 3QWPA 2PEBA 4P75A 3K57A 3IR6B 3MCAB 1U24A 4O3OA 4FN5A 5GAMg 3VCDA 3CC2Q 4KFBA 1WOPA 5K8PA 3QGPA 2ASDA 2PA3A 3K5NA 4Q5VA 4QQGA 3N01A 3G96A 2H4YB 5DG8A 2XMMA 3Q8QB 4BDPA 1H72C 5HVHA 2V2ZA 4ITSA 1Z9QA 2AGOA 1SC3B 4DL4A 1Z2LA 2KE9A 2X1BA 2ROLA 4C11B 2E5KA 4GVBA 3B8HA 3TVKA 1J2VA 2PIIA 3TQ1A 1Q81R 4ZGJB 2AJ2A 4UY85 1MWYA 3CDAA 3V7SA 1Q16B 4X4QA 1M5VC 1QE1A 3LGMA 4RNHA 3EH1A 1NEBA 2WACA 3B4MA 3I9V9 5A0YA 3JCMg 1GCQA 2EAYA 1YITQ 2D9PA 4HT5A 1V1CA 1GXTA 5A8WA 4K4SA 4HA8A 3EGNA 5LM7E 5GAOm 4OYBA 3TAQA 2M5YA 5DM7R 2EXUA 4NRUA 4K4XA 2AZ3A 3G71A 2NUPB 2DCLA 4TKTA 1R6YA 2RA2A 2OELA 4M7AF 4B9VA 5CO7A 2G2OA 2LU2A 3E01A 4PFOA 5E3PA 2W10A 2WB4A 3E2UA 3QWXX 3LP1A 3CD6Q 2E9ZA 3TQ7P 1L3UA 3CC2A 1VQMA 5KYNA 1Z2ZA 2AZVA 4HACB 4RCBA 1QVFA 2BUNA 1KLMA 3WHIA 1VYTA 1YI2T 2ZH5A 2GHVC 2YWHA 5D78A 2POKA 1RT6A 5B0CA 1SV5A 5GAMh 4NWBA 4ZCMA 2DETA 5DQHA 1U3OA 1V5IB 9RUBA 2RUGA 3TARA 2W0ZA 3FCHA 3R5AA 3TREA 1DTTA 2E9TA 4IUQA 4ZLJA 2R3VA 4CH7A 1M27C 3IBWA 2AEFA 4O5VA 1AWXA 2JZ5A 1IGQA 4PL6A 3Q22A 2HBRB 2IHR1 2D69A 1U25A 3TAMA 5GAOn 1IBMJ 4NMLA 1M3CA 4LF5F 1BQXA 3N6MA 5LJ5g 1G2BA 4TVAB 4YY3F 2M1HA 4DR7F 3U1MA 3CCJS 2EGCA 3BYPA 3RRGA 2NUZA 1S7HA 2J0QD 5GAOl 3DM2B 4OI0A 3HZEA 2RQKA 3MM9A 2CS7A 3CPWA 1QLYA 4OX9F 2B6AA 3TP2A 4OZ5A 3BSAA 2LU1A 3PJXA 1S6QA 2X9HA 2M02A 2UUAF 2NUUG 4GKJJ 2DE0X 1VQ8S 4ELVA 4WTYA 1ZUYA 1MLAA 2C2MB 4C92A 2LQ8A 3GU0A 3UCUP 1W25A 3MEEB 4OMPA 3KLHA 4K4VA 4ZTFA 4LF5J 1YJNA 2VFVA 2HK3A 1JLAA 2QL7B 4I0WA 1RTZA 4M7AB 2HKEA 2B51A 3N5BB 1G3OA 3OS0A 3FRZA 1VQOT 2AHJB 1TZ0A 1BCMA 1D1BA 4CTAA 1U26A 3MM8B 2KEAA 4KV8B 2P4RA 3C6TB 3IBCB 1YZ7A 3QQCD 2K4YA 2VZ9A 3D54A 2MLXA 1C0UA 2HBZB 1ZETA 2ZPIB 2L3MA 1ZPWX 5L23A 2ERRA 1IN0A 1OU9A 4IR1A 3W3SA 2ASYA 4DBFA 3M0UA 2GVDB 4BBYA 5DLQE 3NMRA 1S1VB 3OL6A 3EM1A 3J81j 5J2NA 2KYMA 4M5GA 2C28A 2VWFA 2RF2B 5IFMA 5FW9A 3JQJA 2DO4A 4B9UA 1VBYA 4CLZA 3QBYA 4JOUA 2CZ0B 3D3CJ 2GAGC 2DH7A 1KN6A 5DETA 1IBMF 1WLPB 3GV7B 2XD0A 3H8YA 4OZ1A 2O4XA 2YNHA 4HI2A 4F67A 3PW5A 2XKOC 1XNRF 2E66A 1WKJA 1RTJB 4PUOA 1S9GB 4KHRA 1LOJA 3CCVT 3I55T 4UY8T 2LNHB 1UW9A 3NAHA 4GKKJ 4P71A 5C42B 3R2CJ 2GMJA 2W9AA 2DD4A 4KULA 2HBWA 2DNMA 3TVYA 1VRTA 3IM9A 4HT9A 2UVRA 4NYZA 1NHKL 2B9WA 1YIJQ 4JI1F 2I2YA 2DHGA 4R0JA 3KK2B 1GTHA 5J26A 4L5GA 4O6JA 2DXEA 2C3YA 4F7UG 1HMVB 3CCST 4LSLA 3NGTA 2HIQA 2EVZA 2PU9B 3HHNB 1Q8BA 3PFSA 4LF4F 1VQ8Q 1NJWA 1WEYA 4TY8A 3SYZA 2OPRB 3W2WB 4L6V5 4WCIA 4LD9K 1OJ4A 4LMZA 1REVA 2EJ9A 3ER0A 2CP2A 3GNGA 2XI9A 3DN9A 2RK1A 2HS3A 3TUZC 2JSXA 2OTLS 2I5JA 3JXOA 3RR8A 1FMKA 3JCMW 3JQKA 3IGNA 1IKXA 1SJ1A 1RT2A 3OUYA 2DRKA 4NL3A 2HL5C 1H92A 1SHFA 4OB2B 4LRFA 2DHHA 1HD0A 1ZM3A 3MMBB 1KQSA 2MSTA 4IG0B 2HMIB 1EX4A 3QJLA 4BI3A 2ZITA 2EPDA 1FKPA 4PZVA 3MCNA 1NM2A 4FYWB 4DV1J 5I2SA 1JRIA 2DH9A 2R7SA 4DS5A 4RW8B 2M88A 1RBOB 5LL6d 2XSFA 4OYPA 1FKOB 5F8NA 2OTJT 1CS4A 4LNPA 1F1BB 1S9EA 3BKFA 1UWBA 2RS8A 3LGNA 4B6MA 4IFYA 4BD3A 3DLLQ 4PJNA 3QDFA 3Q23A 1VQ4T 4J9HA 3A8IA 1K8AR 1S12A 3CCEA 1T9WA 1AWWA 3H8ZA 4MK8A 3ZNJ1 2MOXA 1SH0A 4CNYA 1IJFB 2DBBA 4M78D 1GCQC 2XMWA 3IWLA 5C0MA 3DOMA 1KQSR 4F4AA 2CG4A 1QWEA 1M90T 2BM0A 4BC7A 2XG8A 2DTIA 1LKZA 4KGMA 1M8MA 2QA4Q 3J80Y 2YHTA 2I38A 4UF4A 3A3OB 5GAEI 3LPEA 1KQFB 3MMAA 5LJ3g 3BDEA 3E1SA 2YWWA 2GA7A 3NGRA 5LJ5h 1GBRA 2GW8A 5HVFA 1OMSA 3OHAA 1X9WA 3CMAQ 4DV2F 3OPKA 1NK8A 4JP8A 2YKMA 3L7PA 1GT8A 2XY6A 2R2UA 4HKQA 1BB9A 4RW8A 1TK8A 4LD6A 1NO8A 2MKIA 4X4RA 4OJGA 5A2QU 1RAEB 3OJSA 