1NPRA

Crystal structure of aquifex aeolicus nusg in c222(1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nprA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nprA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nprA01
1VQ4T 3H7HB 3CCET 2KPPA 2LQ8A 3P8BB 1YJ9A 2OTJT 3CCJA 3OW2S 2LCLA 2CKKA 1K8AC 2KVQG 1JJ2A 5FLXE 1K9MU 3CCUA 3CMAA 1VQPA 3DLLA 1KD1C 3CCRA 1VQ7A 3ER0A 1QVFA 3CD6T 2KDSA 1NPRA 3CPWS 1KQSS 1VQKA 2DO3A 5IT9E 1YI2A 2MWPA 1W2BS 1K73U 3PIOA 1RL2A 1YIJT 1UEBA 1VQOA 2LVMA 1Q86C 3G6ET 1VQMT 1Q81C 3EWGA 1M1GA 2E6ZA 3CC2A 1S72T 1YHQT 1M1HA 2QA4T 1VQ9A 1YITT 1KD1U 1VQ6A 1VQLA 3QQCD 1EIFA 1Q82C 3G71T 1XTDA 3CCQT 1M1KC 1BKBA 3LH0A 1KHIA 1VQ8T 1VQ5A 3CPFA 1QVGS 3HKSA 3CCMT 1Q86U 3CCSA 4CRIA 2JVVA 1N8RC 1VQNA 3G4SA 3I56T 4OBIA 2MI6A 3CCVA 2OTLA 1XNIA 3A5ZB 2L3RA 1YJWA 2EIFA 3LPEA 4RG2A 1VQ4A 1S72A 1M1KU 3OW2A 2OUGA 3CC7T 3CCEA 2QEXT 1NPPA 3I55T 3CXCS 4ESNA 3CC4T 5J3BA 3G71A 1NJIC 5A2QE 1K8AU 2OTJA 2EXUA 1M90C 1NZ8A 3CMET 2XHCA 1KC8C 3CPWA 1KQSA 3DB3A 1W2BA 1YJ9T 3I56A 1X6OA 5DLQE 1YJNT 4ZN3A 5IAYA 3CD6A 4QQDA 3JAME 1Q81U 3CCLT 3OYYA 3CCUT 1VQPT 1SSFA 1YIJA 1VQ7T 3G6EA 5HY6A 1VQMA 3LD7A 1K9MC 2K06A 2JOYA 1KC8U 1JJ2S 1Q82U 1VQKT 2MWOA 1YI2T 1YHQA 2QA4A 1IZ6A 1YITA 3CMEA 1VQOT 1QVGA 1QVFS 5LL6S 3CCQA 3DB4A 3LGLA 1K73C 3CC2T 4TVRA 5J26A 1VQ8A 3TREA 5DM7R 1N8RU 1Q7YC 1VQ9T 1YJNA 1VQ6T 2G3RA 1VQLT 3CCMA 3PIPA 3CCLA 4ZN1A 3KBGA 3CCJT 3LGFA 4YTLA 3J7AF 1YBYA 4X34A 1VQ5T 3CXCA 3CCST 3J81E 3J80E 3CMAT 2JNGA 2JUFA 1NJIU 3CCRT 3G4ST 1VQNT 3CC7A 2QEXA 2E70A 2IG0A 3CCVT 1Q7YU 3I55A 1M90U 2OTLT 3CC4A 1NZ9A 1YJWT
chains in the Genus database with same CATH superfamily
3IQLA 3KJFB 1VQNS 2LEAA 1E6HA 1T94A 2WK4A 4OQJA 4OZ5A 2BMBA 3HHKA 1NEEA 3CCTA 4WKRA 2RNAA 1D0ZA 3T19A 1NMEB 2EC0A 2BEFA 3CW2C 3F41A 1KVIA 5HK3A 3CEYA 2DTIA 4TLQA 4AL6A 4R8UA 4ZVGA 1UMJA 4DX6A 3DXSX 4Q8EA 4WK3A 2FVQA 3RR6A 3M6WA 2KEAA 3VAJA 3HCXA 1G1XA 5D6WA 2CZVC 1U06A 4N47A 2KT8A 1N8RC 2Y1LB 3VYHB 3QSYB 1FJ7A 1VQSA 1NJWA 1JKHA 2F4VF 2HPUA 