1NPRA

Crystal structure of aquifex aeolicus nusg in c222(1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nprA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nprA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nprA01
3CD6T 1VQ5A 3I55T 3I56A 1SSFA 2LVMA 3CCET 3J80E 2JUFA 3G71T 5FLXE 1Q7YU 3CMET 1VQKA 4X34A 3CCUT 3CC2A 4YTLA 1M90U 1VQ8T 3CCRA 3CCJA 1YITT 1YBYA 3LGLA 4RG2A 2EXUA 2JOYA 3CXCA 4ZN1A 4TVRA 1N8RC 3CCMT 1K73C 1VQ4T 1Q82U 1W2BA 1NJIU 1VQOT 2XHCA 1K9MU 1VQLA 1KD1U 3CXCS 1VQ7A 1W2BS 1Q7YC 1M90C 1VQ9T 3CCLA 3OW2S 5HY6A 2QEXA 1M1KU 3LGFA 3DB3A 3CD6A 1XTDA 3G4ST 1RL2A 5DM7R 1K9MC 3CMAT 3G6ET 2MWOA 3CCQT 3OYYA 1KD1C 3CC4A 3HKSA 1S72T 3G71A 4CRIA 3LPEA 2QA4T 1M1GA 3CMEA 1VQNT 3CCUA 2E6ZA 2OTLT 1QVGA 1XNIA 3LD7A 3I56T 3KBGA 2JVVA 2DO3A 2JNGA 3J81E 1YIJA 1M1KC 3CCMA 1VQPT 5IAYA 1VQ4A 3EWGA 3H7HB 2KVQG 1BKBA 1QVGS 1VQ6A 3CCJT 2E70A 3CCEA 1YJNA 1VQMA 1KC8U 1YJ9A 3QQCD 3CCVA 1YHQA 2EIFA 3CCSA 1YJWT 1QVFA 1Q82C 1K8AC 1VQ9A 1NJIC 2OTJT 2KDSA 3I55A 1M1HA 1NZ8A 1VQ7T 2CKKA 3CC7T 5DLQE 1VQ8A 2L3RA 2K06A 3G6EA 1YI2T 1NPPA 1YITA 1S72A 2LCLA 2QEXT 1KC8C 3P8BB 1VQ5T 1KQSA 2MI6A 1VQNA 2IG0A 4ESNA 5IT9E 3TREA 2OTLA 1VQKT 4QQDA 1X6OA 3CC2T 3CPWA 1VQOA 3CPFA 1EIFA 3CC4T 3CCRT 1NZ9A 1Q81U 1KQSS 1VQPA 3A5ZB 1Q86U 5J3BA 5J26A 3LH0A 2KPPA 1NPRA 1K8AU 1UEBA 3CPWS 1KHIA 3PIPA 4OBIA 2G3RA 3JAME 1JJ2A 3PIOA 3J7AF 1VQLT 1YIJT 3DB4A 1YJWA 1QVFS 2OTJA 3DLLA 1VQ6T 3G4SA 1JJ2S 3CMAA 1YJNT 2MWPA 3CC7A 3CCLT 3CCQA 3OW2A 1VQMT 1YJ9T 1Q81C 1IZ6A 3CCVT 1Q86C 2QA4A 1N8RU 1K73U 2OUGA 5A2QE 3CCST 1YHQT 2LQ8A 4ZN3A 3ER0A 5LL6S 1YI2A
chains in the Genus database with same CATH superfamily
3THKA 4JRPA 1T9TA 5IS2A 2RMLA 3CJTA 4C0OC 5A0YB 1WACA 5IQ6A 2OTLS 3AB4B 1T9YA 4C8QE 1S1WB 2VBXA 2EW3A 3LTOA 4CO5A 2VGMA 1KJWA 3N5BB 2HNDA 5HANA 3OVAA 1CC8A 4RTWA 5KFVA 1YJWS 5FW9A 2HQCA 1CC7A 2OIHA 3RB0A 2HHTA 3BSOA 4QJVA 2QQAA 3V81A 1WXTA 1OEBA 2MWOA 3UR3C 1M3AA 1JB0C 5A0DA 4TYBA 2AGOA 5A8KB 1SPKA 2WZ1A 4U9RA 3DRRB 4B9TA 4KQZA 3UA6A 2F4VJ 1S10A 3CCWA 4B9WA 5B0CA 5IWAF 2J6SA 4ZVFA 1DZ5A 3ENAA 4J9IA 3Q8UA 1B34B 2LP5A 2HFZA 1OYXA 3FGVA 1CPZA 2HEQA 5B7WA 2B5JA 3D68A 1PRMC 3CCMQ 3BH6B 3SCJE 3MMCB 4DL5A 3RMSA 2WVEA 3KG0A 3CMES 2U2FA 1D9AA 3L2UA 4LF1A 3AH6A 2DA9A 1PSEA 2EFOA 3I55Q 3E1SA 3OHAA 4DCJB 5GAN7 4C3MA 3EYZA 2LCCA 3BN4A 3UVJB 2N4CA 3IBCB 2EYWA 4YDDB 1XK8A 2C0TA 3CCLT 3OW2A 4R8UB 4HT5A 3OL8A 2YX1A 3FEOA 2WOMB 4RU9A 2DVEA 3R5AA 2FHDA 2L8DA 3AA9A 4C92A 1HQUA 3BREA 1IR0A 4DA4A 3TJ9A 4X4RA 4DZ6A 1LWCB 1YNZA 3O44A 2DGQA 1VQLA 3ETOA 4YB7A 3L2ZA 3W5XA 3HFOA 4IDKA 5GANd 4P2SA 1A7GE 3QYYA 2ZD1B 2XD0A 4QQBA 4JS4A 1HPZA 3DLKA 5IT4A 5H9FJ 1UGPB 3GIBA 2OX7A 1SKUB 2LEBA 5J39A 5ECAA 1R6YA 2VF3A 3GPAA 1YI2Q 4Z7CA 2DIUA 2ECZA 4N76A 1C0UA 2CZVC 3J7Z5 1GAOA 1NEGA 2KM8C 2CP0A 1FJGF 2QRRA 3ILIA 3JSMB 4ZP6A 2D0QB 4XTVA 2YWGA 5B08A 2CZ0B 3TAQA 2AKLA 4M7DF 2NUTA 2ZC3A 2W2NP 2NS1B 3EGXA 3S3OA 1T9XA 3CCUS 2ZUGA 4C9DA 5D0HA 1V3RA 2FZCB 3TSWA 2JLEA 1JLFA 3RRKA 1S9FA 1IN0A 1MMLA 1FA0A 2CWKA 3MAHA 3PW4A 3PG9A 2GVDA 3IR6B 2ZPIB 2J5AA 1IQTA 1WEZA 2JVOA 1YBTA 2B56A 3I55T 4A47A 1G3SA 5GAGI 5KG7A 3G2XA 5E3QA 3G6VA 2A3JA 4YR0A 5DGBA 5GJVB 2DPIA 1I5OB 3H90A 1RU2A 1RA7A 2FC9A 4IG0A 2PFFB 1Q82U 3KK2A 2XSJA 4Q7AA 5IWAJ 1U09A 5GMKi 3C16B 5KFAA 1FJ7A 1S7IA 2K7JA 3BJYA 3EH1A 3PR4A 3VRZA 1N33J 3NHNA 3JRZA 3PVLA 1M27C 1MROB 1RT2A 3OBIA 3FJPA 3HSZA 1TS9A 5C42B 2BBEA 1VK8A 2JRSA 1XNRF 1VFJA 2VG7A 2VA3A 2RK1A 3OS0A 1Y96A 3BKTA 2ABLA 1KIKA 3PVQA 4FS2A 4ECRA 3ZO7A 3LO3A 3HFZB 2XLKA 5F8LA 2MQNA 4O3SA 2EYZA 4DWIA 3VTIA 3C14A 4OMPA 1YI2T 2VIHA 5CK9A 1OULA 1VQ6Q 4BI3A 3OYLA 3QO9B 1QD1A 4I7FA 5C24A 2KMTA 1JXMA 3NNAA 2ZGWA 3A8MB 1KVIA 1Y10A 2CREA 2JC1A 4KPCA 3ITHB 4C0BA 1SJQA 3DFEA 4E7LA 2HL3A 1P9QC 1HR0J 1KD1T 5CQXA 5KYUA 2DYAA 4P75A 3T1YJ 1ZA2B 2KT5A 3QT5A 4PJOE 2DNKA 3AXMA 1NYFA 1FWKA 5AXMA 3HRSA 1AFIA 5I3PA 3HVRA 2DL4A 3CDUA 4O0IA 5CKFA 4WJBA 4K4TA 5EUHA 4X84A 2F69A 2W2MP 4NS5A 5E3PA 4BACA 1S9EB 2XLJA 1OSDA 3PJWA 1FJGJ 1QVPA 3QDFA 1RCOB 2ED1A 3CUNA 4DQQA 4M7DB 2MMYA 5H9FK 2RQRA 3HSDA 3MKDA 5CYMA 2I0XA 1MHNA 5A6PA 1RT6B 3KLEA 2W9CB 3J81E 4JPBW 3CCMA 3INZA 2KRSA 2CQIA 2FUG9 1MU2A 3RDVA 3N4WA 3PMIA 3ZZUA 4HHJA 1N5YB 3GYXB 1LQ9A 4BWMA 1IBKF 3I55A 3C8YA 2BE9B 3I32A 3HHLA 3NMRA 3K7RA 1PG5B 4LD6A 3V8JA 5E41A 1N56A 3WC2A 3SB2A 1QDUB 2R2SA 1UEBA 1SHGA 5KFWA 4NEZA 4YMEA 2MKKA 5M9OA 1VQ6T 3UR0A 1S57A 2L3QA 4MTPA 1I6JA 2OPRA 1KRPA 4JI1F 2GJIA 4A8YA 3C6UB 3AJ1A 4LVOP 2DXBA 2ZUAA 4WU2A 1YBYA 4TQRA 1HBMB 3TP2A 1HBOB 3DM2A 3HHNB 3QYHB 3V7CA 4DQ2A 4GLMA 2PO4A 3MAAB 2DZ9A 2RRAA 4LRBA 3QGHA 2R5MA 3HPWA 3VAFA 5DQIA 1SL2A 3FFIB 4TVAB 4M78A 1S49A 1YCSB 4MKVA 1K9MC 1W26A 3FNNA 1FRMA 1MSWD 2DD4A 3HVAA 1S77D 1VQ7Q 3J7ZT 2Z0GA 1PRLC 5GMKj 2XC9A 2Q66A 3H25A 3OYJA 3MXHP 4M4ZA 2MQPA 4CWBA 4J9MA 4TY8A 4KFBB 1FT8A 1H3ZA 1ZLMA 2F65A 3RB4A 4M75D 4BBYA 3R2DJ 4IH7A 1JLEA 2RN8A 2BRLA 4RKUE 4RUGA 3H8YA 3DOLA 4R0KA 2J0WA 2VFRA 1XERA 5I42A 2AYBA 4RTUA 1VJQA 2XYPB 1HNVA 3W2VB 2V67A 2LQ5A 2WB1D 1C4CA 3PIOA 3JTPA 