1FKPB 2ZJRQ 5KOWA 5GVQA 5KFWA 3OYHA 1P1LA 3NLCA 3OVBA 1QVGS 3MGJA 3QBCA 1TOVA 4C8YA 2RQUA 3VS1A 3EVWA 2AJ0A 3RUBL 2DERA 2Z2YB 2OX7A 4ZP8A 1I1JA 2EJFA 2LP5A 4FVMA 2RKIB 2R5AA 1RT2B 1X43A 4PABA 4GBQA 4NLYA 2YQ1A 3IR7B 1PNJA 5KFCA 1YWXA 5J39A 4DL2A 1D0EA 2W25A 3OT9A 1GMWA 2I5JB 4BE0A 3V8KA 3R5CA 5FU6C 1RWOB 2EPIA 2RILA 4WXOA 1P92A 5JVGQ 1REVB 4X64J 4N47A 1RE1B 2PZ1A 3W2WA 2UV8G 1H38A 1PSDA 2XMTA 1KG1A 3GIKA 3UDEA 4FPIA 5GMKm 4QIFA 2QTVA 2MZTA 2VODA 1TUWA 2A6OA 4XTZA 4FBTA 1VQ5Q 1H2VZ 4OX9J 2YLCA 3JRZA 2H5IB 3NNHA 4K59A 1WHXA 3KK2A 4U95A 5LJ3e 5KCOA 2EYZA 4IFVB 2COWA 5GAMe 2DGQA 1JLGB 4PXEA 2EQMA 3OTOF 1QUPA 2N7CA 2KI2A 5LXRA 3TR5A 1VQOA 1QUVA 4OMOA 3D9BA 1VHFA 4PWDB 4E7HA 1NZAA 2HRTA 4DV3F 2MJNA 4M7DD 5DY9A 4LN2A 4A53A 3ASKA 2KHCA 2X3DA 3SV3A 3NKYA 3PYDA 1DLOB 2HHSA 1SUQA 2AJFE 2B9YA 2AX1A 3M32A 3QZ9B 1OX8A 1I0CA 3OJUA 4WYWA 2RQVA 3IRWP 2QIFA 3D1OA 4K7QA 2IPOB 3GF5A 2FTRA 3H41A 2MQMA 1JQQA 1NSPA 5C2CA 2HHWA 5GAHU 1FRJA 1CKBA 4A0UA 3AD7C 1OI1A 3NWGA 1N33F 1DFDA 5J2NB 2KB2A 3K5LA 2VDHA 1S72Q 5CHCB 1BWVA 2HHHJ 4QR1A 4DEYA 5F3ZA 1XTZA 2M7SA 4IOBA 1ZYQA 3M56A 2ROEA 4ZITA 2WVFA 2ZOGA 4B3RJ 1RTDA 5EX0A 2YH1A 1F60B 2M0YA 4AD6A 2WTFA 1SJ4P 1B34A 4B3OB 2FPFA 1HFEL 3NCQA 2AT1B 1MROB 5G4DA 2MIOA 4Z88A 2BABA 4P5NA 2PQWA 3H6ZA 1RBAA 2FHJA 2RQMA 3G1JA 2N3OA 2JX2A 1BC6A 4HT8A 3LUYA 1T03A 3LP0A 1XJWB 2J9EA 3MEEA 2QEXT 4XPCA 3G4SA 2GAHC 4PWWA 3MEUA 1S57A 3PXGa 4ZK7M 4WFYA 2Z57B 1OZ3A 5IT0A 3IS9B 2VU5A 3V2UC 5H9FK 4JI8F 2GIRA 4F4XA 4EIKA 4LF2A 2B4VA 5IHIA 1RHQB 1JKHA 2WONA 2R2RA 4OHZA 3H40A 1B0VA 3TSZA 3X3UA 1T0TV 2XNQA 2CVEA 1D9FA 3A8JA 2QJ3A 1X01A 4Y2KA 3KXTA 2JHEA 1KK7A 3OYMA 3CC4S 4IOAQ 2JWNA 1PYOB 3V4IB 3QJJA 2FHJD 1VQNS 3Q83A 4OJ3A 5C2GA 3M0PA 2A2CA 2CYYA 3EZUA 2EWNA 5DGBA 3D7SB 4ECTA 4N76A 4LBPA 2MDAA 2W9BA 1CJUB 4J9QA 1RADB 1N8RU 3UDVA 2IMWP 1QKXA 5CKFA 4ZP7A 2EFOA 2AW0A 3PNWC 3UVJA 3K5PA 3FZ2A 3EGVA 1BWEA 1B7TA 2ZHBA 4MZPA 4KB7A 1ZAWA 2DEQA 4Y92A 1LWEB 4RLEA 1AHJB 3D66A 2F9JA 5GAN4 2FY8A 4ZA1A 1NUEA 2NUTB 1S72S 1U1PA 4E7IA 4HACA 3T5JA 1PC0A 2DL3A 3W2VA 2DNOA 4Y28C 3L42A 4ILRA 2HL3A 4OMMA 2PMWA 3HX9A 3LWMA 3LP1B 5A2QY 2CNKB 1OZ2A 1HYSB 1M3BA 2DF6A 4F14A 1VQNT 3IQLA 1CQMA 2L8DA 1A6LA 3MMJA 2F2XA 2V8HA 3I0SB 4M5JA 3HKWA 3FSXA 2EK1A 1VC5A 2W4PA 3HO1A 3TZZA 3QSUA 4JI5F 2MQNA 2DJQA 1U02A 1VLOA 2LEPA 4ID8A 4NI2A 2WVCA 4LR7A 2HVIA 4D8KA 2BRLA 3G8SA 4PWUA 3GSIA 2RNEA 2F4FA 3I5RA 4PG4A 1NRKA 3QT5A 1J5EJ 3RRKA 5IWAJ 2EKYA 2MZQA 1FK9A 1AD5A 2IRUA 3FK4A 1KQGB 2CNOB 4FU6A 5ADZA 1YJ9Q 4P6QA 1AZGB 4C11A 1JB0C 5THWA 1H641 1HLWA 2Z4PA 2GMHA 1WHVA 1M1GA 2D8HA 3GBQA 3T3FA 2A28A 4WK1A 5J1NA 2LYVA 4NASA 3L2WA 2V26A 1BD6A 3LH5A 1N54B 1PRMC 4MK9A 4LDUA 3R8YA 4MH8A 1U45A 1IBCB 3J7Z5 1BHNA 1DZ5A 3C95A 2F9DA 3VRYA 3AODA 2WVBA 4X4TA 3ETMA 4RW9A 5LMNJ 2MKHA 1UZDA 3UN2A 1PC5A 4Q2LA 2ZD1B 4KAIA 2DB1A 3D4JA 4DV1F 4QWAA 5HATA 3HKZD 1KC8C 5KFTA 3L1AA 4ELZC 2CZ9A 2YNIB 1FJ7A 2GX8A 2NR0A 2M0GB 2VIHA 4M4ZA 4DR2J 2G13A 2CWXA 2XSJA 3MEWA 2LA4A 5AE1A 1X2KA 1LFWA 4LR9A 2CJ9A 4WIQA 1JWWA 5IT9E 4DQPA 1F9HA 2M70A 3CCLT 2LT1A 2BJ1A 3CD6A 1G3SA 4FS2A 2ZEJA 1T02A 4ZGEB 1WDDA 3OR2B 2CZ7B 1P9QC 2G4BA 5GMDA 1UEVA 3Q1JA 3G71T 5GAN6 1SKRA 3QATA 2R7OA 1LEOA 2HZCA 2FHOB 2M16A 1HARA 3S3NA 2LCSA 2DY1A 2IRXA 3MMCB 4KSEB 4ATNA 1NMEB 1I4K1 4TNOA 4LF4J 3FJ5A 3D6TB 1FRHA 3HT0A 1FK9B 2OJ2A 2WSCE 1RU1A 3KMSA 3R6LB 3G82B 4RNNA 3CJ5A 5G0RA 5A6WA 2CP5A 1W1FA 1Q86U 2ZNZA 4DUYF 