1NPRA

Crystal structure of aquifex aeolicus nusg in c222(1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nprA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nprA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nprA01
1SSFA 1YJNA 1EIFA 1VQ9T 1VQPA 1K73C 5LL6S 1YJWT 3JAME 5IT9E 2LVMA 4QQDA 1VQMA 3CPFA 1N8RU 3LGFA 3CMAT 1Q86U 4ZN1A 1QVGS 3I55T 5DM7R 2JVVA 3KBGA 1S72T 3CCLT 1K8AU 1N8RC 1VQKA 2KDSA 3PIPA 2JUFA 1YITT 4YTLA 1NZ9A 1VQ5A 3G6EA 3CC2T 4TVRA 4OBIA 2QA4T 3CCUA 2MI6A 3J81E 2JNGA 1Q82U 1KD1U 1W2BS 2LCLA 3CPWA 1JJ2S 1YJ9A 2KPPA 5J3BA 1VQMT 1KQSS 4RG2A 5IAYA 2QA4A 1M90U 1VQNA 3A5ZB 2OTJT 1VQPT 1YI2A 3CPWS 4ESNA 2K06A 3J7AF 1W2BA 1S72A 3LH0A 2E70A 1YHQT 3CCUT 1M1HA 1KC8U 1VQ6A 3CCLA 1NJIC 3I56A 1X6OA 3CC4A 1QVGA 1KHIA 1VQKT 3DB4A 2OTLA 2MWPA 1NPPA 1YJWA 2QEXT 1NPRA 3CD6A 3CCQT 1RL2A 1KD1C 1UEBA 5HY6A 3CCEA 3QQCD 3OW2A 1VQOA 3CMEA 3G4ST 1VQ7A 3I56T 1K9MC 3HKSA 1XTDA 3CCRA 2OUGA 3CCVT 1Q86C 3DLLA 1NZ8A 2OTLT 2IG0A 2G3RA 1Q7YU 3LGLA 3G71A 3LD7A 1YHQA 4ZN3A 2LQ8A 1VQNT 3J80E 1YIJA 1KQSA 1VQLT 3CCET 1M1GA 3CCST 1YI2T 1Q81C 5DLQE 3CCJT 3CCMA 3H7HB 3OYYA 3CD6T 1VQ8A 5A2QE 2QEXA 3CCQA 1Q7YC 1K8AC 2EXUA 1K73U 3PIOA 1VQ9A 1K9MU 2EIFA 3TREA 3CC4T 2CKKA 1VQ4A 3G71T 1XNIA 1YBYA 3CCVA 2XHCA 1JJ2A 1KC8C 3CCRT 1M1KU 2JOYA 3G4SA 3LPEA 3I55A 4X34A 3CMAA 1VQOT 3CMET 1VQ7T 2MWOA 5J26A 1IZ6A 1VQ8T 3P8BB 1QVFA 3EWGA 3ER0A 4CRIA 1BKBA 3CCSA 3CC7T 5FLXE 2KVQG 2DO3A 1YJNT 3CCJA 3CCMT 2E6ZA 1YIJT 1M90C 1YITA 1VQLA 3DB3A 3G6ET 2OTJA 1NJIU 3CXCA 3CC2A 1VQ4T 2L3RA 1M1KC 1Q81U 3CXCS 1YJ9T 1Q82C 1QVFS 1VQ6T 3OW2S 1VQ5T 3CC7A
chains in the Genus database with same CATH superfamily
2VJVA 2ZBRA 5B0AA 1UJ0A 2DNGA 2DFUA 3MMAB 1RI7A 5LSOA 1HBMB 2KHCA 4LRBA 1IKYB 2FVPA 5AXKA 5L9NA 2NYSA 1QJHA 4HCKA 3MM8B 5KFWA 4KC5A 2UUTA 3DLEA 5HROA 3R2CJ 2VKNA 4GVLA 4BE2A 2AV5A 2HNIA 4EUVA 3KLEB 3E9GA 4NLOA 1J5OB 2X35A 2JW4A 1S1UB 3E8OA 5IOLA 1WTBA 1D0EA 2PNIA 4I2PA 2A28A 1M5SA 3RBXA 3Q23A 3MUTP 3LQVA 3PNIA 4RNNA 4NMLA 3PKMA 1IXDA 1S4FA 1N32F 2HNYB 4IUVA 1NK0A 1WF2A 1JIHA 2KRRA 5CIUA 3LPEA 2UVWA 2HZYA 2MSSA 4J9LA 1PYTA 2ATLA 5J2NB 4B3OA 1T7PA 5HLFA 2GQIA 5T7LB 4L3NA 1YJUA 1VYTA 4UT4A 4K4YA 2XNQA 5C25B 4ES1A 3M8YA 2UP1A 3FJPA 1ZH5A 4JI5F 2R5MA 2NXJA 2XULA 2YQ1A 3JAME 2IM3A 3S01A 2ALYB 3FZ2A 4WZQA 3DRPB 4RTVA 4CNYA 4FW2A 5FW9A 1XN9A 4JLIA 2ILYA 4AFQC 3TAPA 5K5MA 3DRRB 1KOOA 3KK3B 4KHRA 1U1SA 2RU9A 4QR1A 5CYMB 4C0DC 1S7HA 4OI4A 4F4YA 1FMKA 2GVDB 2W8LA 4ECUA 3KYLA 1YHQT 3T9ZA 1I07A 4CLFA 4ETZA 3MURP 2W0ZA 4DPYA 3HHLB 5HCKA 3M9QA 2YXLA 2UUCF 3U23A 3JB9I 5KFZA 2LVWA 2DD5A 3A8HB 2DAQA 1Y9OA 3EG9A 3OMCA 4DHVA 2VU5A 2FJXA 4C7QA 1YI2S 4FXDA 2FJDB 5DM6Q 2DXDA 2C0TA 4XK8E 3CCJT 3N01A 4K5RA 4QPXA 1B64A 1G3OA 3ITHA 5D0EA 5A76A 2W2PP 2QGFB 1CLFA 2ZPGB 3HZEA 3FFIB 2EFIA 1V5IB 4LT6A 3QDRB 1NSQA 4OB0B 4YY3F 1IJFB 3WC0A 2V34A 3MKDA 4DQQA 2E1AA 3PO4A 3P4UB 1XC9A 1TL3B 5DDQC 4JYAJ 1FWZA 3FBFA 1VQ6T 4Z2XA 4DV6J 2RPNA 3PVQA 2W9BB 2VODA 3FJ2A 4A48A 5AT1B 1S72T 4C92F 4NZ7A 1FK9A 4J9EA 4II1A 1REVA 2EQMA 2I0NA 2E7VA 2HVZA 1OY8A 4A8YA 1H3DA 2U1AA 2WW8A 3GB0A 1P9YA 5JUMA 2M0YA 3O5TB 3J80Y 1UZDA 4M5NA 3HHLD 3I56T 2RQKA 3TUPA 1WKKA 2MQNA 3HVWA 2QDYB 3ZNUA 2LQ8A 4LF8J 1JNRB 4J5YA 4A8WA 4CT9A 3DMJA 5I3UB 2BUDA 2KT5A 4Z88A 1X69A 3CCLQ 2AEJA 4LF7J 2KHDA 3ZTPA 4K11A 3GR0A 2DEUA 1NK7A 2J7UA 4ATOA 1SC6A 2IBKA 1M0SA 1O9SA 1E6GA 3LO3A 3D68A 2BA9A 1JU5C 2L9DA 1O0PA 2B7CB 3OW2R 2PT0A 1YITS 2RHSB 3CMQA 5DG9A 2B7BB 4X4VA 1WI8A 2RS8A 5F3TA 3GNGA 2BJ1A 1RLQC 3M32B 5A8WB 3DLMA 3DLGB 5B0DA 3JB9F 3AD9C 3SSSA 3QLHB 3X28B 2ZPFB 1K0TA 5KG1A 2X3GA 2QQ9A 2EKOA 5IV3A 4RX6A 3CXCP 3SCLE 2DX1A 2YKNB 1JK9B 3MWBA 3HVRA 1NKBA 4M5IA 1R8OB 4WP3A 2F8MA 3KXDA 2WW4A 5K8NA 1EQMA 1PCXA 2NSCA 3H7HB 2OTLS 2CZ6B 2B9YA 1BQMA 5L23A 3RAQA 1M1KU 5DY9A 3FLGA 4O3OA 1B34B 1RKJA 2M9UA 2CVEA 3OL8A 4OMNA 4CYUA 1FKPA 3ER0A 4JI6J 4J9RA 3H25A 4LRDA 1AVZC 2AX1A 5A2QY 3JTPA 5GAMh 2F2WA 2L08A 2D0NA 2XWXA 2VQEF 1O8BA 4CO2A 4CC4B 3CC2S 3H8ZA 4ZGEB 2LT4A 1N8RU 4ILRA 5KFNA 1SJRA 2BBEA 1BI0A 1Y3KA 2BRKA 2Z2LA 3G6YA 3SBMA 2HHHF 2XK0A 4JDSA 4TY8B 2MI6A 3T1YF 1EETB 4X2BA 3OYKA 2F4VF 4JV5F 5KG6A 2K1RB 2VOPA 1QLNA 3JAMU 1IGUA 4Y00A 1YJNS 3OSSC 2XB2D 2J0XA 1JLCB 1SPKA 5FU6B 2CPIA 5ETQA 2K7AA 1NSKL 3ITHB 1QVGA 4DLEA 3JTOA 1SKRA 4ENOA 2WOMA 4RMOA 4F04B 5AXLA 2YVSA 4I1TA 2HEQA 1VBYA 3IGVA 1WDDA 1XTDA 1LFWA 3M30B 5B0BA 1X4EA 3ENAA 2J0WA 4K2JA 3V8JA 1C4CA 2FVSA 2LP5A 2J7KA 2KT1A 2C0OA 3CD6T 1SV5A 1PHTA 1R43A 4IFVB 3TRGA 2HHSA 2DH7A 4YHHJ 2QLJB 2EWNA 1UFFA 3BQ1A 2QYZA 3PACA 3VCDA 3OTOF 1CKBA 3NLCA 4LSZB 2CVIA 2NLUA 1TFYA 2FHKA 1S1XA 1YWOA 4PUOB 1SJ1A 3W5XA 5GAMf 4USMA 1FKOB 1AA1B 2GMLA 1E6VB 2IYGA 3OYNA 2K2MA 4Y34A 4BS2A 3BDEA 3HT0A 1NZ9A 3MR3A 2YQ2A 1KD1U 3PG9A 2HQGA 4D8DA 1KSPA 3J7A1 1SG5A 4OI0A 1TUWA 2ZGWA 2K3KA 3J80U 2WAQD 1B3TA 5KFSA 1WHMA 2V67A 1U1LA 2B9WA 3T5KA 2AJ4A 1P6TA 3T3FA 1Q86C 1YNZA 4DV6F 4EMKC 2KEAA 3DDIA 4QZVB 4PQUB 5EG2A 2KDOA 2JVRA 5HKCA 4IG3A 2DXTA 2DBMA 4JYAF 1R31A 2V63A 3FEOA 2P0QA 1Q53A 3OLAA 5HP1A 