4CLKA 1H98A 3H0FA 3M0UA 2G0IA 1IKXA 2ZH2A 5GAN2 5KH6A 1Q7YT 2W01A 1NK0A 4FYYB 1HLWA 3KK1B 2VQFF 2JUFA 2GBQA 4YOEA 3GONA 2RQTA 3LGHA 2W2QP 1KBRA 3CC7Q 3A8KA 3J81U 5CXTA 1UCNA 1RHKB 1UZDA 4X4UA 4DSLA 5IV3A 4KGKA 1IBKJ 2RQUA 3CCJQ 1G3YA 3LGFA 3G96A 2CQ4A 2CNOB 2LZ6B 4DV3F 4NI2A 1WC3A 3N79A 4PXBA 4JB8B 2O1PA 2DD5A 3OXFA 3QXEB 2QJ3A 3MPWA 1ZHIA 2C3PA 1VQ6A 2LT1A 3MMAB 4XK8C 5CO7A 2RDJA 5KFCA 4JI8F 1UGSB 3V6JA 1Q82C 3M53A 3CCLS 1R0AA 1VQ7T 4P72A 4CLLA 3MUTP 2FO0A 2DERA 2KXNB 2F5TX 3PHTA 4JS5A 4JV5J 1OJ4A 1PYOB 1VQKT 2QSFA 5AE1A 4HVZA 4DJBA 4IH5A 4JV1A 4NYPA 4BS2A 1BU1A 2FZGB 4NLWA 4XPCA 1J27A 1E6HA 1RTZA 3WIUA 3MCNA 4KULA 4WU3A 3PKYA 3R5JB 4LDVA 2XY6A 4A48A 1Q7LB 1KQ1A 2FJAB 4LSNB 1JLAA 1NSKL 2EQMA 3QT8A 3MURP 1UFFA 1DJ0A 1WQWA 2NCKL 3D28A 1J3TA 3GQCA 3A4TA 3LF0A 4JI4F 1DBDA 2LMIA 1BQNB 4AXIA 2ZH5A 2DNHA 2ZVIA 2HFOA 2K3BA 1F5BA 2VG6B 4EGLA 2OJ2A 5GAOp 3M9MB 5GAOm 1I3OB 2FQQB 3PXGa 1S0MA 3EVMA 4C92F 5EX3A 1VRTA 1TUCA 4OB0B 3KTQA 1RAEB 3IAM9 2N3LA 3CPWR 2KVQG 2D9PA 1VRUA 3UCZP 3CCJT 1F5AA 2V8KA 5LMNF 1HYOA 2COLA 1JRIA 4OMOA 2K7AA 1S1TB 1Y5NB 4M77G 4LVNP 4X9DA 4V1Ak 1LK7A 3FRZA 1WC0A 1HNIB 2WCXA 2NYHA 3I55S 1U48A 2ZH3A 2EQIA 4RTVA 3P8DA 3EZUA 4IYQA 2NUPB 1RDRA 4OZ1A 1J5EF 2ZZNA 1WSVA 1KFZA 4KUDK 4X64J 5J1EB 1S6PB 2HQFA 2IYGA 2G3RA 2QL5B 3QJYA 4N77A 3IMQJ 3KDNA 1N48A 1QTMA 1RT4B 3TYTA 4OI0A 1N5ZA 2BQ3A 2IA6A 3CDWA 4M7AG 2KG1A 2LYVA 5KFDA 4ZPWR 4PFOA 1ZPWX 4BD3A 1R43A 4QCLA 3OHBA 1AWOA 4TVRA 4KSEB 5KCHA 1FD8A 4LRFA 1CEZA 4U8VA 2HNDB 3AT1B 1FKPA 3QZ5B 1SEMA 2Z8QA 3NTIA 1VQ7A 4JI8J 4ED4A 1AROP 4PYAA 3ELHA 4OVAA 4KAIA 4JI5F 4F3QA 4ED7A 2BJ9A 4LNPA 1S99A 1KQSP 3V81B 4ZVPB 1YI2S 3GIRA 4DU8A 5KFFA 2HHPA 4A8MP 3OBWA 2RQVA 3H0IA 3A8IA 3OR2A 2PSZA 3CCZA 1BCOA 3RZAA 8ATCB 4Y2KA 4A0TA 4ECYA 3SSSA 2P6SA 2Z58B 3MD3A 2MCNA 1R8OB 1U6ZA 3U1NA 4EI2A 2B5JB 1F9HA 1PGZA 1LWXA 2C2ZB 2D8HA 4RNNA 1FTRA 2X7IA 3MPDA 3TO8A 2CQ1A 1K1SA 3SD4A 1V9OA 1FDNA 1VQPA 1PJ6A 4IIOA 1JIHA 4ETXA 4XO0A 1NKBA 4ID8A 4E0DA 2RILA 5DM6Q 3DDNA 2RRBA 3EG9A 2H3JA 4URGA 3CC7A 2HWIA 1A6LA 1MV3A 2F8MA 1IBLF 1N5TA 2XMJA 2IMWP 1AZGB 2ESWA 2Y1LB 1X60A 1UB4A 4CM2A 1IHWA 3MEDA 1IKVA 1HQUB 2DIGA 3CCJA 4CC4B 2V8HA 2KJWA 4WP3A 2DK3A 3NAIA 2GMLA 3T1HF 4TYAA 1WJ9A 4ZHRA 1R8BA 1IWAA 4F0HA 4IDKB 2B9EA 4IR1A 4JI2J 4EU0A 2XO7A 3CD7A 2QO3A 2BE2A 4OYWA 5AXLA 1HPZB 4LDWA 2QLWA 2ZZMA 3DLKB 1BIBA 4E8UA 1TKZA 4KGVB 3IBFB 1J5EJ 1F1BB 1XN9A 3PHEA 1C0UB 2HVZA 5KG6A 4ZJQA 2DPPB 4ANEA 4IRCA 4AFQC 1EP4A 4IUTA 1TV6A 1VQ6S 2NUTB 1PJ7A 2GTOA 1D0YA 3EGXB 1G7CB 1Q16B 2PT0A 2EEYA 2ZE2A 5D0RA 3JSYA 3CSKA 4USJC 1C4AA 5CCAA 1K44A 1S7HA 4PPDA 1JLFB 2AKKA 1QSYA 4YR3A 1OPKA 2YNHA 3AOCA 2HQGA 4Y92A 3FDSA 3ETMA 1BMQB 3J7AF 5EHHA 2GVDB 2XB2D 1M3CA 4UOCA 2I2YA 1U1OA 1ZAVA 1MN7A 2DEIA 1UE9A 4UTGA 2IAJB 5DLFA 2QYCA 4DCPB 3PW7A 2LT4A 1IJEB 2DR6A 1TUWA 3QRQA 3BO4A 4IG0B 5KFZA 4YB1P 1HWUA 3MM7B 2JZ5A 4PG4A 1QM9A 1S0OA 3KK2B 5KFBA 2GA7A 3F73A 2XSJB 4EEYA 2YXYA 4PUOA 1VK3A 4DN9A 3JCMc 3CDBA 2GNCA 2AGPA 4DL4A 2B4UA 3IR5B 3SZ2A 4JLIA 2ROLA 1RT2B 4DX5A 2MQMA 3NAHA 3MO8A 2CSIA 4BE1A 1ZH5A 3PM9A 4MYUA 2VG7B 2DO3A 1U5SA 5D6YA 2RDDA 3AOBA 1YTYA 1OPZA 3Q86A 2LQWA 3P5TL 3W63A 3M8YA 5HVFA 1NRKA 4ECWA 5GAMf 4M78F 3C14B 1IBLJ 1FXLA 3IG1A 1VQ4Q 3WVDB 4I7FB 5C24B 2QA4G 4C8YA 4DR6F 2GS8A 1QVGP 3AB2B 2RU9A 4DV4J 4NA2A 3BW1A 1FDAA 1Y3JA 4RKUC 4DI6A 4YY3F 5JVGQ 5KFXA 4CDIA 5KYUB 2Z30B 5I2MA 2DY1A 1RHUB 3M32A 3HZEA 4EYHB 3LP1A 2MWPA 2RUGA 5FD1A 4A46A 3OJUA 5A2QE 2LQ8A 4X4VA 2IIMA 2CJQA 2E5QA 4C8MA 1O5JA 1CJKA 1E7OA 4FL6A 2WSFC 4ED8A 4DUYF 2MIOA 4ELVA 2ASYA 2EQJA 1XTZA 2VZ9A 9ATCB 2RH3A 3I56Q 3C15A 2H65B 2E1CA 1FDBA 1VQ7S 3E01A 1H6KX 1N54B 2BJ3A 5CYMB 1U1KA 4QOTA 4M7DG 3QLHA 1KG1A 5M2PA 2AEMA 1VQKS 2HFNA 3X20B 3LANA 4HDHA 3ZNJ1 3KLEB 3EVOA 3PX0A 3Q2SC 1U1RA 3TVKA 1MU2B 1M5HA 3FBBA 5L9XA 2FJWA 3WVEB 1DARA 3Q8VA 3C46A 3KLFA 2GCXA 4PXCA 3T9ZA 2A6OA 3CCEQ 3B4MA 1Q86T 2YH0A 2Z2MA 5B0BA 2O4XA 1VC5A 2K7KA 1SJ4P 1U1SA 3ZZPA 5HQ8A 3JCMQ 3EG1A 2XNRA 2V69A 2BUDA 4A8QA 3EXYA 3OW2R 2OPRB 2KROA 3L42A 2MYSA 3OTBA 2HURA 3CC7S 1M90T 4PEOA 1KVKA 5LJ3Y 1K8AR 2VC0A 2RI5A 1XMOF 3NWGA 2OTJQ 1T94A 1RUSA 2AJ2A 2OFHX 2CA9A 3HHTB 3CCJS 3DM2B 2HBRB 1S6UA 1K73R 4DEXA 4M78B 3WXMB 3WQPA 2KU7A 4USMA 1QY7A 2KTQA 2X4JA 5GMEA 1F9EB 4OHVA 1MG7A 3I56T 1QMCA 2HS4A 4YY3J 5DDPC 4TY8B 2JEJA 4M5KA 3SI8A 2CNLB 4FF3A 2C3UA 2V0NA 2DRMA 4ALZA 4DQIA 5IT0A 1ACMB 1JLEB 4M77E 1GFCA 2J0XA 1UFKA 2FB0A 1WHYA 2JTMA 3DOLB 1JK9B 5A2QU 2J0SD 1KQSA 4LFBF 5I42B 2DR7A 3LW5C 1U7LA 1HNVB 2WBMA 1PC0A 4DUYJ 4N41A 3L09A 2D1XA 3D6FB 1NPRA 2IM2A 2BE7D 2A28A 3JSBA 3Q24A 1IKXB 5CABA 2F2WA 3CCET 1TXQA 1EZZB 2RJFA 5KE2A 4M5NA 4QPTA 4UY85 3NEKA 4OHXA 2QYGA 2F7VA 3M59A 3GJTB 2EK1A 2R8GA 1SSFA 3OYCA 4M7AE 3H4DA 3TVZA 3JCMd 4J9KA 1G2BA 3HSBA 1WEXA 2IJRA 4A54A 5HMWA 2HHWA 2DL8A 2OH2A 2BOPA 2LU2A 3CTRA 5KFPA 4OJGA 2W4DA 5CCLA 2CPXA 3M05A 5KG0A 2V6AA 2XYHB 2ATLA 2EWNA 5D4NA 2B3TB 4XAKA 1OQKA 5KG3A 3M7VA 3NGUA 5D8HB 2DBMA 3BGRA 1U2RA 4B3TJ 1I1GA 4NI2B 2AZVA 4F67A 1VDHA 3CIMA 2A1BA 1U47A 3PFSA 