1T11A 3QT6A 1BKBA 3PIOQ 2VPYB 3H2UB 2V4JB 2EWHA 3CCVQ 3Q2TC 4MDWA 5HMWA 2YKQA 2NZCA 4DF4A 1RXOB 2UXCF 3QIDA 2QA4G 4X62J 1NPPA 1XN9A 3GP8A 2DYAA 3VGVA 2IA0A 5AT1B 1WPYA 2KG1A 4NLRA 4JJBA 4PJOF 5GAGU 1BU1A 2LT4A 1PO6A 1Q82T 1AB8A 2YXYA 1UTIA 3LH2S 3P6YC 3V8LA 2BKDN 2R58A 5B7WA 1SH2A 2BVZA 3M2RB 5D6YA 5D4LA 1CC7A 4R56A 4RZRA 2VPWB 2C22A 2K2VA 3P8BB 2YNFA 4ECVA 3V8JA 3MEGA 1GEHA 2HYIB 2ZC3A 2XULA 3EG2A 2K06A 4ZJQA 5EHHA 4ESRA 1OQ3A 1Y00A 5D0HA 4KRWA 4ZIVA 3PW7A 3Q0AA 1BQMB 2YKOA 2OD4A 2ILZA 1NKCA 1HR0J 2AV5A 2DNZA 3KFWX 2GJ2A 2HWTA 1VMBA 1TH7A 2UVUA 1RDRA 2Z0GA 1OS5A 5LXYA 2YQ2A 2C3UA 4A8KA 2ZPFB 4PQUA 2AZSA 1CJUA 4X66J 4U67Q 4RW7A 2KRNA 1LXNA 3K58A 5CCMA 3OXFA 4C4WA 2KYBA 4QYZJ 4K4ZA 2PA8D 3MAQA 3NP5A 3U27A 3KLVA 2OEMA 3MR3A 3EE3A 3I56T 3W7BA 1YFNA 2MKSA 2KN4A 2FJXA 1SKWA 5KFIA 1Q81T 1SKUB 1OYDA 3JSCA 4DR3J 2MJUA 1YI2A 4ZN3A 1UJ0A 2DISA 3R5DA 2RI5A 2PGCA 1O5JA 4ZIWA 2RE1A 4ZN1A 1NDPA 3CCSA 2IJRA 2PDAA 4C92F 1N0UA 3SBMA 1JJ4A 2DNKA 2FB0A 1H3DA 1OY9A 1SRLA 1VBKA 4CC7A 2OAWA 1RT5A 1N5SA 3V7CA 3VYGA 1K0TA 1GTEA 2M8DB 2QA2A 3RBEA 3CMAA 1WHJA 3C6UB 1VQPQ 3JCMV 1BQNA 2E5LF 1N5VA 2QA4A 3THTA 4IUFA 1QW1A 3G9CA 2OIHA 2JL9A 2C0TA 3HI9A 3V7RA 3RW7A 5LJ3h 4LT6A 4ECWA 4KGXB 5IHNA 3CCJQ 1Y4ZB 3LQVA 4RBUA 3SFUA 1U1MA 1WACA 2RVJA 2RF0A 3OBYA 3CMEQ 1YITS 3SDEB 1QTNB 2DT9A 3OR1A 3OYGA 3I55S 2H54B 3LTOA 1HWLA 1UEUA 2C3OA 3H2LA 4J9UE 5I11A 4CWBA 3GPAA 5HANA 5KFSA 2RHZA 4EMHA 2H65B 4JI0J 4JI3J 2O88A 3WX8A 2RHQB 3ITHA 2MQOA 1V6HA 4ID5A 1PYTA 1N9SA 1GQEA 4M75G 2VHGA 5A76A 4LUDA 3G4SS 3HFNA 2COLA 2JVVA 4R0EA 2PEHA 2DRDA 3C4SA 3FEZA 3SFGA 2UVVA 4PLIA 3M2RA 1R43A 2EW9A 1CSKA 1ZH5A 2HDAA 4RUHA 2DMOA 3V81A 4NA1A 2BQRA 3EG3A 1QMCA 4U6PA 2E6NA 1GAOA 1IM6A 3EWGA 4C6AA 1D9DA 4DQIA 1HNIA 4WXWA 2LQKA 1Y3JA 3OSVA 3J80E 4DQRA 1PBUA 3HSDA 4M95A 3GIJA 2GVZB 4OI4A 1VQLT 5GAGI 1UZHA 5CA5A 1IKVB 1YIJS 4QBUA 2R7UA 5KYUA 5KG3A 5F8LA 3ENVA 4LQ9A 4M5HA 1MW7A 2FGOA 1TS9A 1R27B 2MQLA 2DXTA 4RWWA 1URNA 4B9TA 2L08A 3BGRA 6FD1A 3MPDA 3MM5B 3G7ZA 1YLXA 1X4CA 3DDIA 2IMOA 2DNHA 3FJ2A 1FTCA 2OAUA 1WELA 4O44A 3PACA 1A7GE 4GY5A 2AU0A 1FRIA 4I2QA 3REAB 3M4GA 3MR2A 2LCWA 4C5IA 4O3SA 5L8RE 1Y5NB 3OVAA 2DRAA 2J5AA 3OXLA 2LDYA 3DOLA 3VS3A 4PFZA 2JTMA 4YR3A 1D3BA 2RT3A 2QT7A 3M9MB 3NPFA 2D3ZA 2X3GA 3AQOA 1CC8A 1IO6A 2GC8A 2ZBCA 2KR3A 2GJFA 2J7UA 4RTUA 3OYNA 5I42A 3CMET 4G3IA 1UEKA 4OYIA 3VQSA 2R5MA 1M1FA 3OYFA 1PYSB 2RHXA 3KOAA 5KT3A 3EFSA 2JTFA 1KKHA 5EWFA 2LEBA 3X26B 2CT3A 3CCMS 2J6KA 4DUZJ 4LBHA 2V1QA 2F5TX 3QFHA 3CC2S 1M5KC 2M9UA 4QQ6A 4A4KA 5BR8F 4P2XA 5DDOC 5EWGA 1LV5A 2XCAA 4ECXA 3NXZA 3JTNA 1PSEA 1JNRB 2BXJA 3A8KA 3M2UA 1P8GA 4EBEA 1F6TA 4L72B 2WZ1A 3M4YA 4ES3A 4LFAF 4OZ2A 2C2EA 1KIKA 4H4OA 1IJEB 1V76A 4M75D 1TK0A 1S1WA 2B8QA 3ZZ0A 4LF7F 1OYEA 4CLWA 2CXEA 1H3HA 5CQYA 4HI1A 5GAMj 3P8HA 1FKAF 3QMQA 4E2FB 4IG3B 2M0OA 2P6SA 2H5EA 3GCXP 2PD1A 4JV2A 1RI9A 1UL3A 2L3PA 1IVZA 3H59A 1XR7A 5J2PB 4CZCA 2KRBA 5D4PA 1FFWB 2XMVA 1WSRA 4BE2A 5GAN7 4C9DA 3NGSA 3W8GA 2V6AA 3OYBA 1JMTA 1UUEA 3W5YA 3M2UB 1BI3A 1EARA 3G6ET 1IUJA 4ILLA 3QYHB 2EFIA 1K1SA 2GO9A 3I0SA 4J9KA 2C0OA 5DM7Q 3AB4B 4DPTA 4MKYA 2XS5A 1JJHA 4DX6A 1LCKA 1DY3A 3CD0A 1SL0A 1N5YA 2GFFA 1Q8KA 4M75F 4IUTA 4R8UB 1NLPC 2QQAA 1TL3B 2CT4A 3IAM9 2VDIA 2KI7A 2H3EB 2DGUA 2DJWA 2RMOA 2HMIA 1OX9A 3BDUA 2K2PA 1NPKA 3UI3A 4IDKB 1RA7A 4DX7A 4DQSA 1VQMS 5DZ7A 1EX8A 1S1XA 1X7VA 2JMAA 3PIOA 5LT5A 2BW2A 3JB9F 1E6GA 1VQKQ 