1TUDA 4USHA 1M1KT 1JJ2A 3GJQB 1L3TA 5LSRA 2YPZA 4O44A 1IZ6A 3UDLA 1K1ZA 5FLXE 4L6V5 1TL7A 4X1VA 1YIJT 2BE2B 1E6YA 4U67Q 2OD4A 4JRQA 1CS4B 2BUNA 1U7LA 5HVHA 1RWPB 3D2WA 2P6SA 1RLDA 1YLXA 3OVAA 1GXUA 4OZ1A 1EETA 4A8FA 2ZITA 2V8IA 3FBEA 4WK1A 4M78D 2A2DA 1ZSZA 4A4KA 5GAGU 3I87A 3GP9A 1ZM3A 3F0NA 1RHUB 3TCJA 4XTXA 4MH8A 5FU7C 3MPWA 5KFUA 3MEKA 4EI2A 1G1XA 1BQMB 3F44A 2AEMA 3R9LA 2HNYA 2R57A 2MZTA 2C2DA 3DLLQ 1NPRA 4C3KA 1M5KC 3DI6B 1VDHA 4RO0A 1V6HA 2VD3A 1XMOF 4IUUA 5LSLA 4DN0A 4KBIA 4DPOA 4J7CA 2DL8A 2Y1JA 4C8QB 1JKHB 2K7KA 2P0KA 4LFAF 1PC0A 4F0HA 4DPTA 1FA0A 2EKYA 1ZAXA 2FHOB 4OB1B 1JXMA 1VQNQ 3HTRA 2E5IA 5ETTA 2E6NA 3SWNA 1QWFA 1M9SA 4O3NA 3M6UA 4Y92A 4FCYA 5LMNJ 2R9LA 1KD1R 3FC9A 2QA4Q 3ZFJA 1SC1B 5F8NA 1DY3A 2AJ1A 2RDIA 2CJYB 4BDPA 1U49A 4X64J 2B0GA 3E1SA 2KRSA 4KSEB 4DS5A 2V0NA 4R0EA 2ZH9A 1WQ7A 2R2TA 3TVZA 5GANf 1RTJA 1WC6A 4FN5A 2R42A 2OTJT 1AUSL 3LH2S 5FDLB 2MKJA 4DZDA 5LJ5j 3QUIA 4TU9A 5HBMB 4OJHA 2VC1A 1NJIT 3GV5B 3K5NA 1TZ0A 1S12A 4YR0A 2DKOB 1Q7YU 3HPWA 2BTTA 1BI3A 1D8YA 1YIJA 2PI5A 4Z89A 4IRCA 4F8RA 3RDVA 4K4SA 3AT1B 1OQ3A 3WX8A 4K4TA 4KT0E 2JOQA 1SVDA 1YI2Q 2O1PA 1WJQA 2H5IB 3LTOA 3BF4A 1RU2A 3CMAA 4A0TA 2DO4A 2WRMA 2JTFA 2XYHB 1XMBA 5A8KA 3M0TA 3PRVA 2CG8A 3NFCA 2OMOA 2KVQG 3S6EA 2PTKA 3EYZA 1F2GA 3IR5B 5CK9A 1KFZA 2CZ9A 2IIMA 1MNDA 4BCAA 5L9XA 4LFCJ 4IR1A 2DXBA 2VG6A 1ZHIA 2XGPA 1CC7A 1MUZA 1C1AA 2YKQA 1YK9A 4LF4J 1WHXA 1A9NB 1Y07A 1SV5B 4J9KA 4B9LA 1CJKA 2QC3A 1UJYA 2VG7A 2KZZA 4OJGA 4PCQA 2DL4A 2IRXA 3RB4A 4X66F 1NE8A 5HMZA 4V2SA 3HVAA 2X4JA 1KQSS 3P5BP 2C3OA 2J6FA 3HRUA 2XI2A 2OFGX 1ZAWA 8AT1B 2IPOB 2FUG9 1EP4A 2HVHA 2NXCA 4N4GA 4BB7A 2PSZA 5L39A 1RYRA 3R6LB 4LFAJ 4NYOA 2MHNA 1M1KR 2CZ0B 2AZ3A 5AYFA 1VQ8Q 5I42A 3JXOA 4ILMA 2RSQA 4JI7J 3MEGA 1X0PA 3IR6B 3SQGA 3CDAA 1C0TB 4I68A 4DX5A 2EXUA 1FRMA 3ETMA 5E33A 2IBOA 1OSDA 4M77E 1KC8T 2QTXA 3D5MA 1KD1T 2P8IA 1K0XA 3MMAA 3FC3A 3JCMQ 2DNRA 3EGVA 2FZCB 1UCNA 1U1TA 2R7RA 5BXIA 2BRLA 2ZKUA 3ZFVA 4ANJA 3M8QA 2PGCA 1JB0C 4C6AA 3HXMA 2AJFE 1WJSA 2C22A 3DOKA 1X75C 2OJ2A 2E5GA 1TL3A 2AJQA 4UUWA 4XU2A 2E41A 3MM6A 1FD2A 4TYAA 3AH6A 3UI3A 1AT1B 4GC6A 5KFEA 4FS2A 2E12A 2E1HA 2W9BA 1Y96B 4LF9J 3LOUA 3OR2B 3HDSA 3CCZA 1VQNA 1R0AB 2MIOA 3QZ5B 1U0HA 3I55Q 1JJCB 3RBZA 2ZH5A 2H1YA 1HJDA 2HL5C 3NTIA 3HMJG 3CCEA 5EUHA 2FLOA 2RHZA 4M4ZA 3CC4S 3GNFB 3Q8VA 2J9DE 1B4SA 4X62J 2HDAA 2UU9J 4ZTJA 3ZTOA 3A8JA 1NJWA 4AQYJ 3E2UA 1M1GA 1YDLA 3JTNA 5IT0A 1LWCA 3T1YJ 3ULRB 3ZZZA 1IB8A 3JSMA 2KMTA 3ET6B 2N7CA 2XHCA 5ETRA 2ROPA 2H8HA 3OD2A 3ZZTA 5GAHI 1YTYA 5A6PA 1WC4A 4DF8A 4XTUA 1Z2ZA 4JRIA 2JFDA 3QYHB 4BDZA 4EU0A 1DTQB 2PI4A 2QRRA 1UG1A 1S48A 1XR6A 4EMHA 1IBKJ 4F02A 4DR6J 3KFWX 2GJFA 3PTAA 2AX0A 2L8DA 4OJ3A 2VPZB 2UUAF 4U7UK 1K73T 2AZ1A 1X4CA 2JLEA 2HBRB 2V2KA 3C3LA 4PG4A 3CDBA 3MMCB 4JJNK 3EFRA 3CMAT 1U1KA 1FF2A 5CCAA 2DNUA 2B6AA 4FVCA 3C8YA 3DLGA 1IBMJ 2KVQE 2DISA 2HRYA 4E7KA 1WQWA 1UGVA 4ZCMA 2MCNA 1DQ8A 3UNGC 2BJEA 2GJ2A 1UEUA 1KVIA 3BGRB 4ICLB 1TKXA 5FU6C 1MMAA 4OI3A 1ZLMA 4MYUA 1M90U 2FHDA 3JCMX 1XNRF 3VQSA 1VQ7S 3C4SA 4XTYA 4IDKA 1IREB 3LPYA 3J7AN 3C6TB 3OYLA 2WSCE 5L8RE 5AE3A 2GAHC 5KG4A 2ASYA 4FSSA 4RPFA 3HFOA 5A0DA 3BV8A 4A0UA 4DEYA 1K9MT 1C1CA 1NYGA 2BACA 3EZUA 1YWPA 2VUBA 2FL7A 2D3OR 4J90A 2QZ8A 2AZSA 5GAN5 3CMET 1T9XA 4IG0B 1ITPA 4N0AC 1VGYA 2NWMA 3CC7T 1E6HA 3VGVA 4YDXA 2ZVSA 4WBFA 3M57A 2RQUA 3PJXA 4ED0A 2GO8A 1BWEA 2XD0A 1RWWB 4IUTA 4LR7A 1EAYC 5HN0A 2QA4S 2LKZA 1RAGB 1FFWB 3CCLS 2FLPA 2NUPB 4OFZA 2VB6A 1UPMB 1V29B 1VOMA 2HBQB 1CQNA 5KT7A 2RJCA 1FEHA 2RO0A 1OQKA 5DQGA 3BJYA 2KZMA 2ZH6A 2AYBA 3MCAB 3CF5Q 1NCLA 4DCPB 1HL6A 2DKGA 1UGRB 2DVEA 5CKHA 2VUGA 5U47A 3BGRA 1EB0A 2L5QA 1M3AA 1SJ3P 1YJRA 5JXSA 1APSA 2CNOB 2RJEA 1Q5VA 3QQCD 3G4SQ 1JLCA 1PAEX 1HNVB 1S77D 2W4PA 1HPZA 3FNNA 4ME7A 2DH8A 2O3DA 4EYIB 3SDEB 3NS7B 3RBDA 2VDIA 3HX9A 4ED1A 2QA1A 4K4WA 1S9FA 1QW1A 3M8QB 2DPIA 3H5SA 2RT3A 5IM0B 4KRWA 4IKFA 2IA0A 1FNOA 4Q7AA 4ZPVR 2QA4G 2HRTA 2W7AA 4PJOG 4J9NA 4C92E 4X34A 2J7IA 2JTEA 1NKEA 1RBAA 4M7DC 4ZS6A 2CYYA 3CPWP 2CGHA 4HCCA 1D3WA 4RNFA 2ZHAA 3NBPA 1HA1A 3CC2A 2B86A 2QQSA 2MQPA 4JZ3A 2JX2A 4Y2KA 2M2BA 4ZOSA 4HHUA 1ZM4A 3HI9A 3OTBA 2KROA 1Q1KA 2V68A 2JS0A 1VQ6Q 4PLIA 1B70B 3TZYA 5DZ6A 4OYAA 1KLNA 4PKCC 1NB7A 1S76D 3HHEA 1AWWA 4CIOA 1VS3A 4C8OA 5LJ5d 2BJDA 3C94A 4USTA 3SCKE 1J5EJ 4BBYA 4E7LA 5L38A 2X1BA 3LH5A 2OPSB 1V3SA 3R6OA 4C8QA 1JJ4A 1A6LA 2JEJA 3NS6A 3A3OB 1UEBA 2XLKA 3O44A 2WONA 1GCPA 2V94A 3CMEA 1AZGB 2EK6A 4GKKF 3HRSA 1FESA 5JMNA 1AXQA 4L59A 5F41A 4OYOA 2CPHA 1W7WA 3TAMB 2G2YA 1IHWA 4L76A 1WHJA 4ZHRB 3CEDA 3CCVS 3D0GE 3OYAA 4C0FA 4M94A 3PX6A 1G8XA 5T41A 1K8AR 2P9GA 2PZ1A 4ZLPA 5D0RA 3PNWC 1AWJA 1MWQA 2CPYA 2ZCFB 3OS5A 3MEEB 2DT9A 1BIBA 4N41A 3U7JA 4DWIA 4ZIWA 2PIIA 4DQIA 5K14A 4ZA1A 5ADZA 1VQ5Q 5D15A 2XY5A 4Q2LA 1U6FA 3EM1A 4P6QA 4PEOA 3G8SA 2H51B 3CO9A 5KFGA 1SHFA 4B3RJ 2MEWA 4KO0A 1F5CA 5GAOn 4O5VA 3H5XA 3NPFA 1QVFP 2NUTB 2VVKA 1NJXA 4ZNXA 1F5BA 2LCWA 1QE1A 2LQKA 1NDPA 3P49B 1WTFA 2HHPA 2HFOA 3DXSX 9ATCB 1Y4ZB 1M5HA 4WU2A 1JLFB 5H9FK 3JCMf 