1BQMA 4C8KA 4X65J 3A1PA 3MM6A 2YKMA 1OX9A 1X5TA 2PDAA 1VQ4A 2FHKA 1RT7B 2J6OA 2C2NA 2YUOA 2NLWA 2MAMA 4Z7YA 2ZJQQ 1BUXA 2VVKA 5FRNA 1OY8A 1R0AB 3EE3A 2K3IA 4JZ3A 2OPQA 2HHVA 2E9ZA 2YKPA 3SIPB 3PX6A 4MZTA 4FT2A 1R8HA 2HBYB 3MEVA 3PACA 3RKXA 2ZBIA 1NPPA 1JEGA 1XC9A 2ACYA 3M2UA 3CXCP 1EB0A 3CC2T 2NWMA 4WP8A 3OL6A 2BKPA 3NY0A 4HL9A 1ZUYA 4OP0A 1AWWA 2AZ1A 3PMTA 4C5EA 5AJ3F 3TVTA 5E7OB 4LF4F 3MP8A 2JMAA 3O5TB 4YDXA 4OYPA 1REVA 3AD9C 1TSFA 1K0SA 1JLAB 4ER8A 3I56A 3OS1A 3KXTA 4N4IA 1WOSA 2HQIA 4ELTA 2EBGA 2HD0A 1YJRA 1VOMA 4CZCA 4DUZJ 4XDDA 1UJ4A 2UUWA 1LWFA 3MECA 3ZFVA 2Q6CA 2CUDA 5M2RA 2P84A 2XLIA 2A2CA 4K0KF 1M1FA 4RW8B 3TR5A 3TW0A 3DHWC 2Y4YA 3QJLA 2AMCB 4DR7J 4RNMA 3M6XA 2AZSA 2AF6A 3HFVA 5HJXA 4XTXA 3H98A 4K4XA 2HNYA 4H4OA 4LFBJ 4F50A 1WEYA 2GJ2A 1KFDA 2L2PA 1VRTB 2BR0A 2CZ7B 4C8QD 1RUWA 1HWJA 1VRUB 2EGCA 3M8QA 3CBMA 1TAQA 1A0NB 1I51B 1SJFA 4K4YA 3CCEA 2AD9A 3ZTQA 3FBEA 3H59A 1WHWA 1TKXA 4F3MA 1GEHA 3VS5A 1RT1A 1LK5A 1NPKA 1NEEA 5DZ7A 3R7NB 2KAFA 4ZVHA 1UGVA 1YHQQ 8RUCA 3VS2A 5J3BA 2EFQA 5DLGA 5L9NA 2ZOFA 3GF5A 3RTVA 4DBQA 1RISA 3THTA 4EZ6A 5CCMA 5IHIA 3M0PA 1QQJA 3UCGA 3W7BA 5LM7E 7FDRA 4WIIA 2OTJA 1OYDA 4LF6J 3HX9A 4WFAQ 2AV5A 2AZ3A 3RGIA 3MMJA 1GQEA 1CQNA 4NZ0A 2LEAA 4ANJA 9RUBA 1LFWA 1UL3A 4DUTA 1OU8A 3G86A 1SL0A 1NDCA 5GAMd 1DFDA 3QGPA 2P9GA 4NLDA 2G2OA 1TQLA 4MZMA 1FKPB 2MLZA 1FXDA 2NSCA 3Q22A 3L7UA 2E1RA 4ZDNA 3C12A 1B64A 3HTRA 5K20B 1M5PC 2HBZB 1RT5A 2FD2A 5F3ZA 3GNFB 4I67A 3GR0A 2W1BA 2KXHA 5F3TA 5IT9Y 2LVWA 3OR2B 2MZ1A 5IZHA 5F41A 2YUPA 3DKMA 4AE5A 1TFWA 3AHUA 3FLGA 1KD1R 4C3LA 3H7HB 1ABQA 2YX4A 4ED5A 2ALZA 4IOBA 3NG8A 4LD9K 2YX7A 5AJ3J 5ETTA 2DL3A 4ZMMA 2CS7A 1ZBJA 3HF5A 3QMQA 2DE0X 4XU1A 1M5Q1 1UVKA 1QAJA 1X5OA 2WSEE 2ZC4A 3PTWA 1M9SA 5EDWA 1SQFA 1VQMQ 1YSJA 2WSCE 2POKA 2OD4A 4A8OA 4RUHA 1W4SA 3OYNA 4C92C 1KQSS 4Y2AA 3T6JA 1U06A 4Z37A 1WQ7A 4QR2A 1RQ0A 2R57A 4XU3A 1U1LA 1F3VA 4LF9J 3B6BA 1K0XA 3VAMA 3RERA 1IGQA 5CYQA 5I4MA 1NEBA 3D54A 2EFIA 1NE8A 3JCMW 1YHQT 3KG4A 3OA6A 1N34F 3RB3A 3UA7A 3I6PA 3MEDB 2M9UA 2RNEA 1IKVB 1EX8A 4XTUA 4ZGEB 3SFGA 3JCMX 4CC2A 3BV8A 1D1AA 2DF6A 3MEGA 2DXCA 3A3OB 4ZHRB 5L1IA 3MM8A 4X62F 3QIPA 2VDHA 1XOVA 2V8IA 3KJNB 2VPWB 5ETKA 3ILOA 3CVKA 2BE2B 4F25A 1XEZA 3BGFA 1CSKA 1TKZB 5GAHU 4LF8F 1TMMA 5GAMj 1U25A 2Z56B 3QT7A 1KS2A 3J7YU 2R7WA 3M6UA 4O23A 2IRUA 3QATA 4NMXA 1SKWA 1EP4B 1TV6B 4PJJA 3BPDA 5RUBA 4DSEA 2FHOB 3D5MA 1FESA 1XQIA 2ZE2B 1UZHA 1N9SA 4IRDA 2DYBA 4Y2MA 5LMUF 2EPIA 4WYWA 1KC8R 3X24B 3H2VE 1U3OA 3O3LA 5T7LA 4NWBA 1NBEB 4KHMA 2K3YA 3EXCX 4ITSA 4OBIA 2C22A 2JLFA 4K50A 1EHWA 4J9LA 2AIRB 4O5VA 4LF7F 3OQ5A 5J1NA 1VQMT 2DHSA 5HMYA 2NPFA 4K11A 2W4CA 2IPOB 1NSPA 5D4PA 3CDAA 2ZJRQ 5CAIA 1VHFA 4OI3A 3I56S 4NLTA 4ZLLA 3W65A 2CPFA 3UW1A 1YK9A 3G6EQ 1DRZA 2N7YA 2G6FX 2Y1IA 1Y9OA 1Y0MA 4PUOB 1UG1A 1Z4UA 2CPEA 2FG0A 4B9XA 4AL5A 4YP3A 1K4US 1CKAA 3FC9A 4I6AA 4PJOD 3O2IA 4OMNA 2V2QA 3TQEA 1CG2A 5IC6B 1JXLA 4MMKA 4FF2A 1I8FA 1M5KC 2N7CA 3VV2B 2PI5A 2AK5A 4CYUA 1T3OA 3QWUA 5DETA 3VF0B 1BKBA 3M8PA 2B4VA 3PYDA 1FK9A 4LUEA 2GC8A 1SHFA 4FCYA 1YHQA 3IM8A 1VQ9A 2WK4A 3KLGA 3CCES 2OSQA 4MIWA 3TANA 2P5VA 3IG1B 1QLYA 1X9WA 3R5CA 4B9VA 2NZCA 1XR7A 1N34J 1EQ0A 3SDZA 2BM0A 3QRRA 3D0GE 3K5NA 4B9NA 4DR1F 2OI3A 2L9WA 3JTOA 4G1PA 3RRHA 3M32B 5IQQA 1WHXA 4IFYA 2CQPA 3LP1B 3OSNA 3FSXA 1YJVA 3BFMA 4IO1A 3QYGB 1KQFB 2QAZA 5D6GA 3SCKE 3I82A 5GAEU 2KXCA 1Q95G 5ETRA 1CJKB 4B9SA 4LF8J 4C98A 2VJUA 4X34A 1Q82T 2KRMA 1RTHA 2BZXA 4C0DB 3CXCA 2HFUA 1SH2A 3BE3A 1DY3A 1F0XA 3MD1A 4LF2A 1N8RR 1U6FA 2UXDF 2H4WB 3QKJA 3ZZYA 3E01B 1N6AA 3R1HA 1RP5A 1H3DA 2JVRA 3MFIA 2VOPA 3HHLC 3QLHB 3MP6A 4P2FA 3MR7A 1VYAA 2R4FA 3G6ET 5LMUJ 1S9GA 4MT1A 4Y3CA 1ZM3A 3K5LA 3CC2S 5CA5A 2P6TA 3LD7A 1JNZB 2NYIA 4J9EA 5CD4A 1K1QA 1RKIA 4IIMA 4O3PA 2I9SA 1VQMA 2C2RA 4P7TA 3NCQA 1PBAA 4DQSA 2K79A 1GCPA 1ZZFA 3DOKA 4HVUA 2X35A 3KLFB 1UW9A 1V3SA 3OTOJ 4PXEA 4E6RA 3CEYA 2K06A 2J05A 4WE1A 1BWEA 1W25A 2DPJA 2WAQD 2O4XB 2KZMA 4WFXA 4ECSA 4PFPA 4F17A 5J2QB 4IRKA 2Y0SD 1APSA 3WX8A 2KEAA 2PI4A 2MQOA 1UPPA 2CZ1B 2YH1A 3FJ5A 3CJRA 5HQMA 3QDRB 4M75E 1Y4ZB 2JNJA 3ER0A 2XO6A 2A36A 2ZZTA 2M2BA 3EFSA 4EK2A 3HSGA 1WXUA 3QO3A 1RYRA 4ZPAA 1BY9A 1LOUA 3KHHA 4DR3F 4LFAF 2MZJA 4M5HA 3VGVA 1NJIU 1EKSA 3GU0A 1LVKA 1OQ3A 3THVA 3URGA 1T11A 1VBYA 4OZLA 3RIRA 2KI2A 2GVZB 4M78G 4NA1A 4KT0E 2GFFA 4MH8A 2NUZA 4J9UE 3FKBA 4NRUA 3HVTA 1UVJA 5CKBA 2QL7B 1WJQA 4DR1J 2F8EX 4DQRA 1QSSA 3RBDA 3JAMY 5CKEA 3CD6Q 4J8OA 2HPUA 4C5GA 3KHGA 5LSOA 5JMNA 2IVMA 4NLRA 4JBCA 2J6TA 4L73A 3TUPA 2FYXA 2X51A 3K2YA 1WHLA 2FHMA 4ZIVA 5I11A 3M30A 3RR6A 2DL5A 3LAKA 4D3HA 2CPJA 2FTRA 2JH3A 4DR2F 3W9HA 3NXZA 1VLYA 1PHTA 3QBYA 4Q5WA 2W7OA 5L8RE 1AT1B 2J0QD 1Q81R 2R42A 3TUIC 1G3TA 4L3NA 4WTYA 2ZPBB 5KFEA 2RHXA 3PRDA 2COWA 3MUMP 2F9JA 5KFQA 2HYIB 2XZDB 4L72B 2H48B 1IBCB 3S1TA 4AFUC 3JB9D 1D3BB 5HK3A 1O75A 2J7UA 4ZJOA 2HFVA 3D6HB 2DGOA 2HHSA 3PEHA 2PVOB 2XK0A 5U47A 2B9WA 3C95A 3BN7A 4HT8A 3BGRB 1YJ7A 1BQMB 2E41A 5DM7R 4NZ6A 3MM6B 1FWZA 2CPIA 2YKMB 1VMBA 3VHQA 2E6ZA 2F2XA 1OPLA 