3T5KA 2YWEA 4K5SA 1RKIA 1KSWA 1RWWB 2BQUA 2AYGA 2DO3A 1FDNA 1K8AT 4CO0A 4DV6J 2WVDA 5DDRC 2LVMA 2J7WA 4CO2A 4HTIA 4AE5A 4WE1B 2YVSA 3VS0A 1FVSA 3T1AA 2R4FA 3L2RA 3OS1A 4E7ZA 2MF2A 1C4AA 2BX6A 4N4HA 3CCMQ 4IH7A 1MN7A 4HTJA 3LPYA 1TU0B 2DEIA 1VRUA 2DZ9A 4M7AE 2XDDA 4CC3A 4U8YA 2FVRA 3JB9I 3TVTA 3CC4A 3V4IA 4TVRA 1R31A 4F0KA 1NJIR 1Y3KA 1UPPA 5KT6A 5T41A 1SBRA 4ECYA 3FCVA 2EYQA 1SC1B 1QSSA 1HI1A 1WI7A 4J7FA 4HHUA 2G0CA 2RRBA 5DRKA 5AE3A 4MIWA 3JSMB 1X5TA 1YHQQ 1AWOA 1N36J 3ILOA 2ZJQQ 4YP3A 5C42A 1VQLQ 3PHTA 3GTYX 1VYAA 1JLCA 2RI2A 2YDLA 2YWFA 3DMJB 3CJRA 4B3TF 1UFLA 1GXUA 5GMKh 2M3DA 4ZPDA 1WX6A 4Q43A 3R7SB 3RKYA 2AYEA 2YNHB 2CNLB 1S7IA 1HQEA 2NSBA 2KVQE 4KPYA 4RCCA 2KMTA 2DXFA 3VAGA 4E98A 4FS1A 1MROA 1HHQA 1VJQA 4KHMA 1TVRB 1BE4A 5DG9A 2DL7A 4OMQA 1RTDB 5B08A 4C8LA 3JYTB 3V5RA 3CPWP 1QSYA 5K5MA 2C2OB 5LSLA 2W2OP 2WK4A 3EHQA 3DXBA 2ZZMA 2IBKA 1YGYA 3RB3A 1FD8A 3A3PB 4M7AC 2GVDA 4DX5A 3DU5A 5ETPA 1X4BA 4LJMA 4AG1C 1N6AA 5GAMd 2J6UA 5C5JA 2PUKB 4UOCA 5GANd 1S0MA 1UCNA 2BJEA 2MCNA 2X1FA 4JB8B 4QWCA 4NCAA 3CC7S 2OH2A 1HD1A 4EYIB 4DOZA 1VQ4S 3TEHB 4F8RA 3MM8A 2FJEB 4NE9C 4HVVA 1U1RA 3V6HA 4OJHA 4D3HA 3I56A 4ZLPA 3C8YA 3ZO7A 3THPA 4M5MA 2HHVA 4PR6A 4X64F 5DLFA 1RWNB 3Q8YA 3RMQA 3SCKE 1O6XA 3CJ8A 1BGXT 2NYSA 2OJ3A 4K4TA 4C92B 4BC9A 4P10A 1FDDA 1R0BG 4PYAA 5FRNA 3S6WA 3JSRA 3CCQA 2MQPA 4PJOE 1S6QB 2ZWOA 2KHDA 1VYVA 5CVIA 2ASLA 4O0NA 3EZOA 4WU2A 4X4OA 5EN1A 2SXLA 5IZHA 1HA1A 3HSGA 3FEXB 3LGLA 1NK5A 1T9VA 4Z89A 1XMOJ 1LNXA 1SVDA 2LXIA 3CWJA 1RT1B 4J9MA 2OUGA 3SSRA 3BYRA 2C42A 3I4PA 4MKAA 3OMGA 4OJ1A 5HK0A 2KFYA 1KQSP 3TAPA 4ORZA 1NG2A 2X4XA 3K89A 4RW7B 2ZPHB 4Y2IA 3N79A 3CULA 1RYRA 3VQTA 3CEYA 4DI6A 5J2QA 2B4PA 1K73C 2FVCA 3DI6A 2F3JA 5FWBA 4USJC 1WC0A 4ZHRB 3R7NB 2RKIA 2QRRA 3OYJA 1KTVA 3NS7B 1Q5YA 2GBQA 1R77A 3E9GA 1VQ9T 1JXVA 1GFDA 3C2PA 1NYFA 1TFWA 4ZPWR 1WIEA 1S76D 1I94J 3LYIA 3HJVA 2J06A 3QG1A 1F5CA 2AKKA 4CT8A 2VFSA 3SWNA 2ZH9A 2DIQA 4FF4A 1NSQA 2YRDA 3T19A 3GMGA 1H98A 2GIFA 3H20A 5GADU 4XQ3A 2CQ4A 1N5YB 2RB7A 1NDKA 1U1KA 3KHLA 3DLMA 2YRVA 3RUXA 2M8HA 1X6GA 1HBUA 2V4JA 2IYIA 2Q66A 2BZ8A 3ZBDA 4OX7A 4WYLA 1ZSGA 2U1AA 1XMQF 5GAN8 1R7IA 1N5QA 2HG4A 1GX5A 1HNWF 5CAAA 5J2PA 3D28A 3DOMB 4OP0A 5EGYA 4TU7A 1FJGJ 4IG3A 4C92D 5L1JA 2EQUA 2C2ZB 4M75E 4RUAA 3UD3P 9ATCB 1SB6A 1ZZFA 5L9NA 1S1WB 4R25A 5GANh 3P8DA 5I3UB 2HBYB 5KG0A 3CBOA 2CFXA 4ZJOA 2OKQA 4M7DG 2NYHA 1UA1A 2K1RB 4OV1A 1TL7A 1IBKF 3S01A 4FXWA 2QLBB 1VDHA 2K7AA 1H8KA 1U48A 1IR1A 4CYUA 4KRTA 1FRLA 1VBZA 2V4QA 2BJ8A 4WJBA 3T1HJ 1CS4B 2GNKA 3LP2B 2AD9A 4C0ZA 2HZYA 5K8MA 1Y57A 3SZ2A 2ZAEA 4CCHA 3J7AN 5FWCA 1JXOA 2KFZA 5KTQA 1UWAA 4J9DA 2F65A 1ZSZC 3CJ2A 4K5RA 1SSHA 3LW5C 1D8ZA 4MMKA 3ENAA 4EGLA 5JUMA 3M59A 2YSQA 4F50A 2F69A 5CZVA 3VUBA 3MPUB 3DOLB 3KK3A 4DV4F 2ZH3A 4HLBA 4C8QD 5CIUA 1VQ5A 2VV5A 2COZA 1IKXB 1S0OA 3CB4A 2YX7A 5CYJA 4EPCA 1N32F 4NRTA 5KFUA 3PY8A 3G2XA 2ZHOA 4XK8C 1EQ0A 3G71S 4OYAA 4OL8A 3GSDA 3BGRB 2OPRA 2MKYA 2DYIA 2O31A 5EX3A 5D77A 1VQ7T 1M1KC 4YOEA 4ANJA 3CC7A 3KHRA 4Z8AA 2FJWA 3PVLA 2JEIA 4NLSA 1X60A 3OFHA 2RDDA 4K0KJ 4PJOG 2OSRA 1X4FA 3LF0A 1HQ2A 4RL1A 2QYGA 1N0VC 2EKNA 1S6UA 4DUZF 1JEGA 2FG0A 2FHMA 4YB5A 1HXDA 2O2OA 4Y0FA 1FMWA 3L2UA 3NRBA 4MYUA 3HF5A 3PX4A 3QT8A 3OFGA 2BTTA 3BW1A 1O0PA 1SJ3P 4JI7J 1YJWQ 4CLSA 1QVFP 2VQFJ 1O9SA 3OA6A 4N77A 3U1NA 2KT2A 2KRMA 4NA2A 5KFZA 4FL6A 2K3XA 4DR4F 5KFHA 2ZPBB 2V8DA 2B3TB 1H7WA 4C8OA 1NK7A 4FPRA 1CBKA 