2RD1A 2AF6A 3DHXA 2QQAA 2EFNA 3JV3A 5KFDA 2HFUA 3CMEQ 2A6MA 4TQRA 2OSQA 3OS0A 1OMSA 3A98A 2IJRA 1TAUA 3DN9A 2QAZA 2DHAA 4XAXB 5A8WA 5GANg 3EG2A 3EGNA 3M2VB 2WONB 2ZBIA 4P2XA 1WI7A 3IS9A 1X8DA 3NEKA 1VIXA 2DB1A 3PM9A 3OW2P 1YG0A 2M8HA 2XI3A 4K2XA 5M2RA 3W9JA 4YB5A 2FJEB 2IDEA 3EPIA 2KAFA 3RZAA 2HK2A 1ZSZC 1JLAA 3D6TB 4DA4A 3M9MB 3AQOA 4KHPJ 1SEMA 1OU8A 1UA0A 1J5EF 2LCSA 1M2VB 2B5JB 3THKA 1U02A 2IYIA 1T8EA 3RKYA 1PD0A 4Q43A 5L1IA 2YKPA 3H9NA 2EYQA 1VIEA 2HLTA 2LA6A 5KTQA 4M7DE 4MAKA 3DM2A 1QP2A 4F26A 1XNQF 5KFIA 3AAWB 2IVYA 5DDPC 4DQRA 4OL8A 2MYSA 4XTWA 3G6EA 4USIA 4JI5J 3FCHA 2RAQA 3IS9B 4RLEA 1QAJA 2BZ2A 2DGOA 4FYVB 4TLQA 2D0QB 1UEKA 1MN7A 5F9NA 3V7SA 1BK2A 3EXYA 5E3RA 3A8KA 3CMES 2C2OB 1FRXA 2O66A 1KHIA 1FVQA 3I5BA 3L2ZA 3AXKA 4KPCA 3G96A 1P8GA 1KD1C 1MGQA 1SJ4P 3EGXB 1JLFA 4H4KA 4WP8A 3THPA 3PR5B 2B8AA 1AYEA 7FDRA 4E7IA 2DEQA 2FVCA 1OS5A 2MKIA 5DJBA 1HHSA 4LRAA 1VQ8A 2LZ6B 5IHNA 5CQYA 1RI0A 5HVFA 1EP4B 1RWMB 2Q79A 2RHUA 3PFEA 1UTAA 2ZUGA 3R5AA 2QEXS 1S9EA 1FVSA 5HVGA 4DV5J 4CRIA 4EMKB 2BKPA 4JI4F 4WYWA 4BC7A 4OX9F 4CLKA 2GQQA 1R8AA 1VJQA 4Y28E 3CC7A 1TQLA 1LK7A 4J83A 2CQHA 4PG5A 3MM8A 1VQPA 3PCOB 3PEHA 3NRBA 1HKAA 1M27C 1K47A 1EQ0A 2RKIA 2FJWA 4X9CA 4J9CA 3CMAS 4J5OA 2ADBA 4BI3A 1WFWA 1R27B 5D4OA 5CZXA 3PVXA 1VQ4S 5RUBA 3NKYA 5B0FA 3NWGA 2YKMB 3W3SA 3UA6A 4M7AD 2DL3A 1LOJA 3H5UA 4KFBA 1WOPA 2LXFA 4OGEA 4LNPA 3CJQA 2F2VA 3A3PB 1WHWA 2MLZA 3MUVP 1FERA 1Y5NB 4KB7A 2DRBA 4N4HA 3MHYA 5I42B 2KXCA 3M30A 2C2EA 2FZGB 2PMWA 1HPZB 2JEIA 2WZ1A 2MZRA 1U8SA 5KOXA 2DK2A 3LP2B 4CO0A 2GAGC 1RWVB 2QTVA 1NSAA 4M78G 3MEAA 4ED6A 1K4US 4J9OA 2JDJA 5ETOA 2QEXQ 4OMPA 3MECB 1UHFA 2KJVA 2R8GA 4Y3CA 4EWTA 2AKWB 1FFSB 1DRZA 2Z56B 2DBKA 4O6JA 4QVZA 2K1RA 1RKIA 5E7OB 4RCBA 3ASKA 1YCSB 3C19A 1RQ0A 1VUBA 4QQGA 3BZQA 2D9OA 2UXCF 2E9TA 3VRYA 4IDKB 3TEGA 2XHWA 2DERA 1RT5B 1MWZA 4ZPWR 5JJBA 2ZWOA 3GIKA 4QOTA 4WJBA 5GAN4 2GTJA 3POTA 3UW1A 2W4CA 4QCLA 3TJAA 4N7TA 1FJGF 1BUXA 1JLQB 4OI2A 4A4EA 1MW7A 4HT7A 1N27A 2E5LJ 3NG8A 2FD2A 1M4ZA 1UFKA 4B9WA 3ILJA 3QRRA 4JV2A 2LQBA 1G3WA 1VQOS 4LQ3A 1MMNA 5IHKA 5LJ3j 3UNYA 2Y1RI 4OX6A 1S0OA 3O1LA 5LJ5g 4ZPDA 3KFVA 3GYGA 1IBCB 4WZMA 3CJTA 3TVKA 2XDDA 4PQUA 2E29A 1PRLC 1U4BA 2KT2A 2OPQA 2Z2YB 3T5HA 3JB9J 1SRMA 5FU7B 4M5LA 3ET6A 1RWUA 2QEXA 3CCQA 2XDPA 3FSYA 1KQGB 3PYGA 4B17A 3THTA 2MYFA 4DXLA 2DEIA 2EKNA 1UVLA 2RRNA 4DR1J 5KFOA 3V4IB 1QCNA 3U27A 3A12A 3W7BA 1JMTA 4AMCA 1YJ9Q 1IWGA 3FBCA 1ARKA 4RTXA 4LF9F 4XTVA 4LF6J 2XIDA 5C5JA 2CJKA 2OLWA 3QT5A 3GFYA 2H3EB 3A8LB 5DLGA 4LN2A 1RWNB 4NLGA 3WIVA 1QUVA 3GG0A 3W62A 1RZMA 4RU9A 3RBBB 4RW6A 2QA4T 4FXWA 1TK0A 2HL3A 4P7TA 3QZ7A 3DRPA 1HBMA 2ZNZA 4PJOD 1RHJB 3KG1A 2WK4A 4QYZK 2FHMA 5AJ3J 5IT9U 3UD5A 4WYLA 2RILA 4UOCA 4QQBA 5KYYA 2P6TA 4USJC 1G3SA 1XERA 2DRKA 4J8OA 4P5NA 4Y2CA 5CKFA 4U9RA 4MIBA 4OQJA 3NBPB 2ZD1A 1ZM9A 1SC4B 4I0WA 2DGTA 4W92B 4AXJA 2D74B 1EZZB 3BYPA 4DR4J 3DRYA 4WKYA 1DBDA 3Q8PB 3AD8C 5EX3A 2DZCA 1H2VZ 4X66J 3VV2B 2CPFA 1ZUYA 5I11A 1S99A 3QO9A 3HP9A 4C0BA 1RTIB 1HYOA 4NL2A 3AB2B 4IG0A 1TL5A 5BR8J 5DGBA 2F63A 3OR1A 4DV7J 2L3PA 5GAN3 1WACA 2LJ3A 3U1NA 2KRMA 3KHRA 1H73A 4DSKA 4Q8EA 2F2XA 4LXCA 3CCSA 3M1VA 2EC2A 2W25A 4AL5A 3QYGB 5FJ4A 1RTDB 3VUBA 4LRCA 3H41A 3HHTB 3M2RA 1OV3A 2A3LA 3QJ6A 2GV1A 3OQ2A 3P5TL 3G8TA 4ANEA 3KHLA 2EYZA 4DPUA 1S6PB 4XQ3A 2VPYB 3K57A 3JS9A 3BKUA 4K0KF 2EFPA 1IQZA 4UQGA 1VQMQ 2FZKB 2JWNA 3A5ZB 3GP8A 1W2IA 3W8PA 2VV5A 1YWXA 1BQNA 1T0JA 1LWXA 2HQDA 2XS7A 2WACA 1MNEA 1TWBA 2VJUA 2Y90A 1PKSA 4ZPBA 2J6KA 3DLHA 2ZH3A 3WQPA 2KQWA 3FEXB 2V4QA 1XTZA 3CCVT 1ZZNA 4NPOA 2YWFA 2K8GA 3IAM9 3EG1A 1TKTA 1WXTA 1M3CA 1C1CB 4G1PA 2R2SA 2H48B 2RRAA 2DJQA 5F8GA 2YUOA 1T0HA 2V2ZA 1N5QA 4UQTA 2FTRA 1VQSA 3MMCA 4N0AA 2IJFA 3ENVA 2R7VA 2HZAA 2VFTA 5CYQB 1ZTWA 3GILA 2C2RA 5C2GA 1C0UA 2N82B 2Q3PA 1AWXA 1FEEA 2GIQA 3V7CA 3IMQJ 2M4MA 5ETMA 1A0OB 3NCRA 4UF4A 2ZZNA 4IH6A 1I6JA 1N0VC 1X4DA 1D1UA 1VRUB 3BYRA 2VFRA 2I5JB 3EGWB 3HP6A 2ZE2B 4MMLA 3PV8A 1KDNA 3EGDA 1FXDA 1S72Q 4J7IA 4R8UA 4NL3A 1K8AU 4M7AE 2VG7B 3D54A 3HSZA 1FNXH 3HPOA 2EG1A 4RBTA 3VS3A 1Q86R 3J81E 4M1KA 3PMIA 1Z2LA 2YLBA 3C0CA 4ECTA 4A8MP 1UJ5A 4QT7A 3MM7B 1LNXA 3R97A 2X4WA 4ZLLA 1N9SA 4C92A 2B4VA 1W2BA 1WC1A 1M8VA 1HQ2A 2JC0A 2HK3A 5CZVA 4C92D 3ENWA 2P4TA 4LDYA 4WCEQ 1TMJA 2W8KA 4HHJA 2Q6BA 4QWCA 2X1FA 4FKYA 3QGHA 4KQZA 1S9GA 2H3JA 3MD3A 1LW0A 3TUZC 2DR5A 1UVIA 4M75A 2LECA 4DL6A 3T1HF 2WTFA 3DLJA 3TZXA 4ED3A 3NGRA 3WDOA 4U7UD 3M8PA 4LF5J 2QQRA 3GYXB 1KR4A 3LP1A 1GRIA 4MJKA 5ETVA 2PVGB 1X7VA 2GHVC 2MHEA 1EARA 3ISNC 3VAJA 4YY3J 1LW2A 4NLSA 2XICA 3MF5A 2O67A 1X5OA 3I0SA 2MWOA 3MM7A 4MDWA 2QA2A 4CO1A 3EUNA 1ZX6A 4MZTA 4U95A 3M6WA 1ROFA 1YRTA 3GU0A 1UDLA 2ROEA 2X51A 3DRXA 5CKBA 4MIAA 3TZZA 2XM3A 3ZZ0A 4CM0A 2WSCC 3CBMA 3IC1A 1X6BA 1BQXA 3JRZA 1HWJA 3FZBA 2ED1A 2Y4YA 4O0NA 1MMGA 1GFCA 1BD6A 3UD3P 4M5HA 2UV8A 2M88A 2DNYA 1OX9A 4ES3A 3SWNB 1X9SA 5D4NA 1N36F 4W90B 2R4FA 1ZBXA 5CXTA 1KTQA 3UE2A 2YLCA 1LW2B 2BJ3A 2YX1A 4DS4A 5BYRA 1KQFB 3R7SB 2RB6A 4DV7F 1PGZA 2OGUA 2RI3A 3EE3A 1GXTA 