5J1PA 1WG5A 5KFUA 3MJXA 1N0VC 1XJWB 1OSCA 3K58A 4NPOA 2GQVA 4QVDA 1WSRA 2OPQB 2EIFA 3H0PA 4F4ZA 2MGZA 2EKNA 3PT9A 4DL2A 2KRNA 5C6SA 4PR6A 1YHQS 5DLQE 1BBZA 3M2UB 3OYBA 3WIVA 2ZCFB 1OZ3A 2EVZA 4FXWA 1EIFA 1YZ6A 2HS3A 5J26A 4MFBA 3HHKA 4N47A 2ROEA 2ZEJA 4S0MA 1REVB 1E6YA 4BLGA 2HEKA 5DS7A 5C2GA 2LVMA 2J9CA 4E7SA 5EWEA 2HSEB 2CYZB 1R89A 1LNXA 3AD7C 3MECB 2NQPA 3CXCS 3KLHA 2VFTA 1J5OA 1Q7YC 5IV4A 5LJ3f 2IBOA 5LJ3g 3DB3A 1FRLA 2HNYB 4H4OB 2GO8A 3UDEA 3EZ5A 2FPHX 3AFGA 1D1CA 5GVQA 4YEAA 1HJDA 4CRIA 2BZYA 3CB4A 4L74A 2IY5B 2LEPA 4XDCA 2QK0A 1RI9A 3TQ7P 3JB9J 3M8QB 2MY7A 3OYKA 2O9SA 3KUHA 1MNDA 1ZTWA 3ZZ0A 3DRYA 4DR2J 4ZCIA 4II1A 5HJYA 3ET6A 3TNVA 2DCLA 1TKXB 1VQMS 1QKXA 2RHUA 1VA7A 2YWWA 1RT1B 1GTHA 3V6DA 4QR1A 2QE5A 4HI1A 4V19J 1RACB 2FIUA 1U0HA 3MI7X 3KMQA 2CJYB 2IM1A 4FKXA 2Y8YA 4A53A 4PABA 4J9GA 4QW8A 3OTEA 2A08A 1NB7A 4M1KA 3I5SA 3GJQB 2YKQA 3GIIA 4UZBA 2OTLQ 2CNKB 1WOPA 4PKCC 1YBAA 2D3ZA 5D77A 4DV1F 4LBPA 3D3CJ 1PILA 4O4RA 2V34A 1JU5C 1UJYA 1L3SA 2AYMA 4U96A 4KBIA 1DJ7B 5L1LA 1MV0B 2ZNZA 4BI8B 4KE5A 5G0RA 4ECTA 1EQMA 4K7QA 1MGQA 2YWFA 2Y1JA 3U02A 3PE0A 1RT5B 2KHDA 5L38A 4A4KA 2ZH1A 4QVZA 1L5UA 3CD6A 2L89A 2Z2YB 4MDWA 5BXIA 3Q8PB 1BI2A 5HATA 3CW2C 4F26A 4I56A 4HTIA 1PSDA 1RTDB 1N36F 4GKKF 4XTTA 4GRSA 2DXUA 2PMZD 3UO0A 2VGNA 4FNIA 1X5PA 4OB1B 1JJHA 2DH9A 3QQCD 5EGYA 1FMVA 1H8KA 5LOQA 3CMEQ 1NJIC 2KM8B 3D7SB 2YKOA 4XIUA 3W66A 3IC1A 1HYSA 2BQUA 1KQSR 1VQ5T 5HP1A 1X27A 1Q53A 5KFOA 1YZ7A 4EDUA 2ZJPQ 2XG8A 4RBVA 1VIFA 5HROB 2QIFA 5F0WA 1K8AU 2DX1A 2CQ2A 4ZOSA 1UAWA 4FU6A 1PYSB 4FVCA 3TX0A 4JYAJ 1W6XA 5EG2A 5CYQB 4OI1A 2D0NA 3OVBA 2FEIA 1MMDA 5CH7B 4DV5J 4DLEA 2VPYB 1K73U 3GILA 1HQEA 3G6ES 5D6XA 2MKIA 4ZITA 4USVA 3EH2A 5DRKA 1JKHA 2B8AA 2DIQA 4NLOA 2ZBRA 1B3TA 3MEGB 3QJ6A 3MM8B 4RW6A 2P9CA 3GR1A 2V63A 3QIPB 3BQ2A 1HBNA 5A0LA 3R6LB 4QBUA 4ZVTB 1XMQF 2W25A 3TEGA 1IQZA 5HCKA 3CJ4A 1SVDA 2MKJA 2CKWA 2K1RA 1ZSZA 3CJSA 2VICA 2NUUG 4X4OA 1NK6A 4NLXA 4YB5A 2NXEA 4I2QB 1M1KR 4RCBA 4WXOA 3GTYX 5F9LA 1B0PA 2EQKA 4Y65A 4OMQA 4HI2A 2ZFHA 3C6TA 1KFSA 4W98A 2G13A 2CUYA 1S1XA 1QAYA 2LQNA 2BW7A 2UUBF 5T7LB 1D1BA 1YCYA 1B0VA 2V9WA 1QCOA 4J9DA 3PIPA 1IXKA 1BI0A 4YN3B 3HXMA 4WZQA 3MEAA 3TJAA 2XWXA 2X4YA 4MIAA 1YQHA 2V8JA 3P8HA 3DNCA 3PO5A 5KOWA 2JT4A 2CJXB 1EKRA 1X31C 3VAJA 5KYYA 2L3MA 1O0PA 2YBVA 2KL8A 5DG7A 3KWMA 4NL3A 2EFNA 4M75C 2BM1A 4Q5VA 1S72Q 3D2WA 4OB3B 2UUTA 4B3SF 4ES3A 2RE1A 1T9WA 2YNGA 2HAIA 4GKJF 5ETLA 3DXSX 3JV3A 5HMXA 3QIIA 4CNZA 5KFNA 2J7KA 4M78E 4MZPA 4UZCA 5MLCV 3FCWA 4ED2A 3NRBA 2O2OA 1KLNA 2BTTA 4CYUB 4UOGA 1QLNA 5THWA 3CWJA 5GANf 2HGMA 1FK9B 4DX7A 2HQXA 5GANg 2GAHC 3VVUA 3P6YC 4F7UA 4QU6A 2MPUA 3KLGB 2RQWA 4ED3A 4VUBA 2GJFA 1L3TA 1U1PA 3MOZA 2P0KA 1FEHA 2QLJB 3N6MA 1JQQA 1R31A 1Z9ZA 2R58A 2OTLA 1TFYA 3EGDA 3RBXA 1W2BP 5H9EJ 5F8JA 3FVYA 4IFYB 1L3VA 1YJWA 3KYLA 2XULA 2QMXA 4USIA 3I9ZA 3M58A 1B07A 3HP6A 3VV0A 5ETPA 3RBBB 3OYDA 3E8OA 1FEEA 2DBKA 3EHQA 1RTHB 1S1NA 4USKA 1QVGR 3M9QA 1HNWJ 2VUGA 5IXUA 5FU7C 7FD1A 3BGUA 4OYIA 4MJKA 4IFVA 3X26B 2HHQA 1I94F 1S72T 2WONB 1I81A 3CMEA 2XTJP 5FWCA 2UUBJ 4NXNF 4CLTA 3PNIA 2FZKB 4K4UA 1QCNA 1SUQB 4JRIA 2MLXA 3UFCX 4KUIA 3DOKB 1KDNA 3IWLA 1FO1A 3P49B 1S6OA 1SCJB 5CKHA 4WE1B 1BYMA 1YIJQ 3NKYA 2L3RA 2MQQA 2P0QA 3EFRA 2HAFA 2XMVA 1SH3A 4OI6A 2GTJA 3CCSQ 1HK9A 3GZ7A 4C5HA 4TQSA 2XM3A 1LW2B 2K2MA 2AQ4A 2O66A 2H1YA 1GK8A 1FFGB 2HHHJ 2WB4A 4GKJJ 2QTWA 3DLGA 3D67A 2IFXA 1MN9A 4X66J 3DLBA 2RJCA 3U1MA 2YWHA 3GWCA 1FX4A 3PR5B 2PD1A 5LSLA 3KNAA 2KSSA 3MR3A 4DF4A 1KD1U 4RX6A 2ASDA 3VGSA 3TA0A 3VS3A 5D6WA 2E5JA 4IH6A 2VQEF 4C0HA 4X4PA 2BKNA 2BVZA 1WD6A 1FJCA 1JJ4A 4ATNA 3ICLA 3M5AA 4M7AD 3HVTB 4KH0B 1VQNT 3AODA 3CCUA 5E5NA 4J9PA 2ZWPA 1ZBTA 2HLTA 3MMBB 2VL1A 4IUVA 1WGSA 1SV5A 3LH2S 3PYFA 4M5IA 3UE2A 3HT0A 1KHWA 4F0MA 3D66A 2D6FA 1FRXA 2UXCJ 5ETQA 2EJFA 3BDPA 2ILYA 4O3QA 3TZWA 5FLXY 1YDLA 3M30B 1F9FA 5H9EK 2KYBA 4G65A 2JX2A 3IO1A 3NCPA 2AWZA 2Y9HA 3UWNA 3UPUA 1YIJT 2MDAA 5CIUA 3V8LA 3OFGA 4DR5J 4B3MJ 4JI3F 3NGKA 1DQ9A 3NWRA 1H2UX 1Q86C 2J7IA 3CCST 5ETNA 3U7JA 3OMCA 2HFSA 1CVJA 4ID5A 1I94J 5LJ3j 2PEHA 5ADZA 4ETZA 2EGAA 2JEGA 4TXSA 4K4SA 4RJVA 2DT9A 3RESA 4DPYA 2C1EB 2C3MA 3RW7A 2V26A 5HK0A 4DPXA 1TK8A 3KUFA 4DU7A 1M90C 3L2VA 4LUBA 5IFMA 4QWAA 3ILJA 4PJMA 1GMWA 4EWTA 2IVFB 3VU3C 2HBPA 3MPYA 1SG5A 1JLCA 4NOHA 1VQ5S 2X1FA 3VGTA 3I5CA 4PNOA 2BYCA 2MZQA 4IUFA 1UWAA 3X1LB 1PD1A 2PTKA 4QYZK 1D0ZA 2AX0A 3FEXB 1KC8U 1R3NA 3ULHA 3RBEA 2MGZB 3H20A 3FMWA 4G6VB 4C8LA 4NLVA 2HQHA 4LR7A 2JTEA 4Y91A 3KKFA 2IVYA 4DR4F 4USUA 3D1OA 3THPA 2MQLA 5GAOl 1AUDA 3N6NA 1LV5A 4DBFA 1MWYA 4ED6A 2CADA 4FF1A 1X4BA 3GP9A 4LFCF 4OZ2A 3EGNA 2E9TA 3VS0A 1FTCA 4MMLA 2QMWA 4L5GA 2QC3A 4MFBB 2L9DA 4XTZA 2H54B 2R7UA 2W24A 5LXRA 1QVFS 1SKRA 2GCFA 4LDYA 2KB2A 2QL9B 3CT9A 1T3LA 5IHNA 5LJ5f 2VQEJ 3SYZA 4Y0FA 2IJNA 3PNWC 3IRWP 3UF4A 3S6EA 4Y28E 4OZ3A 4F4XA 2RQCA 2P4TA 3J7A1 3JTNA 3CXCR 2DJZA 4MAKA 4LE9A 3M4XA 5GAOn 1O9SA 1J5OB 1PM3A 1FE4A 3ASKA 4EIKA 2LC4A 4Y34A 3U27A 2RD1A 3UT1A 3FRNA 3BR8A 2K9GA 4LBIA 4UC4A 4ZLNA 