2O4XB 3KLGA 3M8RA 1TUDA 1QCNA 2P5VA 3H42A 2C3PA 2P0QA 4JYAF 2HFSA 4M94A 4ID5B 1VQNA 1LWEA 1F5AA 2OPQA 4GC7A 1RLPC 3ITHB 4IO9Q 4ED5A 1RLDA 1UVNA 2NS1B 2XY5A 2KZMA 2RF2A 2ROGA 3CEDA 1C1CB 1ABQA 2KG0A 3OR1B 5BYSA 5D7UA 1TV6B 4LR8A 3QGIA 2QO3A 1ZBJA 4I2PA 4KTQA 3AJ1A 2ZGWA 3MHXA 1K9AA 3FQKA 3OYYA 4Z7CA 3AD9C 1B0PA 2ZUAA 5A6PA 4J9CA 4USVA 4JRKA 4NL5A 1B3TA 3KJVB 4JUZA 2G1HA 3CBPA 3OL8A 5L8RC 3VS5A 1ZZNA 1FX4A 1GL5A 1VIXA 2XY7A 1BXNA 3N5BA 3LWLA 3BF4A 2CPXA 4FP9A 2CPHA 2ZZNA 3PJ9A 2EW3A 1U47A 1XR5A 2BANA 4A8MP 2D1CA 2DXUA 3KLHB 3O5TB 5D6WA 4CO4A 1KQKA 3VGUA 1B4SA 3FC9A 2XB2D 3J7A1 5IV4A 1BK2A 2CQPA 2I8EA 3PYGA 4YFUA 2AJQA 4X4PA 1BLUA 4QIGA 2BANB 3LP0B 2JH3A 4DEZA 1LXJA 3MM9B 1MG7A 3PE0A 4Z37A 4CLUA 4JRQA 3PW2A 1TWBA 4OB0B 1FWZA 4BDZA 2OO4A 2HFOA 4MAKA 3G8TA 4F17A 2E5QA 5I21A 4B3OA 2AWZA 2ZBQA 1UVLA 4M78C 5IC4B 1PC4A 4C0HA 3S3OA 4NLXA 1ZQ1A 1C0TB 2RJEA 4ELTA 5GAOq 4PJOD 3M8ZA 2PTKA 4M77C 2X4WA 5K14B 1G1XA 5BJRA 2D0QB 4PJLA 1IR0A 2DL8A 2B4UA 2L9DA 5GAHI 2JS2A 5KG7A 4YHHF 5D4NA 2JM9A 4PQUB 3SEOA 1X5SA 5C7PA 2E9RX 2MLYA 3A8GB 2E5IA 4ZVRB 1AFJA 2EGEA 2DITA 4L73A 4F7UE 4NLQA 5ETKA 4DN0A 1MWZA 5RUBA 1SV5B 2DBMA 1RT6B 2OPQB 5F9LA 3NNCA 5CCAA 4FNHA 2R7TA 2DM1A 2DHXA 2CGHA 4DEXA 2P0KA 2JN0A 6FDRA 3M32B 5HP1B 3FFIB 3WIVA 2KXFA 5D4OA 1WUUA 5H9EK 2YQ0A 1TUVA 3I55A 2HLTA 1Y7XA 2RQTA 2GHWA 2W2NP 3UNYA 4DV0F 4NXMJ 2DTHA 2FJVA 4H54A 2CG8A 3EMTA 4Y28E 3B82A 2W2PP 1FERA 4J9PA 2R2TA 1Y5LB 1ZA2B 2DTJA 4IFVA 3ICLA 2RQRA 4FZVA 3RAQA 1UGQB 2FJAB 4JI7F 5GANj 3BR8A 1RWMB 4ALZA 1ZAXA 1LNQA 2WOMB 1H6KX 3G82A 3C12A 1YRUA 2QLJB 4DLGA 3I5AA 4RTWA 1SCJB 4BUGA 1WHYA 3JCMc 1YIJT 4X65F 4Y91A 1PWTA 1FD2A 3RBDA 3FMBA 4I68A 3VGTA 3ZTOA 1FJCA 2LMJA 1E6HA 2P84A 1YNZA 3D68A 4DXLA 4KGKA 2KAFA 1ITPA 2B9EA 1HHSA 3EDQB 1QP3A 5KFKA 1TKTA 3OR2A 4WPAA 3OTOJ 4I69A 3I5CA 5FDLB 2RMLA 1UHFA 3W8PA 2NPFA 4ZVFA 1NJZA 3I9ZA 3CC4T 3MEAA 5LJ3d 4WBFA 4EYHB 1YWOA 2G2ZA 2YTCA 2ZWPA 3RYLA 1YJNQ 2XSJB 1G7CB 1YP5A 5GANf 2IC3B 1QVFS 2D3O1 2AGPA 4LFBJ 3C19A 4EMDA 2F4VJ 3VV2B 5GANg 3LP2A 3T41A 2FEIA 3OY9A 2ZVIA 1M5Q1 2HQ3A 2RU9A 3RU0A 3PW0A 2YUNA 5DQGA 2L48A 3BBCA 1U0HA 2RN8A 4N5SA 2VB6A 3SSQA 2A37A 1YQHA 4J8OA 3M9NB 1JB0E 2MHNA 1PHTA 4AXIA 4DWIA 2RAQA 2PN6A 5KFPA 2H9ZA 4DDFA 1CG2A 1Y96A 3JCMe 3FVYA 3POTB 3BPDA 2UU9F 1DAXA 3ENQA 3CDWA 3AXMA 3NTHA 1VI7A 4EMKB 3Q89A 2E41A 1YJVA 4ANCA 3BSOA 2JTEA 1P27B 4GMKA 2ED0A 3C94A 3PX0A 3AXKA 3MAAB 1V9OA 4OI3A 3LWHA 4DLEA 5E3QA 1M1KU 4ZPTR 3M8QA 2KSSA 2B56A 4B9NA 2MLZA 4EEYA 1W2BA 4B9XA 1JLEB 1NDCA 1KFZA 2F8HA 4KQZA 3M8YA 1VQ6A 2DGTA 4OZLA 5GMKa 4KHPF 4JUVA 3M9QA 1J3TA 3P49B 1PCXA 2UUBJ 5CAIA 3DRSB 1KEKA 1S6PA 2NXNA 2UU9J 2ZCFB 1HYOA 1WF2A 1S72T 4AQYF 5AXLA 3NHNA 1QY7A 4RUGA 3EGXB 3SCLE 2Y8WA 3CJ4A 2VA3A 3TO8A 3RIRA 4AYBD 2Z8QA 3HFVA 1K4US 3KFVA 3R5GA 3EJMA 2E12A 1FDAA 5LMNF 3L09A 3ZTPA 3OYAA 2W9CA 3VALA 1N8RT 3T1HF 4CM2A 1G3TA 1U2CA 1UJ6A 1G83A 3H98A 3SWNB 4N7TA 3H7HB 2KVIA 3H5YA 2AF6A 3AD8C 1MNDA 5IXBA 1U1QA 4IRCA 3IC1A 1RT4B 3W2VB 1RWXB 1WG1A 4M75B 1GX6A 1KP6A 2KVQG 1X5OA 1CJVB 3O1LA 3O5ZA 3ILJA 4IG0A 4C92C 1U6ZA 5CD4H 3UA7A 5K9FA 1I6JA 4JI6J 2XWYA 2BKPA 2WSFE 3SEMA 1MV3A 4LSZB 2O01C 3QJYA 4WF9Q 4ES1A 1JXLA 4YB6A 3SHWA 1DBDA 2CNNB 4M7DA 3BBFA 4CRJA 4QR0A 5LJ5e 2DRBA 2O1PA 4E47A 4C0GA 3PFEA 3KYLA 3HMJG 1EETB 5A2QE 5HCKA 3WBZA 4DSJA 3J81E 2LLZA 4O3PA 3GQCA 1X4EA 2NSCA 1X6BA 3URGA 3M0QA 1DRZA 1JK9B 3FQLA 4LSLB 5DG7A 3TANA 3QSYB 3KDOA 