4B3RF 3TA0A 4QR2A 4OIXA 5H9EJ 4JPBW 4CTAA 4O44B 1Q86T 1S1XB 1C6VX 1KQSA 4G65A 2SRCA 4L75A 3QAEA 2YY3A 1HNIB 3A8IA 1CJKB 3BDLA 1S0MA 1FI4A 2RN8A 3CJ2A 2EW9A 3CCRT 4B9TA 1RSCA 4F25A 3G6VA 5HK0A 2AYGA 3C2PA 5D4LA 1YHQS 2R7WA 2MQOA 1PAUB 5GAOp 2AGQA 1IKXA 2MQLA 3RMSA 1KVJA 3PYDA 4QJVA 2D69A 2EWHA 4KH1B 1K0SA 2FC8A 2GGPA 2YX4A 4PXCA 4DV0F 3L4BC 3BR9A 1ELOA 1Y96A 3UN5A 4IOCQ 2KFZA 3ETOA 1TSFA 1OI1A 1CBKA 2A37A 3AD7C 2MAMA 2BKOA 2ASLA 3MEWA 1FXRA 2MGZA 5GAEI 2GFAA 1Z9ZA 1IWAA 2YNFA 1F9HA 3CJ8A 3S3NA 4ECWA 4F3QA 1TVRA 1X31C 3GF5A 1XQHA 3CSKA 4L6V3 1KK7A 1FRLA 3V8LA 5EWGA 3EZ5A 5LJ3d 3SHWA 2V69A 3GONA 4F4AA 2OTLA 3T19A 3RKXA 2HVEA 2J8SA 5KG0A 1RL2A 1ZZFA 2F7VA 3ZO7A 2D6FA 1TUCA 3OW2A 3M2VA 2QDLA 4YOEA 4BLGA 2J5AA 1PSFA 1RABB 3LGLA 4ZN3A 2LFVA 4LR9A 4DOWA 4HVWA 1M90R 3RB6A 1N56A 5KCOA 4JB8B 4M63A 3HHLA 3PZPA 3M32A 5IWAF 2HZVA 3KXTA 1I94F 2Y8WA 1T9WA 3VR1A 1R0BG 2QJ3A 4CDIA 4ITSA 2PEHA 2VQFJ 3L2WA 1MU2B 2JTMA 2W01A 1GX6A 3TJ8A 1Q0NA 1QD1A 1HWIA 3EWGA 3O8VA 3W64A 2DO3A 1QCOA 3JB9k 1SPBP 2FJVA 4CLLA 3SD4A 2VKZG 4UOGA 1KSWA 1UL3A 1EKSA 1WZOA 4FYXB 1GMWD 3V5RA 2CPJA 2HHHJ 3TO8A 2BXJA 2ACMA 1MV3A 3IRXA 2YWWA 2AQ4A 4QIFA 2JUFA 1TG0A 5CO7A 4NCGA 1ZA1B 3AXMA 1E6VA 2V26A 2CWKA 2K4YA 4OYBA 4BY6B 2I6WA 2R58A 3BR8A 1RLCL 1RAJA 4MK9A 1SH3A 1HI0P 3SIPB 2E70A 1X27A 3DLBA 1VQKT 3UR3C 5IXUA 1NDLA 5MLCV 1PG5B 3KK2B 4EIKA 3UDVA 1VRQC 2HQXA 4NA3A 4JI8F 3WHIA 1GTEA 1SL1A 2AWZA 1SCJB 2RJDA 2IM1A 2F8HA 1UKUA 1WUUA 1HNZJ 5FLXY 2B4UA 1E6YB 5GMKa 1IR2A 4X4QA 1Q8LA 4EPCA 3F56A 5GAEU 2OKQA 4Y65A 2EGCA 4BY6C 1XNIA 4FW1A 4BE0A 3NGSA 3PJ9A 1IGQA 5L8RC 3MZIA 4PKDB 1HD0A 4OMFG 5DLOA 1FWLA 3G82A 2QG9B 2IA6A 1RA7A 1C2PA 1T9TA 3OHAA 3DB3A 1V9OA 4CO5A 2DYBA 2GF7A 3UVJB 3TA2A 4ZLJA 4DJBA 3QIPA 1AW0A 4G6VB 3UA7A 4OHVA 2YNIB 4RBUA 3QPIA 4OHYA 2EJ9A 1YJWT 5HMXA 4M7DG 2KH9A 4B6MA 2FY8A 1S72S 2KI7A 2RVJA 1RT5A 3V81A 3BREA 4IFVA 1URRA 1ZSZB 3GQCA 2YWGA 4RW4A 4ECVA 3OHBA 1AZSB 2P0PA 1MMDA 3BO3A 3TEHB 3MPVA 1VQMT 1U6BA 4G1QB 1T94A 4J9GA 3HO1A 3OL7A 2EQJA 3L3CA 4IURA 4JI8J 1IRXA 3I4HX 3CCLA 1U1RA 4I56A 4RTUA 4RUAA 1ICEB 4ORZA 4RUHA 4A4HA 1ULRA 4OJ1A 3CCVQ 3PW2A 2NLWA 1QVPA 3CD6S 1JJHA 2ZNYA 4PJJA 5I4MA 1NXIA 2GNCA 2DNOA 1JKHA 1Q81T 1S1VA 2WSEC 3MCMA 4USVA 3CEYA 3SFMA 4RNMA 1T3NA 3VAHA 3TU4K 4F67A 2L0AA 2B56A 3KG4A 1HMVA 4CI0B 4PYAA 3M55A 2C1EB 2FPHX 4Y2MA 4M5DB 1JQQA 5LT5A 3MR5A 1IKYA 2QMXA 1KS2A 3RJMB 1HW8A 4OP0A 1HXDA 1YJNT 4YR2A 4L72B 3UN3A 2YRCA 1Q8BA 1ZBTA 2E1RA 3IN5A 1OPZA 2QXFA 3CC4Q 4D8KA 4DOZA 5D3GA 3CDEA 1W26A 4JP8A 1OY6A 3SXLA 3RNJA 1NZAA 2W2OP 1S6UA 4X65F 3HJVA 3S7RA 2ZH1A 4GLKA 3SQGB 2JH3A 2UUBJ 2IMWP 2N7YA 3PRBA 1RT6A 2R3VA 1RCXB 4WK3A 2KPPA 1X60A 4N77A 5GAOr 3VAKA 2KE9A 1DTTB 1U1QA 3WVEB 2ALZA 4EDUA 3OR1B 2FJAB 3KLFB 2QE5A 1HNXF 2BE2A 2VFSA 5CQXA 1AFIA 1OU9A 4GRSA 1Q4RA 2CSQA 4LF7F 4E6RA 4ER8A 5HBMA 4ZVEA 3JCMW 3TOQA 2W9AA 4OX8A 3BSNA 5D78A 1NO8A 1VQLT 2V50A 2ILZA 2RRBA 2YNHA 2UVVA 3M5AA 1G2BA 5HQLA 3DGPB 1BCOA 5CH7B 1VHFA 1VQOQ 2R7XA 5GANj 1YBYA 1X4HA 2QGGA 1FHTA 2B4OA 4ED8A 4DUZF 1UPPA 5KFTA 4ED2A 5GAHU 1OZ2A 5LL6d 2YUNA 4JJDA 3T9NA 5C24A 3UVJA 4DR7J 1N6QA 3DDKA 2UV8G 4DV3F 4KH0B 1TTHB 3QATA 1FT8A 4C9DA 2HBZB 2ZAEA 1S9GB 1VQKQ 3N79A 1VIOA 1S5ZA 4PNOA 2RMLA 4Q5VA 2BQ3A 3MCOA 4ZCIA 2LTOA 3W66A 1YITT 2VF3A 3M8PB 1JBMA 1XBWA 2Q66A 3LP1B 4V19X 2HWTA 1WA7A 3W65A 3KLFA 2QLWA 1LWEB 1T9YA 2LEBA 1YIJS 1X9WA 3RGIA 4CLPA 2Y9HA 3OS1A 3CD6A 2IAJA 5J1EB 2PEBA 1RBOB 4M5KA 3GCWP 2J0SD 2HIYA 1TL1B 5DQHA 3FRYA 3D4JA 3UT1A 1RDRA 2MZSA 3D3BJ 1O75A 1IKVA 1DQAA 4MFBB 5KT5A 3Q8QB 3VV0A 1YJTA 4WF2A 3OY9A 2OPSA 5A8RA 3GCXP 4URGA 3CCRQ 2QSWA 1U0HB 4M5DA 1TKXB 4L73A 3EVWA 4ZLNA 2RUGA 4KV8B 2HQ3A 3M2RB 2BQRA 4NMXA 4F4KA 2QMUB 2CQ3A 1LCKA 4EMGA 2F40A 2OTJA 3X25B 2YQ3A 1YGYA 2HQCA 3OXLA 4UOFA 2ZHBA 4DCOB 4XPEA 4RKUC 5CYQA 2RQVA 3V8KA 4EGLA 1QKXA 3PDNA 4LDXA 3OTCA 2C28A 3A8OB 2OPPA 3T1HJ 1UGSB 3PHTA 3UWNA 5KT3A 1T05A 2P5VA 1BLUA 3IGNA 4XPCA 2D8JA 5DO2A 4PJOC 5J2PA 4M7DB 3NMAA 3D7SB 1VQ8S 2ZC3A 2A7YA 4OHWA 2ZBQA 3W9IA 1IKXB 4HDGA 4NXMJ 3TAMA 1WDTA 2DXUA 2ZZDA 2V2VA 3N4WA 1NZ8A 1WKLA 4ES2A 3RERA 1IM6A 3CCST 1RTDA 4FS1A 3NAHA 1Q81C 2DR9A 3VUZA 4EZ9A 4ELVA 1T95A 4M7AA 4DR5J 4M75B 1BIAA 1UUEA 3MPUB 2YWKA 2VOOA 2CQGA 2G6FX 2YKMA 5GAN7 3CCUS 5IC4B 4DR5F 3GPLA 4A8OA 1VQLA 2W9CB 3CD6Q 3G6ET 3TVYA 2UVUA 1HBNA 1KONA 2LQJA 4BI8B 2CG4A 3QRQA 3OYHA 5LXYA 5J2NA 1MN9A 1XMOJ 3TQEA 4MKYA 2X4XA 2RNAA 1SUQA 1Q5YA 3EH1A 3LANA 4CI0C 2DR7A 3L95X 1SL0A 3PIPA 3H6ZA 3HD2A 1JXOA 1JJ2S 4OHZA 2CH4W 4B9SA 2JZ5A 2OPQB 2ZM6J 2EK1A 1W4SA 5C6SA 4AL6A 3KHHA 1RCOB 2EQKA 5CVIA 3J7AF 1BYMA 1IO6A 4WFBQ 3P8DA 5ECAA 2JL9A 2D8HA 1U45A 1RAEB 2MWPA 3X20B 4GO7X 4YHHF 2CDRB 1FKPB 5KFJA 2O5DA 4KUDK 2PFDA 2Y0SD 1AEYA 3I82A 2VZ9A 3MM5B 1YBAA 2IIHA 2SXLA 3N5BA 2OIHA 3G71A 4LF5F 4TLRA 4J6XA 1WNEA 1HNVA 2O88A 5FD1A 3NL0A 4ETXA 4HKQA 2KXNB 4DUTA 3G71T 5GJVB 2RDDA 2B9XA 2E66A 2ZOGA 1UECA 4KR0B 1U1PA 4KV8A 2UXDJ 1VQYA 4DQ2A 1P92A 2W2MP 3RW6A 1N8RR 5GANd 2E5QA 2I2YA 3L2QA 3RMQA 2NZ4A 1Y5IB 2BANA 2XLJA 3QGIA 1VK3A 