3M9NB 2RVJA 3IQLA 4QVCA 5GAGU 4E7ZA 6AT1B 4KO0B 1RI7A 3H41A 3JCMb 1HNZJ 2LX9A 5GAHI 2LXUA 2UVWA 4IQXA 4OJHA 2JW4A 1K9MR 3F56A 2DTIA 2DNQA 2CPYA 4ZVOB 4J7FA 1NJWA 2JM8A 1YIJA 3R27A 1CJTA 1HNXJ 3JB9G 1OPIA 4YHHF 4OZ0A 3OPKA 4LR8A 1K76A 4O3NA 3MEEA 3ET6B 1XQHA 2MK5A 1WI8A 3CCSA 3DKDA 1BE4A 3UDLA 3V6DB 1DTQA 2CVIA 4RU2A 1U0HB 1EJ7L 3J80Y 4F4KA 4HTJA 1Q8KA 4LSZB 3I5BA 1QW1A 2Y0BB 2K5LA 1O8BA 1B70B 3TAMA 4BC7A 2GQIA 1PCAA 1G6BA 2MKYA 2ZOGA 1RHJB 2C28A 4K4WA 1KONA 3PRBA 2QGGA 3RJMB 1G83A 2QV6A 1N8RU 1FXRA 3I5AA 2CT3A 5HVGA 3PGGA 3SWNA 1IWGA 1VLOA 1EX4A 2ZM6F 2EKYA 3EZOA 2DL7A 5G0RB 1H7XA 1U45A 1E6VA 1QE1A 4DS4A 2A0FB 2XDDA 1W2BA 4HXJA 3BBFA 4O6JA 2ASJA 3R6NA 4RO0A 1KLMA 2L5QA 4CH7A 3JS9A 5ITHA 4DR4J 3OLAA 4DSKA 4NRTA 3R2CJ 3BYRA 2DXFA 2A7YA 5M2UA 4WFYA 3PJ9A 2MB0B 2PUKB 2JXBA 4R56A 3RUBL 1KOOA 3S3MA 2O5DA 1C1BB 1FWLA 4NLYA 4PAAA 4ZGDB 4PWDA 3E2EA 3HKWA 5BYRA 4CCHA 1PIEA 1X4AA 1OI1A 4JI6F 2C42A 2E3HA 3FRYA 1HYSB 1Q82R 2EBEA 3LWHA 5HP1B 2EBPA 4M7DD 1BK2A 2OAWA 3D1QA 3M57A 3S3NA 2H5JB 5F8MA 3DRSB 1D1UA 4F7UF 2BKDN 3NGSA 1IR1A 2RDIA 3US5A 3S01A 4TU7A 1NSQA 1IHVA 3FUYA 1HQEB 4H54A 3N6LA 2LECA 4R5PA 4DOWA 1DAXA 1S72S 1HD0A 3CULA 1JKHB 4PQUA 4WIQA 1RAFB 4ELYC 4F0KA 2QGFB 3DLEA 3TZZA 2X1GA 5BYQA 4RW6B 1JBMA 1OQ6A 2HVHA 3LQVA 3QAUA 3CIZA 3QPHA 1D9FA 1HBNB 2ZKTA 4KTQA 1U02A 1WKJA 1VJWA 2KVIA 4YB6A 2XWYA 3CCLA 5GANj 1CBKA 1QTNB 4WFNQ 5EWFA 4PLLA 2K1RB 3MM9A 2VHGA 3CPWP 2F5KA 2ZDPA 3HKZD 4IOAQ 1XR6A 3GOXA 1RAAB 1V29B 3M4GA 1CJVA 4P7VA 1HKAA 4KBMB 2O01E 2Y8WA 3L9ZA 4HH0A 2G1HA 4DPUA 3C6TB 2M1HA 2FPFA 3VALA 2UVRA 1S1XB 4B6MA 2EKOA 4RTYA 2PZ1A 2ZM6J 3FZBA 1WTBA 1Q81U 3MF5A 2KK4A 3P45B 2VODA 3I4PA 3TUZC 5BR8F 3NPFA 4M77A 3EG2A 2NXJA 4HCKA 3VYHB 3MM5A 2YT6A 2EFGA 1XIQA 4OI4A 5LSRA 5K8PA 3NTHA 5KYYB 4PWUA 2OEKA 3HPOA 4G1QB 3DOMA 5HBMA 1RE1B 3LALA 1P92A 5GJWB 2KT3A 5B0DA 2CSQA 2QA4Q 3HT3A 4UQGA 4IG3A 2LNHB 1FHTA 3SQGA 2LA4A 2HWTA 5CQYA 3D3BJ 2GZOA 4BDZA 3GSIA 4XTWA 4EUVA 1M8MA 2YQ3A 1DTTA 2VV5A 1F3FA 3A8GB 2MTLA 4MKBA 4FYXB 3Q83A 1FF2A 3NMZC 1S1WA 4EPCA 2CIMA 1AWXA 3KBGA 2CRLA 3LYIA 1WG1A 3LH5A 1CKBA 4N8NA 4LREA 4F7UB 3TX8A 5L1JA 3G6YA 1YIJS 4I2PB 2RPNA 5E2QA 3OYHA 1RA6A 3WC0A 1WC5A 1WIEA 2FGOA 1DLOA 3CCSS 2YHTA 2LLZA 3RNJA 4WTOB 4Q0BB 5DQHA 4WBFA 5A8KA 2RH2A 5KYXB 2RB7A 3EGDB 1JLBA 3CCRT 4J9CA 1H2TZ 1UEKA 3A3NB 1V1CA 1WI6A 3Q8QB 1GXLA 3JCMe 1XNRJ 4JJNK 2RHYA 4Z8AA 2BXJA 1WOOA 5J2MA 3OYMA 3E2UA 2HBWA 2EKHA 1GCQC 1YI2A 3C2PA 4EBDA 2FB7A 3G71T 4U8YA 1X75C 2B7BB 3HHDA 5KT5A 4RR5A 4RUBA 3CJ0A 3BO2A 2FJXA 4U95A 1W2BS 1RCXB 4IFVB 3A98A 3OS2A 4GVBA 2DHXA 1VQKQ 3CJ5A 3N01A 4RW4A 4E7IA 3VWSA 2E5HA 3DYAA 1XTDA 1D3WA 4UW2A 2QA4T 2B9YA 4ANCA 1UJ5A 1GFWB 4F2RA 5LJ5d 3MAQA 2ZBQA 2LDYA 2GHWA 1SH0A 1U6BA 2RT3A 1O6XA 1SIZA 2ADBA 1LKZA 1ICEB 2VYTA 1N88A 4DG1A 1P27B 4DPOA 3NFCA 2RQMA 5I2SA 3UI3A 4C97A 4AXJA 1PO6A 2J6FA 2CYYA 3MPVA 2B86A 2KFZA 2LQBA 3KDOA 2RJDA 3V6HA 2DNMA 5HN0A 3AQPA 4OGCA 1B4SA 3ILLA 4OYMA 3I0SA 1U2CA 1VQ8Q 1HI0P 4OZJA 4AD6A 2E44A 2XMUA 3I96A 2QTXA 3DLGB 2FHJA 4M5DA 3G8QA 4C8QC 2BACA 4BC9A 4CO2A 5FU6C 5J2PB 3NNHA 1GXIE 4PXDA 2IMOA 3QUIA 2MSTA 2KGTA 3KUEA 4CLZA 4BB7A 5E3CA 2PMWA 3RBZA 2JDJA 1P1TA 4A0UA 5C25B 2GGRA 5IXFA 3FSIA 4M95A 1G3OA 3VZIA 4WF2A 4ZLJA 3DLMA 4ZPTR 2J9DE 2G0JA 2ZH4A 4JI1J 2VC1A 4EMHA 3IAS9 1SV5B 3AY0A 5DQGA 3M0QA 3KFVA 1NHKL 1NO8A 5IM0A 1JB0E 1HWIA 1ROFA 3R6GB 3CEDA 3VAIA 3V4IA 2CKKA 1Y57A 3R8YA 1G3WA 3REBB 2DHHA 2CP5A 3OXLA 3OYIA 2HDAA 2MI6A 5C42A 1TL1B 4FW2A 5KOXA 1H92A 4DDFA 1Y71A 4GLKA 2G2ZA 4ES1A 4JJDA 3NOGA 1QKWA 2RF0A 2V2VA 2HHUA 1Y7XA 5GAMe 3RG6A 1X2KA 1RAGB 2QA4A 3BSCA 4ID5B 1ZS6A 3EJMA 4XU2A 2MKCA 5KE3A 1PWTA 2V9KA 1FRJA 5HSPA 3GIKA 3IGNA 1NJIT 1VQ8T 2JFDA 3J81Y 3ME9A 5IN1A 5D15A 3R3TA 5I3QA 3P96A 1HXDA 5JXSA 4J6WA 3OYGA 4JRKA 4IKFA 4IKAA 3VAHA 2PEBA 1AWJA 1LXNA 1TAUA 2HCKA 1RWPB 1JLGA 5A8WA 1M1KU 4QT7A 4A8KA 2E5KA 2VU5A 2ZKUA 4O44A 4CC7A 5KFYA 5FDLA 3CJKB 3FIFA 2KRRA 1X0PA 3JCMh 2JLGA 4J37A 5F8HA 3AHPA 3C94A 2VQFJ 1JQGA 5KFJA 4C92D 1QCFA 4KRTA 4ZNXA 4D8KA 1K9AA 1H72C 2HWHA 5IH2A 2F2VA 4CC3A 4MYTA 1LW0A 1ZTTA 2MF2A 2OFGX 1JWWA 3DLJA 3CDEA 1AFJA 2DXDA 2VH7A 4LRDA 2X1AA 3ADAC 5KG5A 2DK2A 4DV3J 3CPWA 1T95A 4CT8A 2DRDA 4DL3A 4M63A 2V2KA 1N5YA 2HVIA 3KUGA 3M4YA 2K8GA 2W8KA 4NXMF 2RUSA 4P2XA 3I87A 3UN5A 1AUSL 2CDTA 2M16A 4C2MA 4MK8A 1YRXA 1VQKA 4C8NA 1FVSA 3SXLA 3N9UC 2B0GA 4E47A 1X4CA 2XY5A 1ZETA 4C0GA 3EX7B 3H0HA 1SXLA 1V5IB 4GY5A 5HLFA 2KNBB 2EK6A 3DI6A 4ICLA 2R2TA 4JI0F 2X3DA 3JCMf 3BBBA 3W64A 2LJ3A 4LF5F 1U49A 2IRYA 3JCMg 3MTJA 4WCEQ 2E10A 2UP1A 2J7WA 4PZVA 3K59A 2MYFA 2RS8A 3SCIE 3CBOA 2UVVA 1B7TA 1CJTB 2CG4A 1QUPA 2AYGA 1UECA 1H73A 2ZAEA 3BB5A 5KT6A 4BE2A 3G8TA 1I07A 3GG0A 2BMBA 4RLEA 5DG9A 4LRAA 2E7WA 1HQ2A 1U8SA 4JI4J 3RYLA 2VB6A 4X1VA 1DTQB 2ZITA 1PNJA 4MK9A 1VQ8A 2RS2A 4F4YA 2KE9A 1Q8IA 2UU9F 1KVJA 4ZTFA 3TAMB 4DL7A 2FVQA 1PC5A 4ILMA 2IIHA 1TH7A 4QW2A 4FPIA 4KFBA 4C92B 3E51A 3KHRA 4PJOC 3NOCA 2EFVA 2E5LF 1RWOB 4HKEA 2B9XA 2PU9B 4CIOA 2JWNA 3NNCA 5LMNJ 4LQ3A 3OS5A 2PA8D 4KR0B 2RO0A 