1OV3A 2BW7A 4ETZA 3W5XA 1UHCA 5L9XA 2VQEF 2HVZA 4CO5A 3REBB 1Q7YT 3QIPA 3IM8A 4X4VA 1YJTA 5KH6A 1JKHB 2WONB 5B0GA 1VQMQ 2MB0B 4NLWA 2XYHB 5HJXA 3LX7A 1HL6A 2WBRA 3E51A 3BKTA 5HQ8A 2JC1A 2DK3A 1Q81U 3KUEA 3QRPA 1WNEA 3M8SA 3PRVA 1DJ0A 1SG5A 4JJCA 4UC4A 1LWXA 2PVGB 4Q0BA 5A8RB 2N4DA 2LMIA 1FX7A 5IC6B 3KWMA 4M7AD 3TX0A 4Y65A 1ZTTA 1S48A 2MQQA 4ECSA 4UQGA 3W61A 3EPIA 1B34B 3EH2A 3KG4A 2FYKA 1HNXF 3TI0A 3CD5A 1QCOA 2JFKA 1VIOA 4EMGA 3LO3A 2DPIA 4OLOA 5GAOr 3UN5A 2LA6A 2MMYA 4U7UK 3PR4A 2X4JA 3GV5B 1RHKB 3OYDA 3W9JA 1JJCB 1IQZA 2RB6A 2P9CA 2ABYA 3RBXA 4J9IA 4OB1B 4C8KA 1NJXA 3FEOA 4J9LA 2ZH7A 2UXDF 4BE1A 1YRXA 1OU8A 4GC6A 3U7JA 3C6TA 2IIMA 4KV8A 1Q82U 2L3QA 1Q82C 3BGFA 1RACB 1UFWA 4MIBA 3O8VA 3OMCA 1WG5A 1B7FA 2RJDA 3VS7A 1BMQB 1VQ4Q 4USUA 3PVQA 1M9SA 2FQQB 3BQ0A 4DBHA 1GNKA 1D0ZA 1WHLA 2KPPA 3TZYA 4ZPAA 4AFFA 5A8RA 4C97A 2LX9A 1NHVA 1C1AA 1VISA 3LAMA 2D7SA 4A8XA 4ZPVR 1D0YA 1VQ9S 2DH8A 2IM0A 3C66A 3CO0P 4IUPA 2PVOB 2AEMA 4QU7A 1KC8T 5FRMA 2BJ9A 1MU2B 1PAEX 2RH2A 3ET6A 2DR8A 1UPMB 3KLFA 2MGZA 2RRAA 4ZGDB 5EG2A 3CJKA 1U6BA 3PR5B 1RHMB 1U49A 4FBUA 1LJOA 5FLXE 4LDVA 4NL2A 1S0NA 2RQ4A 3HJFA 3OYCA 4PAAA 4R0KA 5CKEA 2HGLA 4X66F 4JI6F 3CW2C 3E9FA 2F40A 5IOLA 4URGA 2ZJPQ 3JV3A 4XAKA 2GTOA 3IXQA 5BYQA 4AMCA 2DGVA 3QYYA 3N9UC 1SC4B 2RI3A 2M51A 2KDOA 3BGOP 1KLMB 1H74A 2PMHA 4QYRA 2LQJA 4GO5X 3W64A 1H0HB 2HLUA 1SIZA 3KUGA 1NSKL 1TL5A 1U06A 4W98A 4D3GA 3A8LB 3ZL7C 4DR3F 2LJ0A 1NXIA 4A8QA 1K1ZA 2ROPA 3OBIA 1B3QA 3OLAA 1HNZF 3RAMA 3NMZC 2Y4XA 3FKBA 3FJPA 3SSSA 2W9CB 3L4BC 3ISNC 1A0OB 3QNWB 1WFWA 2O01E 1UECA 3LOUA 4J6WA 4J9EA 4ZNXA 1Y10A 1UETA 1YRTA 1IHVA 4DOVA 3H0IA 3AJ2A 4A4HA 1TXQA 2VL1A 3MEVA 3C15A 2UUCJ 2RNAA 4FIBA 3RERA 4C48A 3DRSA 4C3MA 4DBQA 1YBAA 3QKJA 5IS2A 5JJBA 4DBRA 1TL1A 2WSEC 4URQU 3MD1A 1V3SA 4NLPA 2OI3A 1AOJA 4LDWA 1W4SA 3DNCA 4DF8A 1K73R 2X7IA 1M5OC 5D0GA 3GIRA 1AEYA 1JLEA 2JEFA 3MZIA 2RQCA 2DHSA 2E1MC 4N8OA 4MTPA 1LWFA 2O3DA 1Y71A 2X4YA 3BH6B 5DDQC 4XDDA 1UGSB 1RGVA 1AUDA 4ES2A 1Q86T 4E7LA 1FHTA 4Y2AA 3POTA 5GANe 3KLIB 4A8WA 3I55Q 2CWKA 3AJDA 2XZTB 3P5BP 4LQ3A 2QSFA 3PRBA 1QLNA 1YN8A 5L39A 4PJMA 4WP8A 1UWBB 3A1PA 3N4WA 3VR1A 4L3KA 1X27A 1UW4A 3I5SA 1FKOA 1CJTB 3P96A 3EICA 2ROTA 4P2FA 3N0VA 1WHGA 3BE3A 4CI0C 5LJ3Y 3BFMA 4ZOSA 3GJTB 5HQMA 2K5IA 2IC3A 5ETVA 3NEKA 2K8GA 1TAQA 5KFDA 3DGPA 5KT5A 1FNMA 5IT9U 3UPUA 1T9TA 1U09A 3TJ8A 1Y07A 3AFGA 4RUBA 2P6TA 4DL6A 2V8GA 4G6VB 3CCWA 3L7UA 1IHWA 3DKMA 4XTXA 2CPZA 4A4FA 4C5HA 3TUJC 3OUYB 5KFRA 3TEGA 3QO9A 2W8KA 2PUOB 4TU9A 2EKHA 4I2QB 1E6YB 1RP5A 4DL7A 2CZ1B 1OPIA 1WC6A 4OFZA 2PVDB 3TJ9A 1HSQA 3DRRB 1JU5C 2K7JA 1VQPA 1SPKA 2HZAA 2K79A 3MEKA 2XGQA 2BZYA 5KFFA 3GLJA 4KPCA 3OFFA 3HVTB 1OY8A 4HYKA 1APSA 2XICA 5EWEA 2UZAA 3OHBA 3PKYA 1O8BA 5KYUB 3VYHB 2KZZA 4LXCA 1IKVA 1WC1A 3HHTB 3UF4A 3AB2B 1WEZA 1M2OA 1TG0A 1KDNA 1NCLA 2G2YA 3H0PA 4ZVGA 4QWBA 3E2EA 5GJVB 1IM4A 5HJYA 2NLUA 3VAMA 3KLEA 2B86A 1HHTP 2FLLA 3LH0A 3M0SA 4L6V3 4EO8A 4K4UA 4EU0A 3VJPA 1JO8A 1VQ9A 1YJRA 5DO2A 4QW2A 4MZMA 2CQ3A 4DQQA 2VFTA 5ETQA 3I4HX 2ECZA 2BOPA 4K4WA 3VS6A 4X9CA 3VS2A 3IBFB 2EFQA 3IP0A 3H4BA 1CVJA 4M7DC 1XERA 3RR7A 3BEGB 3EG1A 4E7SA 1BUXA 5BYRA 5FU6B 2IVMA 2OTJA 3J7YU 2LP4A 3CJ0A 4QPTA 2DHAA 3CCRQ 1AZSA 3U23A 2K3KA 2GFAA 4X65J 2R8GA 4DL0C 3ZFVA 1HQUB 2MZ1A 2DEUA 2KRSA 4ILMA 4DOWA 4KJIA 4YS2A 3SDEA 2BM1A 3HSZA 2CPJA 2XCPA 1ABOA 4NCGA 5CK9A 4L74A 3E19A 4JJDA 1W26A 3OFEA 4N41A 1UA0A 5A8KA 5CYQB 