4OJ3A 2J9DA 5KFPA 4DZDA 3FZ2A 2DK2A 3CC7S 2GJFA 2RKIB 2J6UA 2XO7A 1UGQB 3K17A 4U7CA 1XQIA 3M8WA 3QZ5B 3DLKB 4DBHA 1HYSA 4CM0A 1RUSA 1XQHA 3PYGA 4I6YA 5GVQA 1EFNA 1WZOA 4TVRA 2LCSA 3EFOA 3P8HA 4OHXA 1VQOS 4QQ6A 1OX9A 1NLPC 2E9RX 1H74A 2HQGA 3J80E 4WP3A 3I0RA 3ZL7C 4HHJA 2IJFA 4TVAB 3R7NB 2W9BB 4YFUA 3OTOF 2BJEA 3KUGA 2OIHA 1K47A 1X4CA 4PWDA 3CO9A 1GRIA 1S4EA 1FJGJ 1NNDA 5KFYA 5HMZA 4QIWD 4HACB 3BE3A 4QW9A 1M90R 1WI6A 1YN8A 2FLOA 4C92A 2VDHA 2ROTA 2UXDF 5D4OA 1M1KC 3QMQA 4X9CA 4IH6A 1R0AA 4LBIA 2K1RB 3I56T 2R8IA 4F0HA 1ULRA 3QRQA 3BBFA 2JLFA 5K14B 3RBBB 5IXFA 2DGUA 4J9GA 1GBRA 3FNNA 4RTYA 1AXQA 4P10A 2ILYA 1Y7XA 1QW1A 3GQCA 1NG2A 2YX7A 5IWAF 3E1SA 1ZUKA 1RTHA 4FYXB 3N6NA 1D3BA 1YBTA 2OHDA 3OBYA 1SC1B 1WNLA 2A2DA 4K59A 4J7CA 4Q43A 3GTYX 2B8QA 1G3YA 4PJOF 4Z8AA 1YWPA 3OTCA 4LQ9A 3BS9A 3LP1A 2VQEJ 2E70A 1K1ZA 4I2QB 1YJWT 3M9NB 2Y1IA 4N56A 3CCET 1MMGA 4WKYA 2RI2A 2H1YA 3JTPA 5GADU 2OI3A 2LX9A 2DZ9A 4J9NA 1WKKA 3UDCA 3SB2A 3B8HA 7FDRA 5GAOr 1KP6A 2P6TA 1Q16B 3M32B 2VGNA 5CCLA 1A0OB 2V9WA 1H0HB 1N9RA 3EG2A 2B4PA 3QJ6A 1BHNA 4AYBD 2W8LA 1KSPA 1S0NA 3ENAA 1EIFA 1H3DA 3G71T 4Y2KA 2XYGB 3MM8B 5CR2A 5D3GA 1BI2A 3EGXB 5D8HB 1S0VA 3G9CA 1LOJA 3PNWC 1ZM9A 3OS2A 4O4GB 3QAUA 4CTAB 3Q8UA 5HK4A 4ZVSB 5RUBA 5LMNF 1NJIC 2K3KA 5A8RB 3T1HJ 2YTCA 1MG7A 2HKQB 2ILZA 3JAMY 3JB9F 1LWFA 2CP2A 2QC3A 1WOOA 3PW5A 1SSFA 3TOQA 4OGEA 5IQQA 2EBEA 3RRGA 4HDGA 4CNYA 3I0SB 4XIUA 5GMKi 1VQKS 1AUDA 3MPDA 3TUZC 2XWYA 3PHEA 2AJQA 5GAN7 4PJNA 2E5GA 1AA1B 3TW0A 2GVZB 4M77B 1SH2A 1F60B 1MHNA 1MGQA 1WA7A 4JI2F 3RUXA 1KHVA 2D0NA 3CJ0A 1RZMA 4S0MA 1BI0A 2IY5B 3V8JA 4WZQA 2MXYA 4C2MA 2BXJA 3MAAB 4DQSA 1GTHA 3T9ZA 3PVQA 2DTJA 2KRSA 2IPOB 3PACA 4AFZC 3J7A1 3EVWA 3JAMU 4K4YA 2BW2A 4J9DA 1V9OA 3IG1B 3IAS9 4NXMJ 1K44A 4ORZA 5BR8F 2UUCF 4ZCMA 2E1HA 4D6WA 3JCMJ 1JJ2R 2KL8A 2AK5A 5KH6A 3NCRA 1WYXA 4RG2A 2VUGA 2DY9A 3BEGB 3GNFB 3OR2B 2EW9A 3O8VA 4DPYA 2QEXS 2RK1A 4UT4A 5GAOn 1SSHA 3W9JA 3BQ2A 4FKYA 4DV1J 2HHXA 3CDEA 1C4CA 1TL3A 4PFPA 2VC1A 2MY8A 2KKHA 4DR1J 