2PA3A 4EMGA 3QBCA 1YX2A 1E6VB 3U23A 1QE1B 4D6WA 1HBUA 4LSLA 4J9OA 1OU9A 4M77F 3MGJA 3UATA 4KGZB 5EWGA 4L76A 4I69A 3VKIA 2V68A 3TI0A 3TAPA 3KK1A 1Y3KA 2ILZA 4A4JA 4QQ6A 3BBCA 5KFTA 3ZXWA 2HNIA 1UKUA 3AOAA 3ISNC 5GAMh 3GV8B 1BCMA 1JLQA 2YTCA 3R97A 3HVWA 3OD2A 4BCAA 1UGQB 4RW7A 1TK0A 2WW4A 4TU9A 2LFVA 2BV3A 1EETA 5AE2A 1RKJA 4NMLA 4QIWD 1VQLQ 4NX9A 4JI5J 1M30A 1ARKA 3NL0A 2GIFA 4QQDA 4QWDA 3VVTA 4RUAA 1HI1A 3X25B 1X9MA 1JMTA 1YITQ 4CO1A 4WZMA 4HA8A 2DD8S 2QMUB 3D0IE 2LDIA 1VQOQ 2AJ1A 2JSXA 4R5PB 3BKUA 4LF5J 3JCMP 1UVNA 3W60A 4PQUB 1KTVA 2J8SA 2QA4S 1ZSZC 3HHLD 1EFNA 5K14A 2FJVA 2F4VF 4MDXA 2JJ4D 2VKRA 4OGEA 4E7JA 1UFWA 3GCXP 3VS6A 1Y96B 4M75A 4CH1A 2CXEA 2U1AA 4H4KA 4DN0A 1K0VA 1FNOA 3NP5A 3AA8A 4ZVQB 4A8FA 4A8WA 2HZYA 4ILLA 1OS5A 2V94A 3MM9B 1H74A 2LQKA 1WYXA 3C19A 1S4FA 3EG0A 2RHQB 5GAMg 1IM4A 1TELA 2UU9J 3UPFA 1D0XA 2VBZA 5ETSA 4RTTA 4PG6A 4Q8FA 2GW8A 1CJVB 1W7WA 1N52B 3O1LA 4O4GA 4M8LA 5CAAA 1T05A 2NPIA 1IO6A 2ZHOA 1ZM9A 4TNOA 3T1HJ 2GF7A 1M3BA 3ZL7C 2R2UA 5KYNA 2V8VA 4DV7F 3RB6A 2UUAF 1NM7A 4I6WA 3FSYA 2HQ3A 3V5RA 1FNXH 3M8WA 3BGOP 1AHJB 4M78D 4DSIA 4PG5A 4M5LA 5L23A 3NGDA 2DCUB 3CJ8A 1QP3A 2DO4A 4P74A 2D1CA 1U2FA 2XMMA 3BYPA 4M77B 3CPWS 3BZQA 2ATCB 1VQLT 1W70A 2M52A 2DGXA 1K73T 2RNAA 5E3RA 2VOOA 1KQKA 4XAXB 1TZ0A 4AL7A 4OL8A 5CHCB 1NHVA 1SSHA 1N5QA 1UDLA 1C1CA 3DOMB 5HBMB 3IWNC 2XHWA 3UDCA 3IS9A 2HG4A 3D1HA 3EGUA 4G3IA 1R0BG 1YITT 3OYFA 3JYTA 4U7CA 2A2DA 2YKNA 3CO9A 1HD3A 1CULA 3HLUA 4IG3B 3IBWA 1LXJA 1N6QA 1H7WA 1VQOT 3KOAA 3PRVA 3SQGB 1Y0HA 4KH1B 2JS2A 5KAKA 4PL6A 3GBQA 4ES2A 4F4WA 1NK5A 4K4VA 5HAOA 1DTTB 3LA0A 2KKHA 2DNPA 2CPHA 2HZCA 2V5HG 4C0ZA 2DR8A 1L3KA 4KGXB 1NJZA 3HHLB 1EIYB 1M2VA 5KCOA 2HZVA 2E1MC 2Z57B 4TN2A 3CCTA 2JJ9A 3SQOP 3M6VA 2XY7A 4CH0S 1H0HB 4CLSA 4F7UG 2FHJD 2WVDA 1VBKA 3H5XA 3GLJA 5DY9A 1ZAXA 1DLOB 3P3DA 4Z89A 4FKYA 1G8XA 1MUZA 3RAQA 4YQWA 5HKCA 4XK8E 3M2RA 4BDYA 2JZ2A 3HL8A 4K2JA 1JLBB 1VQ8S 5KFRA 1SRMA 3VRYA 1TL5A 2KYMA 4PYDA 4XQ3A 2CZ4A 3ZZOA 1N33F 1RWVB 4KHPF 1M5SA 5J2MB 1G2EA 3MPUB 5ETVA 1F60B 4P5NA 4NE9C 4WFBQ 1T3SA 3GFXA 4RG8A 3N0VA 1FYNA 1WHGA 2NUHA 4EMKA 4GMKA 1W2BR 1Z2LA 4DR6J 1K9MU 4GVBB 2KVQE 2RJEA 4RW4B 3CC2Q 3DYAB 3IGVA 1NLKL 2DGVA 4H4MA 4OX9F 3W9JA 1ZYQA 4CO0A 4DV7J 1D8ZA 2UUAJ 1UP1A 2W2PP 4RBUA 3REAB 1I0CA 5HI7A 3HK2A 1HR0F 1MMAA 2X9HA 4B02A 4F3OA 1Y5IB 2RHIA 3ZBDA 2JC0A 3T1YF 5DO2A 1ZPVA 1HARA 2YRDA 2IJFA 4DG1B 2QX0A 2YRVA 3A1YG 1NZ8A 1NG2A 4QIVA 4M5MA 1FXXA 2HW3A 2ZPFB 1YITA 1Y00A 2I1RA 1TKDA 2E3IA 3GE9A 4IO9Q 4EBCA 1VQOA 3M1VA 1X9SA 1ABOA 3I0SB 1QSLA 4QYRA 4JV2A 4L3KA 1YRUA 4FIBA 1VUBA 2K5IA 4ZCMA 3EG3A 7AT1B 4M5DB 3C4SA 2HRUA 3R9LA 4CTAA 4NOYA 1NK9A 1FWPA 2G2YA 2SEMA 5GADU 3DN9A 4W90B 2GGPA 3HSJA 2DNOA 2UXBF 2CFXA 1VQYA 1D09B 3SBMA 4KV8A 1YP5A 3CMAQ 1UJ6A 5HL7Q 3CCMT 3BO3A 4MKAA 4MKYA 3L7PA 2M9KA 3H2LA 1KTQA 5SZTA 2IAJA 2W7PA 2MJUA 3PIOQ 2MXYA 5JVHQ 4ZPDA 2I2LA 2F8HA 2D7SA 2ABYA 5KT4A 1WORA 1GMVA 4C0FA 2FVUA 4AFZC 4X4TA 3MM7A 4J9NA 3C66A 4ENOA 2QN6B 4ZVUB 5IM0B 1XMOJ 3VS4A 1JJ2P 3I31A 3CGIA 3EUNA 3V8KA 4WKYA 2V2ZA 1ULRA 4QKUA 5F9NA 3PVXA 3G7ZA 3V4IB 4KHPJ 3VAKA 1TU0B 1TR0A 4DEZA 1E6GA 2CP2A 5A2QY 2DGWA 2X3XD 1M2OA 2OJ3A 5F8GA 1R7IA 3P4UB 2GX8A 2O31A 3LWIA 3PV8A 5C2CA 4JJBA 1B7FA 6FDRA 2KR3A 2RHZA 2HAXA 1PAEX 4DBHA 3O8VA 2F9DA 1YWOA 4ZVRB 1YGYA 1YBUA 1FERA 1I1JA 1IZ6A 5J2NA 2ENMA 4OX9J 3PTAA 4FYVB 4N0AC 2CT4A 2E29A 3VJPA 2F1LA 1Q78A 5EN1A 2HIQA 4L59A 2DRBA 4FYDA 4UUXA 4ZVEA 1T9UA 3ZTOA 5A6WA 3A8JA 2ZZDA 3H9NA 2KYXA 3P5BP 1B99A 4EFAC 2KH9A 2BZ2A 3SEOA 1JLGB 3M2VA 5A8WB 3TCJA 1GH8A 4HDGA 2LXFA 1NSAA 4O44B 2OP5A 4XTYA 4OMMA 2HMAA 5FDLB 1KEKA 4A8SA 5F8NA 3CMAT 3OR1A 2RU3A 2HVDA 2B6AA 1FMWA 4I64A 2JVVA 3PCOB 3K0JA 2JNGA 2CGHA 4RW9A 2M7SA 1WF0A 4CLUA 5T41A 2DTOA 1ELOA 5D0EA 5D4LA 1LW0B 2EC0A 2KDSA 4W4MA 4DPWA 3MR6A 2K3XA 4J9SA 1RBLA 1LOJA 3M0SA 2E7XA 2CJAA 1F6TA 2XDBA 4DPTA 1YJNQ 3RKYA 4NLGA 2UXBJ 3QNWB 4F02A 1S48A 1VIOA 4G1IA 4ZKAA 4R55A 4U7UD 2XI3A 2EJ9A 1V3ZA 4DOVA 4J7IA 1WWHA 2ZDOA 3CJ2A 1T3NA 2Z2ZA 2L08A 1GRIA 2VDIA 2L3SA 3OTCA 2IC3A 1S1UA 1Y7PA 3VQTA 1SB6A 1NDPA 1ZOTA 2BQRA 3A8LB 3CC2A 1L3UA 1WF1A 3VS7A 2GMHA 3CCQQ 4O3OA 3RMQA 2XI9A 4DOZA 3FDRA 5HLFB 4RTZA 3AD8C 3DI6B 4ICLB 3G6XA 2CH4A 2HBQB 3OW2S 2YQ1A 4JV5F 2EC2A 2UV8A 3LWMA 4LF4J 1RXOB 2AEJA 4AT1B 3HKSA 2OLWA 1FMKA 4FXDA 5CZVA 1KC8T 4GO7X 3LP0A 1AW0A 2DNLA 1VC6A 1P8GA 4M75F 4EO6A 2E70A 1VQLS 2APOA 1Q8BA 5MAOA 4MMOA 1UHFA 1H641 2E12A 4UY8T 5AXNA 3EG9B 1DQ8A 2VONA 3H2UB 4K0KJ 1N5SA 4B08A 5FRMA 3QSYB 3SWNC 1WUUA 2QT7A 2ZPGB 3MDFA 3TREA 1YITS 2HIYA 1VBZA 3DU6A 1LCKA 8AT1B 3A5ZB 3MEUA 2HKQB 1VQOS 3UN3A 4C92G 4X4NA 4WP9A 3CNQP 3CMAA 1YJNT 3B82A 3EDRB 2QLBB 2OHDA 1X4DA 3FZ2A 3KMSA 2QDLA 4OYBA 5DJBA 1BIAA 1OYEA 3JSRA 3HFNA 4Q2LA 3NS6A 1ZZNA 2CQ0A 4AFFA 1HBUB 4LSLB 2RRNA 4M7DE 1YJTA 5GMKl 3BF4A 1HWKA 2K57A 2WSFE 4ZLPA 2EJGA 3TWZA 1VQPQ 1Y07A 4FZVA 3NGPA 1O51A 2YY3A 3OFEA 1AD5A 3V4MA 3E9FA 1YRTA 4N8OA 2IM0A 3QG1A 3CCQT 1AXQA 3A8OB 2EWHA 4A4EA 4X64F 2K3KA 4CLWA 5JUMA 5K9FA 2CG8A 4QR0A 2R5AA 3M6WA 