5J2QB 1CQMA 2ABYA 2F1LA 5F8MA 1YJWQ 3AY0A 2CQ0A 3CCUQ 3ZZRA 2C06A 2CP2A 1H2UX 3GFZA 3ILLA 2FB7A 2XSJB 4Q45A 4F3MA 1SKWA 1YVFA 1CJTB 2RI2A 4TYBA 2VQEJ 2P9CA 5D8HB 2JT4A 4C5HA 1URNA 3FMWA 2BKNA 4ZVOB 1Q82R 2AYMA 1U1NA 4E7HA 2RJFA 1RTHB 2DNPA 4A47A 3RTVA 4J9SA 3O5ZA 2E3IA 2DYIA 4ZVFA 5HLFB 4VUBA 3DLLA 4PZVA 2E1MC 3I0RA 4AD6A 2KJWA 1JRIA 2V2QA 3QMQA 2FYXA 2X9HA 3SCJE 5KE3A 1NHUA 3WX4A 3HJFA 3UCUP 4W4MA 2PVDB 3H5YA 1RTIA 2VGNA 4Y2AA 5IS2A 3MFIA 2PUOB 1TKTB 3I5CA 4F7UB 4PJOE 5B0EA 1RA6A 4PPZA 2YH0A 2M1HA 4PR6A 3C95A 2YWHA 1QVGR 1UWAA 1NLOC 1WOSA 4IIOA 4J9QA 4N5SA 4NOHA 2HKNA 3CCJA 2V8GA 4H4OB 3CXCA 2BJ8A 2ED0A 3OYGA 4OMLA 3MM6B 2M70A 5KT2A 3VS5A 2LMJA 4CYUB 1U2RA 2GVDA 3KNGA 2HFVA 2D41A 4OYPA 2J9DA 4F2SA 3ZTRA 4UW2A 2MDAA 1D0YA 2JC1A 2N4CA 1WXUA 4R0KA 3EGUA 5J2MA 1GBQA 2M02A 2E7WA 2V4RA 1YJ9A 5L1LA 2D3ZA 3UF4A 2KTQA 7AT1B 1K1SA 4CWBA 2HSEB 5E2QA 3FCWA 3PEJA 1SRLA 1W70A 3OYJA 1BE4A 2RH3A 3W9HA 3L2VA 2EEYA 3CJ0A 2M51A 1S1TB 2IC3B 3V81B 2C3MA 1NB2A 2R5AA 2Z2MA 2XS2A 2NUPA 2HG4A 1T11A 2VFUA 4WF9Q 1I3OB 4DV1F 4ECSA 1BMQB 2IM0A 2MKHA 5HAOA 3DYAA 1H98A 2MMYA 3VZHA 1GL5A 3KHGA 3M4GA 1YQHA 1NKCA 4RWXA 1PIEA 4ZPAA 1T0TV 3R5GA 3HLUA 4CC2A 3JCMg 2F3JA 2E64A 3V6DA 4C8QE 4FYDA 1B3QA 3MMBA 3OR2A 2NUZA 3R2DJ 5HANA 1PC4A 3HF5A 3BSOA 2V4JA 5HSPA 3RRHA 1WC3A 4HT9A 5EHHA 2XU8A 4LJMA 3I9V9 3MJXA 3IRXB 1UGQB 4PWDB 2I38A 1M1KC 1Q81U 2XMFA 1VQ5T 4QVDA 4C92B 1VLOA 4DUYJ 5HMWA 4HCBA 3FDSA 2A1BA 4PJOF 3T41A 2E44A 2JSXA 4C5GA 3V6HA 2OI2A 1WD6A 2YNGB 2WVDA 3MTKA 2RF2B 3N9UC 2UXBF 4XDCA 2DJZA 1D9FA 1YP5A 1JLGB 3D1QA 2DNQA 2GJIA 1VQ4Q 2GFFA 3HK2A 2J6TA 1HARA 3QIDA 2DY9A 2YNHB 4FNIA 4KRTA 3NTKA 4KGVB 2EQIA 1M5Q1 3GYNA 3Q8RB 4K4UA 2V8DA 4RCCA 2DGWA 3I0SB 3IWNC 3I32A 3X24B 2YXYA 2AW0A 3A8EA 3UFCX 1KRPA 2BIVA 4LSNB 3JCMV 2BZYA 3FK4A 1C0MA 2GX8A 4DZ6A 4BDYA 2AKKA 4HH1A 2XZDB 1QCFA 1S0NA 3R7NB 2Z2ZA 1DLOA 2AGPA 1U1MA 1RT4B 3KUEA 5B09A 4NXNJ 2RQRA 4EEYA 1R8BA 2X1GA 1VQ8T 4IUQA 2ABLA 2H54B 3H20A 3Q89A 2BQUA 2DR8A 1U6ZA 2BZ8A 2BE9B 2WVEA 5LJ3h 2OEKA 4GLMA 4ECXA 4Y0FA 1T3LA 1VC6A 2J9CA 4LF8F 2DD4A 3R8YA 1U0SA 6FD1A 2ASDA 4CZCA 2DH9A 3CPFA 3D1HA 4DLGA 1LVKA 1NG2A 2VG6B 2V9WA 1UE9A 2HSPA 3G86A 1VQKA 1UTIA 5LMNF 2IHR1 4LD9K 4M8LA 3W5YA 4LD6A 4RUBA 1IR1A 2L48A 4NLTA 2HHVA 4DR6F 1IBKF 1W1FA 3FCVA 4EK2A 1S10A 1M5VC 2JLFA 3CPWS 1PYOB 3IWXA 4ZJOA 2DGVA 2RHIA 4WE1B 4B08A 3CCJQ 2FPDA 5HL7Q 1S1TA 1Q16B 4DQPA 4F50A 4ZKAA 3PJWA 4CTAB 4WFZA 1WHYA 2W7OA 1YFNA 2LQ5A 2K9GA 1IR0A 3DKMA 2RQWA 1LQ9A 2YTCA 1UFLA 4G1IA 2HKEA 3JSRA 4H4KC 3PHEA 3EGZA 1K9AA 4DEZA 1S79A 4PWWA 3VJPA 2P9EA 4DBHA 3NMRA 4AT1B 3SDEA 4FBTA 3M4XA 5CD4A 1WEZA 4D3GA 1U2FA 4JOUA 2AK5A 1RAIB 2MF2A 1EFNA 5KFHA 1B99A 2A36A 4K4XA 2Z8QA 3MOJB 1OZ3A 4LBIA 1TKZA 3FEZA 1B7FA 3ZTSA 1B34A 1T3OA 1UB4A 1S6QA 3SSQA 1ABQA 1HBOA 1VRTB 4U8VA 3J7YU 1ZTTA 1QP3A 2FO0A 4OZ2A 3NGUA 3LAKA 4C8QC 4OI1A 2L3SA 2POKA 1RU1A 4PJOB 1Z4UA 1QLYA 3IM8A 2XMUA 1UHCA 4NLVA 2E65A 3BBBA 1PJ6A 4JI4J 2H65B 1NJIR 2GA7A 4F0MA 4PJMA 3PR4A 3R27A 4P74A 4PJLA 4FVMA 2BVZA 5GMKi 3M2UA 4DPWA 3AJ1A 2F8EX 2HEKA 1VQ7A 3H98A 3QHSA 3TR5A 1HQEB 2LX7A 1SIWB 4MT1A 1Q78A 1YHQA 3BM7A 2A08A 1JLQA 2IAJB 5LJ3Y 3LGMA 5GAGI 5A2QE 8RUCA 1K73U 5IHIA 5AE2A 2DNZA 5ITHA 3NMZC 1D09B 3A3NB 4KJIA 4NE9C 1SKSA 4LFBF 2QN6B 1IHVA 5A2QU 2PC6A 4CP5A 3W60A 2PN6A 4NZ0A 3OBWA 4C3LA 3M7VA 2V8KA 4ED5A 2COZA 1N8RT 2HMIA 2FB0A 5KYYB 4FT2A 3F73A 2QV6A 2DCUB 4B02A 3M8WA 3BE3A 4OV6A 2EFGA 3U02A 1B0VA 2RHYA 2R8JA 1Y00A 4M7DF 5H9EK 2GIRA 2JVVA 4KTQA 3CC7Q 2CP5A 3IA0A 4LSNA 2WBMA 5DRKA 4M77B 4DU7A 1WX6A 1KVKA 2CKWA 2MJUA 1UJ4A 3HHKA 2QA4A 3CD5A 2CPZA 1VQPT 4MZMA 3KWMA 2AGOA 1V3RA 4F14A 3OVSA 2LCCA 2L9NA 4MKVA 4HACB 2E3HA 4XK8C 2CUYA 3UQSA 3E01A 4DUZJ 4HVUA 5HY6A 2C2KB 2QASA 3CT9A 3GIJA 3HT3A 1DFDA 3V4IA 5KFLA 3I6PA 3M0UA 2GBQA 5I2MA 4IUPA 3BN7A 1Q7YR 1VHIA 3MO8A 1GXIE 4PQAA 2XMAA 2VASA 3EX7B 2R8HA 3THVA 1HR0J 3VWSA 1YBTA 3Q24A 3FQLA 3LW5C 2COLA 4ZVPB 2L2PA 3TREA 2MZJA 4DUYF 1S59A 4M75F 1H2TZ 4N76A 4IIMA 1UMJA 3VHQA 1HBNB 4TVAB 1N5YB 2UUWA 3RYLA 5LJ3f 1YCYA 2V4JB 2LQ9A 3ENQA 2AT1B 4LVNP 3MDFA 2FIUA 3Q83A 2YX7A 3HRTA 1UW9A 1DAXA 2DY1A 3D28A 3LP2A 2IVMA 2DGSA 4JUVA 3ZC4A 4M78A 4RUGA 4F36A 4X4PA 3TJ9A 2HNDA 3N28A 1S0VA 1YJWS 3ILIA 3NWRA 2KYXA 4WKRA 3CCUA 2UUAJ 5A0LA 2KKHA 3NGPA 1KEKA 1IKVB 2RHXA 1LOUA 4R5PA 1PBAA 4DR7F 4DFPA 4OZJA 2QQBA 4HLBA 1WHKA 6AT1B 2E5HA 2D7SA 2Y1LB 3EDRB 3UR0A 4CLYA 4HDHA 1UVNA 3BQ0A 2ESWA 2LJ0A 1U48A 4KBMB 1CJVB 2HFZA 1U25A 4N8OA 2W10A 2YNIA 2C3UA 5HMYA 3N6MA 2GMJA 2XTJP 3LLRA 2CUBA 3LWIA 5F8LA 4IRDA 4RW8A 2L3QA 2V8JA 2CRLA 4M77D 5HK4A 4FSXA 5GAOm 2CWXA 2CP3A 1UVMA 3OA6A 4HA8A 2YKAA 5EDWA 2FLNA 4NLQA 4LR8A 4QU6A 1KNZA 3MM5A 3VAIA 4PPDA 4KIAA 1TP7A 5ETNA 1Q8IA 4JJCA 2HMIB 3R7BB 1RACB 3L42A 2BJ7A 4DR3F 2GFUA 2DPJA 2HNZA 2OELA 1IVZA 4K0KJ 5C2CA 4E47A 5M9OA 2RK1A 3CJSA 3OUYA 2RB7A 3OV7A 2K6DA 3OFGA 2UUBF 3GE9A 1NK4A 3KJNB 5FIIA 4DV2F 2ZJPQ 3JB9H 3JSBA 5CAIA 3F70A 1KQ1A 2EYWA 1Y71A 2XSFA 3NTHA 1RISA 1P9QC 2RHQB 3MPDA 5KCHA 4B3OB 2N4DA 3CXCR 3OYEA 2AHJB 