2V8PA 2D6FA 1U6ZA 1Q8BA 3ZNUA 1YJUA 4PUOB 1X4AA 4WPAA 4RNHA 3MEAA 1RWUA 1TK8A 3DLJA 2EKOA 3CXCA 1AWOA 2O9SA 2ENMA 1RT2A 3MEEA 2HHTA 3LUYA 3FRNA 2MQPA 1K1QA 4ZPDA 3OSSC 3M9MB 2K7AA 1BD6A 2MTLA 4DOZA 1U25A 4CM2A 4JI5F 3C3LA 3BZQA 2AHJB 4B3RF 2I0NA 1FKPA 3QUIA 2GJ2A 3ILIA 2DNOA 3LGNA 2RS2A 1FF2A 1IKVB 3B6BA 3RRKA 3IM8A 4F2RA 3R5CA 4PG4A 4K4SA 4A8OA 3TANA 1NH7A 1FDBA 1GFWB 1G3WA 3J7AN 3OBIA 1W2IA 2HVZA 1MMNA 5J2QA 4HT9A 3GPAA 2CDQA 2BM1A 5BYQA 4C8NA 5EGYA 1QSYA 1UETA 4ZVHA 3DDNA 4FVMA 1FXLA 4M75D 1YI2Q 2O88A 4EZ6A 2YKMB 2H4YB 3NPFA 1E6VA 1NYGA 4CO0A 2E66A 4ELVA 5KYUB 5IFMA 5KFTA 2R2UA 4QQDA 1KFSA 2ZPFB 1U2FA 2KM8C 5A8WB 2VPWB 4DL2A 1CC8A 1VQPS 4ATNA 1FWZA 1UZHA 4CQ1A 3DB4A 4UTGA 5ETNA 1I1GA 3OQ5A 1N36F 1EKRA 3TQ7P 2GMJA 5KG0A 3H40A 4OX9J 1N0VC 2AKWB 5GAOm 4J9IA 2CNOB 1WQ7A 5E3CA 1Q0NA 1RHMB 4ID5A 4K4VA 5EWGA 5MLCV 4JV0A 2AGPA 3EHRA 2QA4Q 4RBUA 4JJDA 2VFSA 2GVDB 1RHJB 1QVGR 4LBPA 4AQYJ 2C3PA 3TUPA 2MPXC 3KXTA 2LJ1A 4J7FA 2B4UA 2DNNA 1QCFA 1BQMB 1TV6A 4O3SA 5HVFA 1FWLA 2DVEA 4MK7A 2Y0SD 4ZPBA 2JEFA 4OJHA 1WHMA 3QHSA 4F7UE 1M1HA 5DG8A 2ZE2B 1JX4A 1UA0A 5GADI 1SF9A 2FY8A 5D6XA 3C94A 1CBKA 3CIZA 1MU2A 4USJC 4K4XA 2LP4A 1RBOB 2QAZA 4JJBA 1P9QC 2JDJA 4ZIVA 4CLSA 1C1BB 3WVEB 3C4SA 3KOAA 3EG9B 2MI6A 4G1QA 3RMQA 2YDLA 2EJ9A 2X9HA 1VQ4A 2DJWA 2G1DA 4KH0B 2IVWA 1K9AA 2YY3A 4HTJA 1K8AR 1HIYA 2BOPA 2J0QD 1WC5A 2V8KA 2YNGA 3CPWA 1KQSA 3GCWP 3CF5Q 3TJAA 2BR0A 2M51A 2Q79A 2WVDA 3ULHA 3MCOA 2I6WA 3EXCX 4C8OA 2CJXB 1VQMA 4ER8A 2L3SA 1VRQC 3EX7B 4JV2A 1KG1A 2ZH1A 4P9SA 5JVGQ 5I3UA 1AZSB 3ZBDA 5T14A 4NLYA 5KFQA 2YKAA 4X4SA 2IMWP 3FEZA 4C92C 3PVXA 2JWNA 2DMOA 2DBMA 4C8ZA 1ZA2B 4HH1A 4QJVA 3DNCA 2HVIA 3DM2A 1BCMA 5CHCB 5KT5A 5A8KA 4EMKA 3QSIA 1IWAA 2HS0A 1XR7A 4KGMA 3MM6B 4M75G 1AHJB 2VYTA 1REVB 3MMJA 4Y28C 1V3SA 4RPFA 4RUHA 2GS8A 2VFVA 2WSFE 3JSBA 5LJ5d 3CE8A 2AX0A 4G1IA 5GAN2 1VJQA 3QYHB 4X1VA 3UO0A 1G3SA 4HTIA 5M2PA 3BREA 4UC4A 5LJ5g 1HNWJ 1KQKA 3E8OA 1NK8A 3CCVA 4IKAA 4BI4A 4EYIB 1SIZA 4JRQA 5KFNA 1YWOA 2WRMA 2CXEA 