1JLQB 3S7RA 3OYAA 1WKLA 3BDLA 4RW7B 1WZOA 2A18A 2YNHB 3CC4Q 2CH4W 3O6QA 3QT6A 1EETB 4F7UE 2JEIA 1B7YB 4P71A 1Z2ZA 4OMLA 3PZPA 3ENQA 2NZ4A 4ZP9A 3RW6A 2RF2A 3EM1A 3P8BB 1AZSA 1T03A 1D9DA 1X6OA 4K59A 4C8ZA 3B78A 1RT7A 3A8HB 3LP2A 3SDEA 2BANA 3X28B 3IFEA 1LJOA 1RWMB 2KFYA 3META 2MQ8A 4J90A 1Z1ZA 4ZPCA 3L2QA 1HMVA 2DO0A 3VZHA 1N8RT 2YNIA 1OMSA 2DGTA 3BKFA 1BGXT 3ZC4A 3GP8A 1WC1A 2D9OA 2QASA 4B3OA 5K14B 1OY6A 2C0OA 2VASA 4AG2C 2CPDA 1UEVA 1IGUA 1ZM4A 2DYIA 2EW9A 1GNKA 2JN0A 2EXUA 3G87A 4KB7A 1V6HA 3EAEA 4F4AA 1IR2A 3BS9A 4M75B 2XHCA 3S8SA 1X2QA 2H4YB 3GYNA 3FJ2A 3EPIA 1VR6A 4ZP7A 1Y11A 1Q7YR 1NK4A 2IHR1 3PEJA 4Y6IA 2FVCA 3PO4A 1U8WA 2DH7A 1VIXA 4E7HA 2I38A 3HJVA 1DHMA 4FDFA 2ZH7A 1WNEA 4J9VA 4JRQA 2P8IA 2DTHA 1VQPT 1YWXA 4O4GB 2WVFA 4M77C 1T05B 2FLNA 5KT3A 4J9FA 1YJNA 3NGTA 4RW8A 3VR1A 3JQKA 1HWLA 5LJ3e 3D6MB 1WJSA 4TU8A 1GMUA 4X62J 4DF8A 1HHSA 2DNNA 4OX8A 3CC7T 1R0CB 4TY9A 3UD5A 3ZNUA 4PG7A 2C3YA 4YR2A 2FLLA 2VPZB 2HKNA 3M54A 4ESNA 3HM9A 2ZPEB 1JJCB 2LJ1A 2Q43A 3CC4T 3MUVP 3CBPA 3CCMS 1NCLA 3I4HX 4JI2F 4KHRA 3V2UC 5DM7Q 1ZSGA 4DV6F 5F8IA 1TWBA 3LW5E 1JJ2A 1RWWB 4CQ1A 2AHJB 2QI2A 4M7AC 2I5JA 3OV7A 3C15B 3VUZA 3CCQA 1GBRA 1TL3A 2DR9A 2ZH6A 5B0GA 3K17A 2R7XA 2HQDA 1C1CB 5E0OA 2H5EA 1S6QA 3IS9B 3IXQA 5GMDA 4ORZA 2IBKA 3JYTB 1GCQA 4CO3A 2XICA 1JO8A 4NYZA 2CUBA 2YKNB 1CULB 4U7UK 1N6QB 1P1LA 3MZIA 2BA9A 1U8RA 1IBMF 2HL5C 1HSQA 2JM9A 4C3KA 5IHKA 5FU7B 3G8SA 3HI9A 3MOJB 2Y4XA 1UA0A 4LF7J 1T8EA 1WHMA 2L3PA 2RKIA 1M2VB 3LPYA 2CQCA 4CM0A 4R0JA 1T02A 2O67A 3CJQA 3UD3P 2MMPA 4OYAA 2XYGB 1VQSA 5LJ5Y 2B43A 1RAJA 2RAQA 2B51A 2RM4A 1RU1A 2M4MA 4LDXA 3OFFA 3OBYA 3M2RB 1NJIR 2NREA 1SBRA 1Q81T 2CWXA 5KFHA 4WYLA 4K8RA 1U1MA 3D9BA 3PW2A 3DCAA 3OYEA 2YPYA 3AAWB 1N4LA 3O8WA 4RL1A 5HO4A 2R7TA 4BY6B 3H5SA 3M0RA 2HNZA 1SQGA 3W3SA 4YFUA 3Q0AA 2QTVA 1YG0A 1FX7A 1RZMA 2C2OB 4J9BA 4J5YA 4X4SA 3CMAS 4PRFA 5A76A 1C0TA 4C8QA 3GFHA 2XU8A 4EMKB 4F14A 2JOYA 2MY8A 3MWBA 2PIIA 2K5FA 1WI7A 3K8WA 4D8DA 1SPBP 2LXIA 5GAOr 1CSJA 4RTXA 4H4MB 2OELA 3T5KA 4DL6A 3HJFA 3CC4A 4DV4F 3RAXA 4HYKA 2PE8A 1OOTA 1SJ3P 3VGUA 2MJNA 4OQJA 3HD1A 2XGQA 3EWGA 4B9LA 2DXTA 1TUDA 1TKTA 2KY9A 4DSJA 4Z2XA 4DV6J 2CJ9A 2K4YA 2DHAA 1TTHB 2W9BA 3Q8YA 4PLIA 3W62A 2UXDJ 4Q43A 4OYZA 3G6EA 2R8HA 1FKAF 3M1VB 2WVBA 3I0RA 4FN5A 3LWLA 2DH8A 2GNKA 1M4ZA 5ETOA 2OO4A 4QIGA 2GQCA 1RHMB 4ZVSB 1IBMJ 3R1LA 2EAYA 1TUGB 4Q2MA 4ED1A 4J5OA 4CTAB 5GAN6 1X69A 5IOLA 5CZXA 2GGPB 4E2FB 1OO0B 4P2MA 4ZIWA 3TEHB 4KV8B 5LJ3h 2MZTA 2F63A 2X3GA 3LGLA 3EVWA 2MHEA 3GIJA 2LCWA 1AZEA 1QVFP 1KN6A 3F41A 2AX1A 3JB9I 1FKOA 4RNFA 3DU5A 4WWSA 5SUHA 1A9NB 4LJMA 3K89A 3MCSA 2F3JA 3T9NA 2CQDA 4HVVA 1WHVA 2LNVA 4J6YA 1FRHA 2QQSA 4ATOA 3FQLA 3H42A 1RLPC 2PFDA 2WSEC 2P2CB 2VKZG 1PKSA 4DR3J 3KLIA 5KG4A 3MCMA 2QQBA 4LFAJ 4ESRA 2NLUA 1U24A 2W0ZA 4N4GA 5C0MA 1YJNS 2WSCC 1ITPA 5DZ6A 4WFZA 2OPSA 3MEKA 2DEQA 3C0CA 1NKEA 3IA0A 4RCCA 1NB2A 2D3OR 1ZA1B 5KFSA 4DHVA 2PVGB 2DR5A 1NZ9A 5GANe 2RSQA 5D4OA 1C0MA 1RB0A 2E66A 5D3GA 1KKHA 2P4RA 2F1FA 4Q45A 1LWFB 4C92E 1IKYA 1JJ2S 5J2NB 2JS0A 5LXYA 3HCXA 1RT3A 2O88A 4PK4A 3T19A 3CCQS 1NDLA 3UN2A 3PFEA 3UWTA 3NCRA 4ECXA 3ZZRA 3FQKA 1UUEA 2XEXA 1BQXA 1F2HA 3UDVA 2DNGA 1VQ5Q 1NMEB 1B0TA 2RD5C 3M2VB 4M7DC 4ZJLA 2M3DA 2F4FA 4OLPA 3OR1B 3R7SB 5DLOA 1NDKA 2B6AB 2P9EA 4U67Q 4FF4A 4LRCA 3AQOA 3JCMJ 5F0UA 1KWMA 4OMFB 2FY8A 4QWBA 4ZVGA 2H3EB 2YXLA 2DVIA 1HI8A 1OY9A 4RW9B 2XZTB 1SF9A 1JXOA 1ZM2A 1RWNB 2R3VA 2HGNA 3M9OB 1HHQA 2FL7A 2G0CA 4R25A 4K4ZA 5KT7A 2P0PA 4ZGJB 3BM7A 4V2SA 4AUKA 4FBTA 1YJ9Q 2Z2LA 2CPZA 2ZHAA 5K8MA 2PNIA 1RSCA 2FY1A 4ANDA 3POTA 3DC2A 3H4BA 1FDDA 2VBYA 2KI7A 2DHGA 4B3TF 2QSWA 2LX7A 4PJOA 4X65F 3G1JA 3SSRA 3M8SA 3RR7A 4ZPVR 2ACMA 2IC3B 2OUGA 2OMOA 1BI1A 1S1UB 1BHNA 1HW9A 4M94A 3UNGC 2Q1LA 1NNDA 5J2QA 3TSZA 1W2IA 1FVQA 4WK1A 3R5GA 2X1BA 3J81j 2FLPA 4RG2A 1VQPS 3CD5A 3QJJA 1OZ2A 3N28A 1XWLA 3D6TB 1VQ4T 4X4QA 2V4JA 2FRYA 1VS3A 2EFPA 4FP9A 2DY9A 1M1KT 3OY9A 5A0GA 3L95X 4DX6A 1KQGB 4DSFA 5C7PA 3LGMA 4U6PA 5HY6A 4OLOA 2CQBA 5B0FA 1FCAA 2AJ0A 4KRWA 2D3UA 5L46A 1KK7A 1Q8LA 1WDDA 3V7SA 3ZZZA 3T5HA 2DB1A 3KK3A 4DL0C 3LP0B 2KYZA 3CC4S 2DGUA 5LT5A 2QEXQ 2BOAA 1HD1A 2JMCA 2MZRA 1U1QA 3HRUA 1GX5A 3L2RA 3BR9A 2QYZA 2GVZA 1RABB 1BC6A 2JFKA 4USWA 3OFHA 2DKOB 1ZQ1A 2K6DA 2YUQA 3A3PB 1U4BA 2OPPA 5IT9E 3TA1A 2A3LA 4DUZF 3NMAA 1SQEA 4OZ5A 1IVZA 2DILA 2XDPA 1S12A 3MHYA 4RNOA 4NLUA 3MP1A 2BRKA 2DNZA 2EGEA 1RLCL 2V8DA 2ZVSA 4DR7F 5BYSA 1KR4A 4BHQA 4J7CA 3PKMA 1YJ9T 3G9CA 1VRQC 1JXVA 2M88A 4ZPBA 4OFZA 4RZRA 1Q86R 1UVMA 3RRGA 4OIXA 1CS4A 3VCDA 1MNEA 2RA2A 1Q5VA 3QWYA 1PKUA 1RHRB 4C5IA 4J83A 2RMOA 2AEFA 2BJDA 3NS5A 1M90R 1UGRB 5GANh 4KIAA 2BZ8A 2PQWA 2XMWA 4DV1J 3EGZA 4XU0A 2LDMA 2XCPA 1D3BA 1UJ0A 1M8VA 3R6OA 2MZSA 3M0TA 2N82B 4ERDA 4LF6F 1Q0NA 1NAQA 2IM3A 2HZAA 4NLQA 3GJSB 2DNYA 1I4K1 1NXIA 2OTJT 2Y1RI 3H6ZA 5DGAA 4MK7A 4OF1A 2XQCA 2RF2B 2C2KB 3IN5A 2CDQA 1AZSB 1T03B 1RAIB 3HFKA 2QEXT 1WKKA 2E5IA 2PVDB 1CJUA 2HSPA 4LBHA 4Y2CA 3JQJA 4AQYF 4A63B 1TG0A 2EI5A 3LP2B 2Q6BA 4ZA1A 3TU4K 2BANB 2DZCA 