2WVCA 2C0IA 2MY7A 3VVTA 2BE7D 3T1AA 4M77F 2X4YA 3VS2A 4DBFA 1VQ6A 4ZGDB 5LJ5f 2KI2A 3SDZA 3G71S 4JI3F 4KGKA 1NEEA 1WJ9A 4I2PB 3M0SA 2F9DA 5KFVA 5KFMA 2G0IA 1Y0MA 2KSSA 3D3CJ 3FDRA 4EMDA 1N5TA 3FSIA 3Q0AA 1QUPA 3QRPA 1K8AC 4OLPA 1I1GA 3UCGA 2NXNA 2DTHA 2JZ2A 4P7VA 3PW7A 3MOZA 1VYUA 1W2BP 2Y4XA 2HBYB 2X3XD 2JFKA 1SJQA 1PRMC 3UN2A 3H59A 4M7AG 2C2MB 3SWNC 2RH2A 3ZBDA 1XR7A 3VS7A 1B7YB 1PILA 4IG3B 5BYSA 2EVRA 1MG7A 4B3SF 4AL7A 3NNAA 1I4K1 3MCSA 2NSBA 2XG8D 1GX5A 3K8VA 1WDXA 3Q8YA 3JQJA 1VRUA 3RIRA 2DRDA 5J2MB 3I96A 2MB0B 1KOHA 4OYXA 1OJ4A 3SI8A 1MWYA 5HI7A 1U8WA 4C8KA 1R8PA 5HATA 3S3OA 1PSEA 3GV8B 3C14B 1SHGA 5GAMg 3G6ES 1HYSB 3CD0A 2JJ4D 2DGXA 4B9UA 3FSXA 2HVIA 2CZVC 1DTQA 3US5A 1QWEA 3CCRS 2IDLA 3C15B 4M78F 4ZPCA 4G1QA 3G87A 3R3TA 3RRGA 2K5LA 2FVQA 2XMMA 2WCXA 4O3QA 3W2WA 5GADU 1QVGP 1DARA 5A8RB 1U3OA 1BGXT 1U1OA 2XNRA 5GANe 2ZZTA 3G4SS 3M6VA 3QKJA 4ZVQB 4C4WA 2NPFA 4ZVSB 3I55A 4ATNA 3HHLC 3JSYA 3L7PA 4DR1F 1YN8A 2RUSA 5FROA 4OVAA 3LGHA 6FDRA 3KLVA 2QLXA 4FBUA 2G0CA 2E6ZA 1FX7A 1XMQJ 2C2NA 2VG5B 2RU3A 2CQCA 1HNZF 3HFKA 2AHOB 2J0QD 4YS2A 1LWEA 1BXNA 3DXBA 4Z7YA 1U5SA 1HMVB 3O3LA 4LIRA 4TQSA 4J7FA 3B4DA 4HTJA 2XCPA 1D3BA 4C11A 4I7FB 2A0FB 1VBKA 2QSFA 3OSVA 3PYFA 2B43A 2V8PA 5LMUF 4EBCA 3HVTB 1U09A 1UWBB 3BBFA 4LE9A 4AYBD 1O5JA 4J6YA 5D3GB 4JLGA 2HGLA 2RQMA 1YZ7A 4WPAA 3L2UA 1YX2A 1WORA 2ENMA 4RW8B 5D0GA 4U96A 4ECZA 5KYWB 4X4TA 1AHJB 1GQEA 3GTYX 1FWKA 3CCQT 3CD7A 3POTB 4KKOA 5A8KB 4DEXA 1PKTA 3OYBA 1I51B 4LBHA 2OAUA 3OPKA 4ZVGA 4IKAA 3JCMe 4XIUA 3MP6A 2LXIA 3K59A 1FKAF 3OYYA 4B9VA 1Z1ZA 4LUBA 1C0TA 1LWFB 5KYNA 3M9OB 3IP0A 2OX7A 4NXMF 2HHUA 4QW9A 3DLEB 2IY5B 4P9SA 3CNQP 1IQTA 3TNVA 2NQPA 4IH5A 4PXEA 3Q22A 2CJAA 1TK8A 3NY0A 3QAUA 1DZ5A 3CCMT 5GAOl 1ZSGA 4OF1A 4DR2J 2DILA 5KYUA 2DIGA 4C92G 1F3FA 1LW0B 1EIFA 3CJ3A 1JWWA 3N6LA 5I2SA 1NU4A 4PK4A 5GAMd 3TUJC 2CT3A 4N8NA 3KLGB 3IAS9 4IFYA 2YNFB 4PG8A 3DU6A 1CVJA 2CXEA 4MK7A 4CLUA 3OTDA 1MLAA 3TWZA 1WHHA 3WC2A 1PNJA 1Y5LB 4MTPA 4I64A 2MGZB 2O2OA 3VVUA 4ZITA 3D67A 3EXCX 2BJ9A 4ZVHA 4LF2A 3NOCA 2ZM6F 4DR3J 4C8NA 3LF0A 4FZVA 2XWYA 5LJ5h 4KKOB 3V6KA 4LREA 4B9XA 2AJ2A 1GCQC 4ZTFA 2BM0A 2W9CA 1TL4A 4CLZA 1KIKA 4Q0BB 3CBOA 1OULA 5LXRA 1NSPA 3PIOQ 3E2EA 2EGAA 2LDIA 5J39A 1R3NA 1LFPA 1VQLS 5DLQE 5DM7Q 2IJNA 5GVQA 2AIRB 4E7JA 3PRDA 4C3MA 3JCMP 5K8PA 3HKWA 1PO6A 4Z02A 3OS2A 1B7TA 4DV5F 2DYAA 1JLBA 3G7ZA 3M56A 2LMIA 3FBBA 2ZPIB 3C14A 1NHKL 2WSEE 4TKTA 3CUNA 4C8LA 5J26A 3OYIA 1PBUA 4GMKA 5KYUB 4NCBA 2OEMA 2VHGA 4M7AC 2DXCA 4QKUA 3SEOA 4CNZA 2QL9B 2LDYA 5CCMA 2ZKTA 1YJ9T 3KOAA 1FYNA 1S6QB 2C3PA 2HHQA 3PO5A 1EKRA 5LL6S 5ETKA 5GAOq 1NEGA 4I6YA 1H7WA 1ABOA 2KNBB 4NA2A 5F8HA 2QTWA 3G2XA 3I35A 5HP1B 3OL6A 3LWHA 2PA3A 1I5LA 2DBBA 4DX7A 4O23A 5ETLA 4YTLA 4YMEA 4TVRA 3IG1A 2BEFA 4C0OC 4PYDA 1YRXA 3J81Y 4NEYA 3HFZB 1UAWA 3CPWA 4F7UG 3I0RB 3M05A 1XMQF 1TELA 4H54A 1FMWA 1QAXA 2YHTA 4LDWA 4DL7A 1T9UA 3IO1A 1SIZA 5LJ5e 3T5LA 4AFSC 4DBRA 1CSJA 2EQUA 4ZGJB 4O4GB 1FKOA 3KK1B 2J8AA 2CJ9A 2KN4A 2V8HA 3BGFA 1ZETA 1PJ5A 1HYSA 2UZAA 1G5VA 3SV4A 5KG3A 4O3PA 2K79A 1ZPVA 1KWMA 4F4XA 4I7FA 3WIUA 4X65J 3HHDA 4FF3A 3BEGB 2JHEA 1CULB 1FRJA 2VDHA 2DGQA 2ZJRQ 3FB9A 3M0QA 4C0DB 2J05A 2WB1D 4ECRA 2DD8S 2B4PA 4Y91A 3PW0A 2KT8A 2HURA 3R5DA 4R56A 2Z0WA 4OZ0A 1RTZA 1TH7A 5GMDA 4DCJB 1M30A 4DSJA 2BV3A 3HCXA 2CJXB 4XTZA 1VK8A 2ZBCA 1VQMA 2JEGA 3HM9A 2L41A 2RQTA 1X6GA 4MKAA 3I5AA 3GPAA 4JI2J 2NXUA 4ZPTR 4NRUA 4N4IA 2AYEA 2E1CA 1UFWA 4FF4A 1R0CB 2VGMA 5FRNA 1OEBA 3HSBA 1RWXB 2RIJA 1NHVA 5D6GA 2CQ2A 1HI8A 4DSIA 4MDXA 4NASA 4MK8A 3VZIA 4LFBJ 3SFGA 1IN0A 3C6UA 3SCIE 4DX8H 5C24B 5KT6A 1K0VA 4MYTA 4HKEA 2MPXC 3RUBL 4K4VA 3U1MA 2HS4A 1FCAA 3TSWA 3OJSA 2QIFA 3E19A 3OB9A 3C12A 3MUMP 2YDLA 4ID5B 2Y8YA 1WC5A 3AOAA 4WXWA 3D6MB 4CLWA 1HQUB 1VQNS 1R8CA 4F2RA 2GQCA 3DCAA 3PIOA 2YUPA 1B07A 3RESA 4NLUA 2LP4A 1RT3A 5GAN6 3QO3A 1VR6A 5J1EA 2XLIA 1SQGA 1Q79A 3CJ4A 3MECA 4J9IA 3PX4A 3QDFA 3OJUA 3IM9A 4LVOP 1FDNA 1M90C 1R6VA 4R25A 1I0CA 1WKJA 2O31A 3MI7X 1M5PC 1WEXA 2M52A 1J27A 4F7UE 3QWXX 2X3DA 1VQ9T 5M2UA 1G6BA 1KHWA 1HBUA 1LKZA 3J7YI 1B0TA 1VMBA 1N8RC 5GMKj 2RDJA 4LQ9A 4ECQA 4JI1J 2DIUA 4OMQA 4M75D 1RYSA 3I5SA 3D0IE 5HROB 3K17A 3BO2A 5J3BA 3ZZYA 3QIIA 3L2RA 1D9DA 4DR2F 4CM2A 4FYYB 3HFVA 1WG1A 2I8EA 3QSIA 1Y10A 1RT6B 2N3OA 3QWYA 4PUOA 5FWBA 5HJYA 3EICA 4OYIA 4WFYA 3DYAB 4ZVTB 2YSQA 2D3O1 3QNWB 4N56A 9RUBA 2F4FA 4PAAA 2DXFA 3TX0A 2MK5A 4KGXB 4I2QB 4AFZC 3ZNJ1 4M7DD 3CCET 1N4LA 1TS9A 4RTYA 4DSFA 2ZBPA 3DGPA 4L3KA 2MXYA 1RHRB 2EIFA 2DTJA 2EFQA 1ZBJA 3EFOA 1KC8R 2SEMA 3KJVA 1T05B 4JUZA 5KFCA 2KFNA 2ZD1B 4PLLA 2FG0A 1H3ZA 1YZ6A 4FKXA 1VBXA 4OLOA 2BZXA 4M78C 2XSJA 3H90A 1RT2B 2HPUA 3CXCS 1Q82C 3FMBA 2VBYA 5IH2A 1FJGJ 3UO0A 4OB3B 2YT6A 1LV5A 5LOQA 4R0JA 2L3MA 1UP1A 4FL6A 1TR0A 4JI0F 2IMOA 3RAXA 2VQFF 5HO4A 5F8JA 2A18A 2EBPA 3QSYB 4C0GA 1YITQ 1X4GA 2PUKB 4X4UA 4C8MA 1HI1A 4OBIA 3I31A 1DJ0A 3QO9B 5ETSA 4R8UB 2VBWA 4Y2IA 2CNKB 1UEVA 1F2HA 1HBOB 1HK9A 1TL1A 5FDLA 2J6OA 1C1BA 3GJSB 3FIFA 1FWPA 2GGPB 4LF1A 2D9TA 1S1WA 4U7CA 1FNMA 4HI1A 