3M2VA 1H7XA 4BY6B 4P73A 5DLOA 2B5JA 1TUGB 2DVJA 5B09A 4DU7A 2A36A 3HT3A 2HWIA 5L1IA 2RJFA 1QVPA 2LCCA 2X1GA 1YJWA 4JI4F 1AYEA 3ZTQA 1R0AA 1IR2A 3L7OA 4CTAB 3ELHA 3J81U 1ZAVA 5B0BA 2VG7B 3W60A 3RESA 4ANEA 3QJ6A 2C2RA 2HHPA 4DCJB 3C6UA 3C0CA 3CCVA 2W24A 4LF8J 2HBPA 3VF0B 3TJAA 2DEJA 2H5JB 2CQHA 1LK5A 4RJVA 3Q8RB 3KJNB 2XI3A 3ZZZA 3MF5A 2DAQA 3A5ZB 3B78A 3JAMY 5A0DA 4FSSA 4PG7A 1JJ2R 1AA1B 1YBYA 2XEXA 4CQ1A 1DQAA 2MWPA 1RAGB 1JJ2S 4XIUA 1REGX 4PG6A 4AL5A 3H5UA 1GFCA 2KXHA 1N8RC 5KYYB 3ETOA 3KJFB 1PM3A 3PX6A 3KJVA 1YJ7A 3KNAA 1WKLA 4CLFA 5ETNA 2I9SA 3X20B 4AFZC 3MM7A 2VKZG 4NYOA 7AT1B 1CJKB 2ADCA 4O3RA 3BQ2A 5GAMf 1YTYA 1S5ZA 4Y2MA 3JSBA 3UCZP 4M78G 5LJ3f 3CCVS 1F3VA 1C1CA 2HS0A 3Q2SC 5FLXY 1AW0A 1BQMA 2IM3A 1T8EA 4Q8EA 4ICLA 4OLPA 1S49A 2FYXA 3BSNA 2FHKA 2OEJA 2ADBA 1EB0A 2H4WB 5I3QA 2CJKA 1Q7YR 2XK0A 1VQYA 4J37A 3HD1A 4WFZA 3SMZA 1UAWA 3CCRT 2E3HA 2VC8A 2HKNA 3OS2A 3DRPB 4DSKA 1WD6A 4ZS6A 3DLBA 4QPXA 3GNFB 2AKLA 1YIJA 4TN2A 2DZCA 2HNDB 2QV6A 1RLCL 2K7KA 4P74A 1K8AU 4C0BA 4V19X 3MPYA 2KFNA 3NBPB 1FWLA 2DR9A 1UMJA 3G4ST 4WCEQ 4OHWA 4DV3J 2IDEA 3FNNA 2B5JB 2EG2A 4NCGB 2Y1RI 3F56A 3MKDA 2OTLT 3R6NA 3FBCA 3UD4P 3JB9G 4ZP9A 3NS5A 2KDSA 1HQUA 1YX2A 2Q43A 5A0YB 3CUNA 1VYUA 4A63B 3HLUA 5D0EA 3EYZA 4FVCA 4UUXA 1I51B 1VQMT 1HWUA 4LRCA 1MUZA 5I2MA 4ELYC 4U8VA 5FIIA 3CCLQ 5KFJA 3CDEA 5KT2A 1OEBA 2MKKA 4GVBB 4IUUA 1MMDA 3OW2P 2DD5A 1PIEA 5FLXU 1WTBA 4Y3CA 1FESA 1RU2A 2DIVA 1GMWD 3JQMA 3OW2R 2MYFA 2HVHA 1IB8A 4DV6F 1QAXA 4RX6A 3UQSA 4NMXA 3KLEB 4GO7X 3UR0A 2QA4T 3ULHA 1WI6A 4ZPCA 4HVZA 2ZBIA 2CREA 2AJ4A 2E1CA 3UDCA 4J7CA 2RK2A 2D0NA 4ECQA 5F8JA 2CJAA 2V9WA 1CULA 3H0FA 1DJ7B 1S1NA 3CMAT 1S10A 2VG5B 2XYGB 4ED7A 4IUVA 3DYAA 2EG1A 3QPIA 3SIPB 4HDGA 4HDHA 1Q53A 2DK2A 3C16A 2FRYA 1Y5IB 3KXDA 1U8WA 3M05A 2XIDA 4II1A 3TRGA 3SI8A 1F9FA 3CCLS 1NEEA 4CYUB 3K8WA 5E41A 1KONA 2EI5A 1V3RA 1Z4UA 4DJBA 3DLEA 1JBMA 5ETLA 1ZSZA 1IWAA 2DO0A 4DUYJ 4B3MF 2QTWA 3CJQA 2K1RA 1HIYA 1OSDA 2X1AA 3PRDA 3GJQB 2GGPB 2ACYA 2WBMA 1RT7A 1PCAA 4PEOA 1FE0A 4EZ6A 1LW2B 4KH0B 2Z2MA 2SEMA 4BI4A 4AL7A 4NCBA 4JRIA 5HK4A 1PGZA 4LVOP 4M78A 3FCWA 1NZ8A 5AE2A 3OLBA 1DTQA 3CPWS 1VQPS 1PD0A 4DV4J 3NCRA 3GCWP 2HURA 1OIAA 3G8QA 2V4RA 4IIMA 2OTJQ 5D0RA 3UT1A 4N0AC 2CPYA 1SKSA 3L2VA 4JI2J 2CUBA 2LX7A 2QMUB 2ZZDA 4F4WA 1SC6A 4DV7J 2FGCA 4FKYA 3JB9D 4RU9A 2W1BA 4F4KA 5E3AA 1S1TB 4J9GA 3I56Q 2CPFA 2LDIA 1VQ9Q 2XC9A 1J5EF 3IRXA 3CCSS 1Q1KA 1M4ZA 3IA0A 1RTHB 1X75C 2FRWA 2MTLA 3M6WA 2HNYA 2IBOA 2DY9A 4WZMA 2F5KA 4IH5A 3A8EA 4KO0A 3VWSA 3SCJE 2PFDA 1U2RA 3MOZA 3MM6A 1JJ2P 1XEZA 2JVOA 2EFGA 1Q79A 3HRSA 1LWFB 5GADI 2QI2A 1YJNS 1K73T 4J5YA 2NUTA 1SQEA 3S6EA 3WIUA 2Y0SD 1YITA 3B4DA 3EHRA 3HHEA 1VQOS 5DLGA 1X0FA 4A0TA 4KGZB 2CQ0A 1NB7A 3DRXA 2Y1LB 1BI0A 4IR9A 1SL1A 2DNQA 4YEAA 1K9MT 5J2QB 2IAJB 4NLUA 4CO1A 3UVJB 4O23A 4OGEA 1SQGA 3LLRA 3CCQS 1OULA 4RTVA 2KT3A 3M9OB 2QXFA 4C0FA 4LE9A 4LIWA 4G65A 4OGCA 1GMUA 2OFGX 4Y00A 5EDWA 3KTQA 2RJCA 3RBBB 4I4BA 1HW8A 2VKNA 3F0NA 1HD3A 1FTRA 2YKNA 1WZOA 5GMKl 2F4VF 3MDFA 2AYBA 3M6VA 2E1AA 1YHQA 1R8OB 3BDLA 2HQCA 1RT3A 3FRYA 2FJBB 4I1TA 1OQ6A 1L3TA 2Y0BB 4HT7A 1N48A 2NYIA 3V6DB 3HD2A 4WTOB 2DPPB 2W01A 3LANA 2EYWA 2AQ4A 2LNVA 3IS9A 3M30A 3HVWA 3CDUA 3OYLA 2YNGA 3WDOA 1BIBA 4H4MB 3MI7X 1WXBA 5CD4A 2RM4A 3FBEA 1RHJB 2HKQB 4A8YA 4C0DC 4PG5A 4XU2A 4P9SA 4FYVB 2QA4S 2F2VA 2QQ9A 2DXDA 2XMAA 4JI8J 5CKBA 4E8UA 3CCES 3EG9B 2CQDA 1LQ9A 3FLGA 2JEGA 1VQKA 