3SDEB 4DZDA 3W61A 1XR5A 4OHYA 1UHCA 1N36J 4GKKJ 3OTDA 3R7BB 1HMVB 4DBRA 2YKAA 5DDOC 1M5OC 4H4KC 2YNIB 2E64A 4NZ7A 2VD3A 2R8JA 4LUDA 4NCAA 4EO8A 3ZTRA 4B3OB 1X7VA 3EMTA 1VQ5A 1T0HA 5E3AA 3UCUP 4QQGA 5BJRA 1XBWA 4LIWA 3NTKA 3EFOA 2IDLA 3DMJA 3TVYA 3OSSC 2EYQA 4CLFA 3DLLQ 2QQRA 3J7AN 4HHHA 4ZN1A 2XI2A 1RGVA 1S1VA 3M8PB 5D7UA 2VFVA 4M75G 2EG2A 1BXNA 2RQ4A 4KT0C 3ZEHA 5LJ5e 2JHEA 2YNFA 2FJBB 2E65A 4C8QF 2ZNYA 3I9V9 1TL4A 1OX8A 3OUYA 5IT9U 1XNIA 4LF9F 2LKZA 2DVJA 1TOVA 2BUNA 3DGVA 1PYTA 2PN6A 2WBRA 2MKSA 2ASLA 1YJ9A 2X4WA 1UEUA 4F7VA 1K1ZA 2J9DA 4NCGA 1N32F 1QVFA 1S59A 2R9LA 1SI9A 1XMQJ 2VFUA 4JP8A 1R77A 1FNMA 4PQAA 1H2VZ 4IQMA 4DFMA 1TVRA 2DRAA 4DEYA 3W5ZA 1P6TA 2NXNA 3VYGA 1KHIA 2GO9A 5L8RC 4PWWA 4I0WA 1LEOA 2I5JB 1UA1A 1VQNQ 2XCAA 1TL3B 2NYSA 3TARA 3E3XA 2E1HA 1U0SA 1S6QB 5GADI 4I6YA 1VQ9Q 4NEYA 3LLRA 2SXLA 1VCTA 3HMJG 3FMBA 5KG2A 2ROTA 1S9GB 3C3LA 4OJ3A 2ALYB 2CAJA 2XMKA 4MIBA 1BB9A 2E4HA 2DNUA 2CQ3A 2FRWA 1KSPA 2UUCF 2V8GA 2B7CB 3OL9A 3TRGA 3MR5A 2QEXA 2RIJA 2RKIB 2FVPA 1X0FA 2GMJA 1VYUA 1FRIA 4OZNA 1M1GA 4RNHA 4AQYJ 3K5MA 2DM1A 2RB6A 1QVGA 2YVSA 4ZCLA 1RWUA 4BY6C 2QA2A 2BABA 3QZ9B 2XZWA 1PAUB 2QDYB 2JTFA 3LUYA 3GIMA 2ZH9A 4B3SJ 1SIWB 1VYTA 1NM2A 1GXUA 1AVZC 3FBCA 2RI3A 1KHVA 2H9ZA 2D9TA 4JUVA 1XMBA 2LCLA 1N0UA 4J6XA 1NH8A 3IR7B 1RTDA 4C11A 2HLUA 2G1DA 4EMKC 2E1AA 1FD2A 3E19A 2ADCA 1RWXB 3QAEA 3DRPA 2HNZB 4FXVA 5ETMA 4HH1A 3M8ZA 3CE8A 2HK2A 5AXKA 5K8OA 2AP6A 1K8AC 2VJVA 1QP2A 1YJUA 4A8XA 1C0TB 4C8QB 5FU6B 4CLYA 2H5IB 4EYIB 2COZA 1S79A 3B4DA 5HROA 4F16A 1K73C 1X4EA 1IM6A 1QUVA 2KXFA 1RAHB 1HW8A 3SEMA 4DMZA 2ROPA 4UF4A 1N32J 4Y2IA 4PJNA 1VQ9T 5KYWA 1U1TA 3OYYA 3SCLE 4CI0B 4QZVB 1DURA 4V19X 2V4RA 4KPYA 1RK8A 3OSPA 3PYEA 2C0IA 1HL6A 1J2VA 5IAYA 1TKTB 1T0JA 2M02A 4C48A 1X5SA 2V1QA 1K0TA 1IKWA 2ERRA 1BI3A 4PKDB 5AYFA 2RQKA 2W9BB 5DDQC 4JOUA 3TA2A 2V4QA 4ECQA 5D0GA 4KKOA 1WNLA 1S72A 2E5GA 3SV3A 5FIIA 3CCVQ 3I0RB 1U1NA 2RJZA 2XS2A 3LOUA 1SC6A 3QJPA 4I2QA 1VQ4S 2YQ2A 5LJ5h 4NXNJ 3A13A 1IJFB 3JAME 1MMGA 1TUVA 2FLOA 3DB4A 4KY3A 1NLOC 3DLLA 4IR9A 2UUCJ 5H1SV 1Q4RA 4ILRA 3NBPA 2WHOA 2VG5A 3LX7A 1Y5LB 2M8HA 2H8HA 2YWEA 3RU0A 4N0AA 4LMZA 4HVWA 2L41A 4EZ9A 1K9MT 5FROA 2GHPA 3T1AA 4DV0F 2NR0A 4M5JA 2VPXB 1FKOB 1H38A 1WFWA 1LWEA 1H3HA 3CF5Q 4PJOF 3OTOF 2DBBA 4L75A 1IB8A 3E9GA 2VKNA 5LL6d 3RAMA 5I3UA 2BJ7A 2GIRA 3ZTPA 1FFSB 2MHNA 3OT9A 1B3QA 2YDLA 3A8EA 1AEYA 2EYXA 3KLIB 3IP0A 3IWXA 2Z0WA 4FVMA 4IOCQ 2LRQA 2BJ8A 3KHLA 2AHOB 3N5FA 1YJ9S 1RWKB 3TJ8A 2OPSB 4OJ1A 3PDNA 5KG1A 1E6YB 2ZWOA 5KFKA 2KZZA 1VQNA 3QGIA 1GFDA 2IG0A 1NLPC 5LJ5g 2IDEA 3OQ2A 3BSNA 1F2GA 3BH7B 5GAN4 2DIVA 2VC8A 3ZTSA 1VBXA 2WW8A 1ZBXA 3D0HE 1SL1A 1IXDA 2DLPA 1JJ2R 5D3GB 4OV1A 1IKYB 1R6VA 4FSXA 3EPGA 6FD1A 1UWBA 3KLHB 4N4HA 2X3WD 2D8JA 3H5YA 3W1YC 2BJ1A 2XMFA 4IUQA 3CCVT 1RT3B 2N4DA 3WZ0A 4QW9A 2LJ0A 3QZ7A 1SC3B 3H8ZA 2GQ2A 1Q7YU 4F36A 1U26A 1TL7A 2GV1A 3GLXA 3G4SQ 3UQSA 3ISND 3Q2TC 2VA2A 4JUZA 3J7YI 4OI2A 2XG8D 3W8GA 1TMJA 2A10A 1N5VA 3M55A 3DHXA 1RBAA 2OTJS 4IUUA 2HQEA 2MSSA 3EGWB 2AJQA 2A37A 2DAQA 1UTAA 2AT1B 1WG4A 3ZFJA 4JI3J 1URNA 2QEXS 2DKGA 1RBOB 2FVRA 1RAOA 2C2EA 2LP4A 2Q79A 3FEZA 1UVLA 4N56A 4OMFG 3MEWA 2M0YA 4NLSA 2W4PA 1QVGS 2CNNB 1X6GA 2CZ9A 2KN4A 4EBEA 3H5UA 3JAMU 4ELUA 4JJCA 2GAGC 4PCQA 2UVUA 3JQMA 3JB9k 2KT8A 2QQ9A 3I5RA 1REGX 2WONA 3QPIA 4FSSA 1LPLA 1R27B 3QFHA 3POTB 4FBUA 2BKOA 4HR2A 1SUQA 2A6MA 4DV0J 3QSIA 3JB9H 3QRPA 4HKQA 4RWWA 4QIFA 2CQGA 4PJOB 3DDKA 3EDQB 4GO5X 4D3GA 2RI2A 1NK7A 1JX4A 3EGVA 2OI2A 4HCCA 1A0OB 4NA3A 2XMTA 4NLPA 5HVHA 2VBWA 3B8HA 3KJVA 1LW2A 2GFUA 4LFCJ 2V4JB 4QU7A 1NKCA 5E33A 2B8QA 1SJRA 2OEMA 4M78C 2W9AA 3W2WA 3V6KA 1V5VA 5KFLA 4CT9A 5HMZA 2UV8G 3G4ST 1KD1C 1VGYA 3KK3B 1RTJA 4W92B 1I5LA 3GCWP 2HHXA 4FNHA 1QAIA 4HACA 2EQUA 3Q1JA 3M8RA 2DRKA 3RR8A 2QZ8A 4RUCA 1JNRB 2XMAA 4N7TA 2V50A 3CCVA 1Q5YA 4Z02A 2AKWB 2OSRA 3W8PA 5GAOq 2FPDA 1PCXA 2DXEA 1SC4B 2OPPB 1T7PA 4NASA 1F5CA 2COYA 5GAEI 3BY7A 3Q89A 3MMBA 4JV0A 1URRA 4B17A 3CD0A 3K57A 4TLRA 1PSFA 2EPDA 2WTFA 4JI7F 2ED0A 5KFIA 3G82A 4YHHJ 2E9RX 5B0EA 1HHTP 1FRKA 1RTIA 3T6BA 4FM4B 4P52A 2CVEA 4P9SA 2D74B 1R8AA 4TKTA 2J8AA 4DS5A 1FFWB 1S97A 3KG1A 2V1RA 2LMJA 1SC1B 1NU4A 4LQ9A 3JB9F 3O5ZA 1WHJA 1CS4B 5A8RA 2XKOC 2IA0A 1ZSZB 4RMOA 4ECUA 2HS0A 4BUGA 3PY8A 1PBUA 1ZUKA 4ED0A 3F70A 2I8EA 4B3RF 4QWEA 4JZ4A 5GMKa 3CCRQ 3F44A 4OX7A 2XS7A 4RBTA 1NUEA 4ZS6A 2AGQA 2R7OA 3MCOA 3TZYA 1WHHA 3KLVA 2XSFA 3K5OA 1WTFA 2NSBA 3CO0P 2IVWA 2H51B 2YLCA 2DMOA 3G71Q 3NLCA 4UQTA 5I21A 1S0VA 2K2PA 2GFAA 2W8LA 4KC5A 4K5SA 2HMIA 1GTEA 1QWEA 2ZH8A 2QA1A 2CDRB 1CJUB 1KC8C 5G4DA 3SFUA 4C8OA 1MWZA 2FJEB 4I4BA 4OB2B 5T14A 1KSWA 4GBQA 3IRXA 1YN8A 4UOHA 4CNYA 1VQNS 5CVIA 2G9OA 3GG1A 2KPPA 2XIDA 2ZPHB 2Q3PA 3T5JA 2VFSA 4WF9Q 1EAYC 4OHWA 4FW1A 1VQ9S 3G4SA 2JEFA 2YNGB 1NHUA 4CP5A 4M7AA 4JI6J 2CJKA 4ECVA 3DGPA 4TLQA 3CD6T 3LAMA 3EFOB 3S6WA 3CJ3A 3DMJB 1GT8A 4E7KA 3L4BC 3OJSA 3UNYA 4YTLA 2WVCA 5A0YA 2V8PA 3IM9A 3DXBA 4WK3A 4KYZA 3FBFA 2OGUA 2FPEA 4QWCA 2O9VA 1S1VB 5HQLA 2OKQA 4X9CA 1X4FA 3N5BA 4K2XA 3I35A