1HSQA 2HQIA 4C2MA 3R5CA 1RGVA 3IQLA 3MR6A 3JCMh 3E9FA 2HGNA 2NCKL 4OZLA 4YQWA 1HR0F 4KY3A 1FXXA 1DURA 3BDPA 4KGZB 2FHJA 4A4FA 1K1QA 3OFFA 2WVFA 2LNVA 2DZ9A 4WIIA 1V3ZA 3MR2A 1X5TA 2VKRA 1G3TA 1VQ9A 3B6BA 3G82B 4DV4J 1RI9A 2GHPA 2JM9A 3AODA 3H8YA 2A6OA 2J06A 1MROA 3W2VA 4QIWD 3AOBA 2FVRA 4C8QD 3S1TA 1GBRA 1AROP 3L1AA 3DI6A 1WXBA 1G4CA 3CULA 4XU1A 4LRFA 2LEAA 4KO0B 5A6WA 2B5JA 1PSDA 5KFQA 3P3DA 3OW2S 3T6BA 4KFBB 3IFEA 1KG1A 2FPFA 3V6DB 4KHMA 1IBMF 3R5BA 4ELYC 1VLYA 2VL1A 5BJRA 2MOXA 3LW5E 2KDSA 1RBLA 1NDKA 3GIBA 3K89A 1QKWA 2EPDA 3CE8A 2HS0A 5LM7E 1KFSA 3JQKA 3VS0A 4A63B 4M78B 2VYTA 4D3HA 1YI2A 2ZJQQ 5KFRA 4PJNA 2MQ8A 4MIWA 4M77A 2G1DA 2Z0GA 5G0RA 4DOVA 3M2UB 1VQPQ 2WVBA 3CVKA 5H1SV 1RXOB 2G1HA 1Y57A 2F5KA 1PYSB 2BX6A 2YBVA 4XTTA 4FXVA 2NS1B 3TZWA 2FYKA 5K14B 2AZVA 2J7WA 3CCSQ 1IM4A 2BOAA 4JI2F 5E41A 2KR3A 5EC7A 3BH7B 4KYZA 2XYGB 2BABA 1VQ9Q 4H4OA 1Y7PA 3LA0A 4X62F 4KAIA 4A4JA 2UU9F 1S6OA 4FM4B 4HEA9 4LF4F 4QBUA 3KNAA 2G0JA 5SZTA 3KJVB 1KP6A 3ZEHA 1ZUKA 4BWJA 2CQIA 2FGCA 4J91A 1NNDA 5CA5A 4BHQA 1QVFA 3LAMA 1ZPWX 2EJFA 2MLYA 3DLKB 2NXEA 1D1AA 1NJIU 4RW9B 1N36J 1QTMA 2OI3A 5B7WA 5G4DA 2M7SA 5IT9Y 3N0VA 4X84A 4TU7A 5K8OA 4WU3A 1YJVA 3TW0A 3WBZA 1XOVA 3TQ7P 3N6NA 2CSIA 1UA1A 3CPWR 4B9NA 3K7RA 1F5AA 2V1RA 3GR1A 3I55S 3JB9D 3HVTA 4HYKA 1S1VB 5D77A 4IUFA 1EX4A 2KB2A 4TN2A 1NPKA 5D6WA 5IAYA 5BYQA 1KTVA 2GTOA 2HMAA 2D9PA 5IQ6A 1S1UA 3WVDB 3LH0A 1TVRB 2P4RA 4QIGA 3C16B 3VAFA 1NJIC 4GVBB 1Q7YT 1HWLA 2YRVA 3VKIA 3MXHP 5LJ3e 4RTWA 1RT1B 3AA9A 5IT4A 2MQQA 2HLUA 3HKSA 2U2FA 2MSTA 1RHQB 3EJMA 1DLOB 4UTGA 4DFMA 2XO7A 3KMQA 1U8RA 4IQMA 3X26B 4DV0J 1AD5A 4JI7F 2LEPA 4AE5A 2BANB 1WGSA 5IXBA 2XMVA 2L89A 3ISZA 2R8KA 2ROTA 3TEEA 1K9MU 3G71Q 4JV0A 2MZ1A 1JXLA 3GLJA 4PFPA 5J2PB 4I6AA 4IOBA 1TU0B 2CQ4A 1V76A 3RU0A 1GH8A 3D66A 1FTCA 5THWA 4ZCKA 3MEGB 1VQ4T 2KG1A 2MKKA 3H40A 3BPDA 4J9FA 4OGCA 1R77A 1WWHA 4B3TF 4R55A 1QVFR 2OEJA 2HQFA 1NLPC 1K44A 4HTIA 5D6XA 2J9EA 1FMVA 1OO0B 4WWSA 4Q5WA 5SUHA 4YEAA 3OL9A 4TY8A 1AFJA 5DG7A 2B3TB 2NUUG 4MKBA 1VQ9S 4ID8A 3L9ZA 3B82A 2JNGA 2GQVA 3DM2B 2UVRA 1NK8A 2FY1A 3T6JA 4O0IA 3QZ8A 1MROB 4RNHA 5DDOC 1JJ2R 5GANh 1HD3A 4PRFA 1LPLA 1S72A 2GW8A 1GMWA 4WCIA 4DF4A 4A8XA 2AU0A 3CJKB 1X4AA 2EFOA 4NXNF 2QEXT 2RQ4A 2MKSA 1WF1A 2DR6A 1D1BA 2OUGA 3DKDA 1YJ7A 3AOCA 2IG0A 2V8VA 3C66A 2HVDA 2I2LA 5JVGQ 5EWEA 5CYJA 2IC3A 3A8GB 2BR0A 4C0HA 4LFCF 4OZNA 4HVZA 2OO4A 3ZZOA 2COWA 3VGSA 2CKKA 2BMBA 2HHTA 2GVZB 1U06A 2FRWA 1HQEA 3TYTA 3MP1A 4RJVA 3H0FA 5GAN2 2F65A 2QMWA 1MMLA 1OY9A 1AB8A 1FX2A 1HD1A 3EH2A 2LDMA 1TMMA 4XDDA 4C97A 1GCQA 4J9UE 3MEUA 3QWUA 5J1NA 2EKHA 5IT9E 4QPTA 2ATCB 4DL2A 1WG4A 4ZP7A 3H2UB 4X4RA 4PJOA 5GMEA 4E0DA 2EVZA 1VYAA 2AD9A 1VQ5A 1B0PA 1AWOA 1GFWB 3ZL7C 4LDVA 1H72C 2YH1A 1ZYQA 4LUEA 3NS5A 4ZJLA 2E5JA 1GMUA 2RD5C 4X4OA 2KYZA 1SH2A 3PY8A 1AZSA 3CC7S 2IFXA 3RR7A 3UD4P 1X6OA 1G3YA 5J2QA 3W5ZA 5B08A 4K4ZA 3IRWP 3JCMd 4NI2A 5L1JA 5BR8F 1RHMB 4BE1A 2C42A 3DNCA 3QT6A 4DL4A 5AJ3F 1HNWJ 3K0JA 2KXFA 3L09A 2K2VA 3CCEQ 4KGMA 1ZM2A 3EVOA 2G2OA 2VFVA 3AHUA 2CDQA 4CT8A 3MEDB 3CB4A 2W24A 2ZDPA 2FLLA 3O2IA 1S97A 7FD1A 3TQ1A 2V6AA 4FP9A 3ELHA 4FIBA 2QL5B 1VQOT 1VQ7T 4HL9A 1RTJB 3UPUA 4ELTA 1RB0A 2Y1IA 3MCNA 1L3SA 4QQ6A 1UZHA 1N5ZA 4BD3A 3QGGA 4GVBA 4I6WA 3QSUA 1TK5A 3OTOJ 4DMZA 2B9EA 3P45B 5DZ7A 1SF9A 5C42A 3FRZA 3DGVA 4ZP8A 1H74A 3DOLA 1M5OC 1N52B 1KHCA 2YNGA 1JNZB 2QL7B 1HNIA 2K5IA 4MFBA 3QJYA 5E0OA 4QU7A 2KVIA 4LF6F 2XEXA 1WHLA 2HHWA 4KT0C 3FRNA 3LWMA 2CFXA 1IBLF 2XG8A 4PG6A 2M0OA 3S3MA 2H9ZA 1NYFA 4ID5A 2CPDA 5DS7A 3X1LB 4P10A 3N5BB 2O01C 4CQ1A 4FF1A 1ZQ1A 4UUXA 2DNMA 4DI6A 5D6YA 1D0XA 4JV5J 1V5VA 2NUTA 5CD4H 3BB5A 1MHNA 2HQEA 2VG5A 3BKFA 4UC4A 1VRTA 3KLIB 2CT4A 1RAFB 1UVKA 1L3KA 1EJ7L 3GBQA 2CUDA 3M4YA 4K50A 3BQ2A 1YIJQ 4E7SA 2PVOB 3NAIA 2JMCA 3P8BB 1GEHA 2DRMA 1C4AA 1HQUA 2I9SA 1SSHA 3LUYA 4NOYA 2UXCJ 4NZ6A 2VBZA 4OHXA 2G13A 2OD6A 3PXGa 1JB0E 1RAOA 1HIYA 1G7CB 1F9EB 1C1BB 1CG2A 4OI6A 2LQWA 2ZHOA 3GWCA 3QPHA 4FU6A 1JLEB 2JM8A 3TP2A 4QYZJ 3HFNA 5GMKe 1GTHA 4ILLA 4QIEA 2CAJA 1FE0A 3Q8UA 1CJTA 4F3OA 3DHWC 4E8UA 4J9PA 4PWDA 1QY7A 1LWFA 1CKAA 4FYWB 1IBLJ 2DIQA 4C8ZA 1VQOA 1LWCB 2HWHA 1K9MC 2LU1A 4QYRA 2LQNA 1F60B 3TI0A 2F69A 2OMLA 1VQNT 4DU8A 2O4XA 3K58A 1NUEA 1PC5A 2E7XA 2LYVA 3UCZP 3Q1JA 3D6FB 2CQPA 3LP0B 2RM4A 3KK2A 2KK4A 1RLPC 5KT4A 2PU9B 1VC5A 4XO0A 2HKQB 4FPIA 3W1YC 4E7ZA 3CCQS 4F17A 5IN1A 4ECYA 1WSRA 4USKA 2CP6A 4I2QA 2O9SA 2CA9A 3OMGA 1QSYA 1UJ6A 1F3VA 4NL5A 1H92A 4OX7A 1U47A 5F9LA 2XYPB 4C8YA 2LNHB 3RRKA 3QFHA 3OFEA 3RUXA 2E10A 4RL1A 4AG2C 1QSSA 3EHRA 4RBVA 1SSFA 1QE1B 2ZEJA 3CW2C 4DN9A 4ZDNA 1F6TA 3BKTA 4JI0J 1IKWA 3LALA 5G0RB 4WXOA 2OTJQ 2R7SA 1I81A 3BFMA 4L5GA 2C2ZB 2BOPA 3IBWA 4ALZA 3IXQA 4DL5A 3OQ5A 3B78A 3HSJA 2F4VJ 3W61A 1X01A 1IJEB 5KFAA 3H0PA 4J9MA 5KH6A 2CNNB 1AOJA 3REAB 1VQ7Q 2B51A 4WIQA 3MFHA 3META 3CCRA 5ETPA 3JYTB 1P1LA 1N9RA 2I5JA 4LUDA 5CAAA 3RB0A 4X4SA 4O3RA 5F3ZA 4CH1A 1X9MA 2GO9A 2JVOA 1HW9A 1FO1A 1R0AA 4OZ5A 1HHTP 5F0WA 4ZIVA 2O4XB 4YR3A 3CCVA 5C42B 2Y3YA 2ZOFA 3G4SA 