1SRMA 1Q81C 1VQ7A 2QQSA 1C1BA 1NB2A 2MGZB 2LJ1A 1KFDA 1T05B 2R7RA 1IBLF 4I6WA 4IH6A 2RD5C 1F2GA 2HQEA 2A2DA 2CUDA 2YX1A 2JDJA 3EGWB 5GJWB 4S0MA 1Y11A 3DC2A 2V67A 2AIRB 2QX0A 4NOYA 3R27A 3GOXA 5JMNA 3MPVA 1QAYA 3FC3A 3JTPA 1V3ZA 5M2RA 4Q44A 4N4IA 1KWMA 4KE5A 5HSPA 4ELUA 2J8SA 1TVRA 4RKUC 2LTOA 2D8JA 4A46A 2K5FA 2SRCA 2HQDA 2F2WA 1K8AC 1DLOA 2QL5B 2CZVC 2GQIA 1BCOA 4XU3A 4OX6A 2JW4A 1LK7A 4RNMA 4PWDA 1B99A 2BE2B 1NH7A 1VBXA 3L2ZA 2RHSB 3U02A 3PMTA 1IREB 5C24B 3DRYA 1JLGA 2C2NA 2N3LA 2RH3A 2G0JA 3IFEA 1YHQT 1B07A 1LW0A 2L41A 3PIPA 4NZ0A 2KXDA 4GLMA 4LF8F 1I8FA 4K4YA 2R8IA 3ZXWA 4OZJA 4Z2XA 1C1BB 1AFIA 3UDLA 4F2RA 4KIAA 2R57A 5F3TA 4IOCQ 5F41A 1C4CA 2Q1LA 2CJYB 2M52A 5K8OA 4OMNA 1VRQC 2LQ9A 1WXTA 3M8WA 3DLLA 2Q79A 4QOTA 2HHHF 2D1XA 4QWDA 4WK3A 4R5PA 2WCXA 1V5VA 4M8LA 3CCTA 1RCOB 1P1TA 4ED3A 2R7WA 4QVDA 2HFUA 3C46A 2LRQA 3EGDB 3DLGB 5D6GA 3QUIA 4Q0BB 1NK4A 2GQQA 3BKUA 4A8SA 4EUVA 1L5UA 1UJYA 2DKOB 2YNGB 1MNEA 1IXDA 3VUZA 4AFSC 1CPZA 2ZOFA 1TKXA 4M77F 3F41A 3LAKA 1WC5A 2GMLA 2LZ6B 2XLKA 3QIPB 4O4RA 2VGNA 3QDRB 1C0MA 1E6VA 3DU6A 2YPYA 4DV7F 1UDLA 5LJ5j 3MD3A 5LMUF 2YKNB 4R8UA 4JV5J 3ILLA 3CIZA 1S59A 1Q7YC 5FD1A 4F7UA 2MZSA 2VQEJ 3CGIA 2G0IA 2K9GA 2J9DE 5CCLA 1FXDA 2GCFA 4HH0A 1X4AA 1KHIA 4B9MA 5HQLA 2HS4A 5KG2A 1KVIA 2HRYA 3MMAB 4TQSA 1YI2S 3I96A 1I81A 3CVKA 2DYBA 3OYKA 2NXCA 3HTRA 2MY7A 1X4GA 2GHPA 4QT7A 1I5OB 4X4NA 1D1CA 2V63A 1EZZB 2V69A 3N6LA 2JC0A 1D1UA 3KMQA 2JJ4D 4LREA 3RJMB 4TLQA 5GAEU 4NLDA 3PZPA 3H4DA 1QJHA 2C06A 1RQ0A 3CC2T 4B3MJ 1R8PA 4Y6IA 2IVWA 3CSKA 1S1UA 1K47A 4PJOB 3A13A 5LJ5f 1SEMA 1MN9A 2HNYB 2V5HG 4XU0A 1UGPB 4BLGA 3RBZA 2AZ1A 2A0FB 4HR2A 3O6QA 3NAIA 4X62F 5DGAA 1KLNA 4M77B 3O3LA 3M0RA 3JAMU 2EYXA 2WSCC 3K8VA 4PRFA 3PYEA 1ZLMA 5ETRA 1G6BA 4OHVA 3HP9A 2ZKTA 2KO1A 3AH6A 2E64A 2UXBF 1YJWS 2IYGA 1AT1B 3A8OB 1LOUA 1YG0A 2PI5A 3RNJA 2GIQA 5GMKe 4OYWA 3FB9A 1VC6A 1QM9A 3NTIA 5KYWB 3BSCA 1RAHB 2D9TA 3W62A 3K5MA 2AMCB 3RZAA 4DSFA 4I64A 1FYNA 5I22A 4ESNA 5I42B 3M8QB 3S8SA 1NBEB 2RQWA 3VU3C 3MMBA 3V4MA 1D3BB 4CLPA 5D15A 3JAME 4A8OA 1LW2A 1UB4A 4EMKA 3CCJA 2CJBA 2LDMA 4ZLLA 5IAYA 1XMQJ 3EXCX 3TUPA 1U1SA 1VQLS 4FF3A 5LSOA 3UCGA 3M8PB 1N34J 4LBIA 2Y90A 1Y96B 1HWKA 2E6ZA 4D8DA 2JRSA 2H51B 4Q2MA 3RDVA 3VAHA 3DLEB 4JZ3A 4RKUE 1K44A 3PG9A 2DX1A 3SQGB 2AGQA 2XU8A 4TY8B 5LMUJ 2CRLA 1VGYA 3GG1A 1WGSA 4PFPA 2EK6A 1W6XA 2JS0A 3C16B 1U1OA 3HXMA 1JLQA 1NDLA 4EFAC 4KC5A 4H4KA 2LKZA 3ZTSA 3CCSQ 2AYMA 2XQCA 1N6QA 4N8NA 3JCMf 1RUWA 2JLGA 2QYZA 2FLPA 2RIJA 4ZVPB 1YI2Q 1AXQA 2KT8A 3KG0A 1VRTB 3D1QA 2XG8D 3WQPA 2J0SD 2K3YA 2KXCA 4N0AA 3FBBA 3DDKA 3RB4A 4HH1A 2BE7D 1PJ7A 2E1HA 1VLYA 3BH7B 4E7KA 5KYXB 2ATCB 2GZOA 4KT0C 4PUOB 1U8SA 3BJYA 1DHMA 3CO9A 3OTDA 3PTWA 3FEYB 4ED4A 2HIYA 1O51A 1KHVA 1EHWA 1XNIA 2BIVA 1S4EA 2HEKA 1RA6A 3BQ1A 3BO4A 1WG4A 2IFXA 4USKA 3EPGA 5HK3A 2VICA 1VQ6Q 2OPPA 4YHHJ 1VOMA 1T94A 2A6MA 4A47A 2QYCA 1XR6A 3DDNA 5D8HB 5B0FA 2CH4A 3ZZTA 3EFOA 2COYA 4ZVHA 1S1VA 2H48B 4OV6A 1E7OA 2EIFA 3NGUA 4ZCIA 2JOQA 1HI0P 1IBLJ 3UNGC 3DLKA 3WZ0A 3EG0A 3NGDA 2OEKA 1D9AA 2DCUB 3HSJA 2ED1A 3NY0A 3MECA 3TZWA 4PXCA 3N5FA 3LALA 2MYSA 2R7XA 3G71Q 1DURA 3MFHA 2FZCB 1C2PA 4X34A 1RKJA 4UQTA 1LPLA 1XMOF 4ERDA 3FFIA 3BY7A 2V9KA 4FYYB 3VRZA 1EFNA 3L95X 4A8FA 2OHDA 4K2XA 1XBWA 2CQCA 3OW2A 3R1LA 4C92G 2E10A 2OMLA 4RR5A 1RT5B 2OSQA 1RLQC 1YDLA 2ZHAA 5IV3A 4ED1A 4XTYA 4JI4J 1HBMB 3MFIA 2IG0A 4J6XA 2NXUA 2DXCA 1X0PA 3G6EQ 2B6AB 3DGVA