3ONQA 3S6WA 4M75G 3UDCA 2W1BA 2PQWA 1H6KX 4A8SA 3AA8A 1T3SA 4M5GA 5KFPA 2KGTA 3PMTA 3DDNA 4NEZA 1JEGA 1NLKL 3QJLA 3H0HA 1YITA 1NM7A 3PW5A 2QLBB 3M8RA 3OYDA 4CC7A 1WG5A 2LX9A 3W2VB 1L3VA 1J2VA 3IBCB 4ZN1A 3M9NB 4G3IA 4DQSA 1VA7A 4USUA 2OHDA 3QGPA 2XY6A 5A0YA 4I4BA 1FX4A 3FFIA 4DSEA 5K20B 3MP8A 3QLHA 1EIYB 3I9ZA 2PMHA 4ED7A 2VWFA 3I56A 2PE8A 3DB4A 2H5JB 2EGEA 2NYHA 1NPPA 2H4YB 1KKHA 1GT8A 3M53A 4UY85 4IFYB 2XGQA 3HKZD 1HWKA 1VFJA 4FDFA 1KHVA 4D6WA 4V1Ak 2HAIA 5CYMA 4O4RA 3KJFB 2GNKA 1T9VA 4JV1A 2G9OA 3SSRA 4ICLA 3CCES 2KO1A 1WF0A 2QT7A 2FJBB 5IZHA 2XS5A 1K8AT 5KYWA 1N6AA 4OX9J 4CLTA 2D1CA 1YHQQ 2DM1A 1XIQA 1LEOA 1RJJA 5CABA 2JOYA 1PWTA 4WFAQ 3M8ZA 2N3LA 1WSVA 2DTIA 3MM9A 3J7Z5 2PD1A 1NJZA 1WPYA 2ACYA 2BKDN 2ROGA 5F0UA 2VH7A 4LBPA 1RADB 3CO0P 3RKWA 5DG8A 5DDRC 2NZCA 2RK2A 1VJWA 1TFWA 3P8HA 2IRYA 2NYIA 4LSLB 1H0HB 1NBEB 2MKCA 2ZVIA 3I55T 5H9FJ 5C25A 3OUYB 2XMKA 2MLXA 4PL6A 2ZPHB 1X5PA 3LP0A 1D1CA 2DNLA 1N32J 5KFFA 1K9MR 5LJ5Y 1JXEA 4NRTA 4F4WA 2QFIA 4YP3A 3MTJA 4TXSA 1KLMB 3GIIA 2FPEA 3NCPA 5FLXU 2K5FA 3FGVA 3QJPA 3CCMS 1JJ2P 3P96A 2DHSA 4F0KA 1M2OA 3ULHA 4Y28C 4LIWA 3CC4A 4H4MA 4M78E 1TKDA 1KQSP 1XNQJ 3H2VE 2B8PA 4MZPA 2W2QP 5GAN8 1ZOTA 2F9JA 3VS1A 2GVZA 5GAMj 5IWAJ 4RUCA 4QWEA 2MPUA 2JNJA 3BY7A 2R2RA 1U2CA 4GKJF 3I4PA 2GMHA 5HK3A 3DC2A 3KTQA 4NLRA 1NK5A 3QT7A 3CJ5A 1KFDA 2GGRA 2Q1LA 4P71A 2UUCJ 1D9AA 1HWUA 4AG1C 4AUKA 3KKFA 2KRBA 1F1BB 1QDUB 1N88A 1KLMA 2Z4PA 1G2EA 2XKOC 3I56Q 4BWMA 4GBQA 3IBFB 2YRDA 3EGDB 4A8QA 2L3RA 3W2WB 1W25A 1Z9QA 3KLGA 2QO3A 1OPLA 1XQIA 1H641 1RAHB 1BBZA 1E7OA 3JYTA 1LXJA 2DPPB 4FF2A 3H42A 4QQDA 3C15A 2RE1A 4C5EA 5KG2A 1WI6A 1BI2A 2IM2A 3CCLT 2OPPB 1XJWB 4U8YA 2JLGA 2DJWA 4URQU 5M2PA 1TV6B 2R7TA 5JVHQ 2C3YA 4C8QG 2LCLA 2GQ2A 4NYPA 4HCZA 5I3QA 2DL5A 2K06A 1RT4A 1RT2A 1X2QA 1YSJA 3O8WA 2XQCA 1RAAB 2PFFB 4TU8A 4X64F 2D1XA 1FFGB 3M54A 1DJ7B 3VQTA 1YBUA 4K8RA 2CP0A 4EO8A 1NDCA 3P6YC 2KBTA 4BUGA 3CCMQ 4Q44A 1JLBB 1D0ZA 2WSFE 3L7UA 2LA4A 4HHHA 3R6GB 5B0GA 1H3HA 3TANA 4M7AB 4XU0A 3EDQB 1X2KA 4UZBA 2VA3A 1N5SA 1KN6A 5KYXB 4WE1A 3SQOP 1GMVA 3MD1A 1Q82T 1X5SA 1FXLA 5K8MA 4DFJA 2X7IA 4R5PB 3H0IA 4AFFA 1TAQA 3MGJA 3T5JA 2JXBA 5A0YB 2CS7A 1FK9B 2OTJS 4DV3J 2V1QA 1REVB 3R5JB 4DX6A 5GMKl 3QBYA 2ZDOA 4CH7A 2BYCA 4OYMA 3AJ2A 3BO4A 4J9BA 2DIVA 4DDFA 3MPYA 4I67A 1X43A 4OB2B 3RR8A 4ZP6A 4HT8A 3G8QA 3INZA 4YB1P 1QAIA 1M1FA 1SXLA 1RT1A 4QIVA 4WP9A 2VC0A 2HWIA 2LXUA 3W63A 4F7VA 1D3BB 4C11B 2EYXA 1JLAB 1N48A 4NX9A 2R7QA 4A4GA 1S7IA 2RA2A 2IRUA 4NI2B 3KDNA 3E51A 2GCXA 4CO4A 2MJNA 4ZVRB 2DNHA 4ZMMA 1VIFA 1OSCA 8ATCB 4QR0A 2HCKA 2HFNA 5T14A 2DHXA 2OTLT 2OH2A 4JJBA 1OYEA 1TKZB 1NM2A 2DK3A 4EBDA 2WB4A 1YRUA 2CREA 3A1PA 1Q7YC 2W2NP 2CH4A 4M77G 3CC4T 2MZQA 4XU3A 2R8IA 5IQQA 1C0UB 2PA8D 1W2BR 1OPKA 3BGUA 2JEFA 4OV1A 1JO8A 2RF2A 3SV3A 3JCMc 1DQ9A 1N0UA 3RG6A 3EAEA 2P2CB 4RG8A 3TAQA 1P27B 4WFXA 1NH7A 1SL2A 4JI6F 2A10A 4F7UF 4F4ZA 2K3YA 2R7OA 4QWBA 3MM9B 1KBRA 2XI9A 3OLBA 2L9WA 1QMCA 1U24A 4WTYA 1Q95G 1CPZA 3O6QA 1S49A 3CC2Q 3TSZA 2NUHA 3SMZA 2Z57B 3QT8A 4M75E 2WBRA 1PD1A 2ZH7A 3MMBB 1FJEB 4CO3A 3HZGA 1MV0B 4RTTA 4C92C 1VQLQ 3CGIA 4P75A 4ESNA 2O9VA 3KMSA 3R1HA 3G6XA 2ERRA 1XWLA 3WXMB 3GV7B 2ZOMA 4RW7B 4C98A 1CJVA 3B54A 2A2CA 1ZA2B 3GSIA 5E3AA 5I21A 1GFDA 3R6NA 3ZZPA 2ADCA 4F16A 4LSLA 2OSRA 3MHXA 3LD7A 1IUJA 3EG3A 3U1LA 2M8DB 1TUGB 2WOMB 2CQBA 1BCMA 3EG0A 4IH7A 2VXFA 2XCAA 3K5PA 2GS8A 3NP5A 1H8KA 3AQPA 1H7XA 3PGGA 2I0XA 3OSNA 2ASJA 3QBCA 4HR2A 4J9HA 5KFXA 3PFOA 1HNXJ 2FEIA 3TUIC 3VS6A 2XMWA 4QVCA 1IKWB 1SH0A 4YN3B 3V2UC 1XEZA 2AKLA 4Q2MA 5EN1A 3QXEB 5GAMe 1Y7XA 3UDEA 2EI5A 1FTRA 2HRUA 3VGUA 1LK5A 3CDWA 1KQSR 2QLFB 4ZK7M 2A3JA 3VYHB 4K5SA 5C7PA 1NK6A 4ZHRA 1IXKA 2E5KA 4A46A 2VA2A 3R1LA 4K59A 1V1CA 4GC7A 4B3SJ 1CSKA 4A54A 2I1RA 5CHCB 4PWUA 1RP5A 2ZH4A 5C0MA 4XAKA 2HS3A 2DITA 2RNEA 2E5LF 3EHQA 5GMKh 3EPGA 3MR7A 4A8KA 4CC3A 2JS2A 4DFKA 1I8FA 4IRKA 4L74A 4OYZA 4PXBA 3JSCA 3M0RA 2V5HG 3PYEA 2DHGA 4DL0C 4USWA 2HGMA 4IQXA 1Q81R 3I9QA 1PKUA 1TXQA 2ZC4A 1NEBA 4GO5X 2XO6A 1WIEA 4ZP9A 2KM8C 4TNOA 1HNWF 1RK8A 4EYHB 4YFUA 2KYMA 4CLSA 5KFKA 2Q6CA 1KQ2A 1KC8C 2KL8A 4I69A 3FJ5A 4J9VA 2F5TX 2DVIA 2CPXA 4MMOA 5CKDA 1I1JA 3DFEA 2E9ZA 2JN0A 5IFMA 3EFSA 3ISND 3A4TA 3SEMA 3NOGA 2GIFA 2GCFA 3DRSB 3M59A 1X0FA 3VAGA 3PW4A 4YDDB 4HH0A 3FQKA 3HHNB 4J37A 2LC4A 4UZCA 2YUQA 4HT5A 1YJNA 2M0GB 1O6XA 5HJXA 2BDPA 1VBZA 4PG7A 2LVMA 2DNNA 2MTLA 4UY8T 3KUFA 4ELZC 3QYYA 2HD0A 1QVGS 2HBPA 3IG1B 1OYXA 3FUYA 2QI2A 5KYXA 5EWFA 5E3PA 4JS5A 2LLZA 1FRHA 2OPRA 3GIMA 1CJUA 1YJ9S 1JX4A 3GIRA 2VXEA 4S0MA 1FJ7A 3OTEA 5CR2A 3GMGA 3OSPA 4B3MF 1BB9A 3NGKA 1HFEL 3BSAA 4EBEA 2ZZMA 1OWXA 4IR9A 1QM9A 2VIHA 2FVUA 4JI1F 2Z30B 1YJWA 1BU1A 2KG0A 5A0GA 1RE1B 3OBIA 2DRAA 3OYCA 1TOVA 4ANCA 1FDBA 5KG7A 1M3BA 3K5OA 3CCWA 3G9CA 2OAWA 2HAFA 3MEEA 3SZ2A 1SUQB 3UATA 4CRJA 2QX0A 1JLGA 3OXGA 1GAOA 1VYVA 1WC0A 2EG2A 2XDBA 2O01E 1RWOB 3FKBA 3TA1A 4A53A 3H4DA 5DLFA 1Y0HA 1Q86U 2EFVA 2CJBA 2ECZA 2BW7A 4FT4A 1UGPB 2KT3A 2DF6A 2EYYA 4NCGB 3GJTB 3KLEA 2KXHA 1M2VA 4IOAQ 3C6UB 2HND