4NXNF 4YB1P 1NEBA 2Y0BB 4J90A 3BR9A 4LE9A 2MK5A 4B9MA 2L0AA 5B0EA 1M27C 2HCKA 1MUZA 4YS2A 2DH9A 3GE9A 2HMIB 1SI9A 2DT9A 2QL7B 2GW8A 2XC9A 2ZC4A 4JRKA 3OT9A 5D77A 4EMGA 4M5KA 4DN9A 1MLAA 3JQMA 3C6UA 2CVIA 2BE9B 1T9WA 1LXNA 2CDTA 5HBMA 4NOHA 1S5ZA 1AWXA 1SQEA 4DI6A 3OXGA 5EWEA 4JB8B 2DRAA 3OS1A 1H72C 1CLFA 5LXRA 3D5MA 1YTYA 4IH5A 2N7YA 1LXJA 2GNCA 4MYUA 3RB3A 5GAEU 3QKJA 4EFAC 1YITQ 1C0UB 2A08A 4MIAA 3LO3A 3RGIA 5ETQA 2CQ3A 3MP8A 4PFZA 3K8WA 1VBZA 2HK2A 3M2RB 1N6QB 5GAMe 1WORA 3DLMA 4R55A 4TY8A 1TK0A 3UN5A 3KMQA 2X35A 1U1PA 2RF2B 4ECZA 1W26A 1RBLA 2P9GA 3IM9A 2DR6A 1ZAWA 3KDOA 3OTDA 4N41A 3MMCA 2QIFA 3BPDA 2MKHA 5KT2A 2XMJA 3VGSA 3U23A 1WGSA 3MEGB 3JCMW 3W66A 1S72A 4EIKA 2BE2B 5HL7Q 3CJRA 4FZVA 4KHRA 4FYDA 2HFUA 2MCNA 3KNGA 1YJRA 3IWXA 1QJHA 1KC8C 3AHPA 1UJ4A 3EGUA 1FXXA 4MZTA 2OMOA 3CCUQ 5ETTA 1LKZA 2JTEA 2C2EA 1Z2ZA 2DRBA 4YR3A 5G0RA 3DGPA 2RPNA 2ZGWA 3G6XA 2RNEA 3HD1A 5HMXA 1YJNA 2G3RA 3VS2A 1N27A 1OJ4A 3HP9A 2VBZA 1CJVB 4NLSA 2RA2A 4NCBA 1P1LA 3H4BA 2XZTB 2JXBA 1FRXA 4OZNA 3V7RA 4QPTA 2KPPA 4J9MA 1NDKA 3NKYA 2CUBA 2A3LA 2CKKA 1QWEA 4AD6A 3FRYA 3UVJA 1KQ2A 4IG3B 3S3MA 2DL4A 1QCNA 3G6EQ 3WC0A 3VQTA 3EVMA 2HVEA 2J05A 3VCDA 5CKFA 1SJ4P 1HPZB 4CT9A 3O5TB 5HQMA 4BACA 2IHR1 4GVLA 3RRHA 4KV8A 3L2VA 1TUDA 2HQDA 1TL7B 1RU2A 1WX6A 2HBYB 4USVA 2MQLA 3K89A 5J3BA 4B3SF 1EP4B 5KT6A 1VC6A 5LSRA 1VQ6Q 3VGTA 3RAMA 2RDDA 3P5TL 3GLXA 2FJBB 1OPZA 3EHQA 1HQUA 2FJEB 2EVZA 5ETMA 2P8IA 2ROLA 1K0XA 5LJ3Y 5FLXU 1L3VA 2P84A 1RU1A 2R42A 3EPIA 5D0EA 3NFCA 3JB9I 3N6MA 5F0UA 1JJ4A 3KK1A 3CDAA 5IC4B 3TI0A 3N79A 2WSEE 3CCLA 1D8ZA 5KAKA 4RG8A 3J81E 3MM7B 4LREA 3S3OA 1XERA 3GV8B 8ATCB 2W4CA 1TOVA 6FD1A 2EK1A 4DV4J 3G8TA 2VA2A 1JLAA 1F1BB 4KRTA 3R9LA 1ZZNA 3PFEA 4KULA 3KLEA 1EQ0A 2LU2A 1DRZA 1UJ6A 2KVQG 1N4LA 3HFKA 3MEWA 1SVDA 2F5KA 3HDSA 5CYJA 3BF4A 4DCOB 2G2YA 1KFDA 4J9KA 4IQMA 1FFWB 3PZPA 4M78A 3PDNA 2H3JA 2OO4A 1N8RT 4P6QA 4OZ0A 1UKUA 1RBAA 2CPXA 2EPIA 2EEYA 5FIIA 5IHKA 3SSSA 2X3GA 6FDRA 2HKNA 4J9LA 1LVKA 2HNYB 2KRRA 4PXBA 1RLDA 2CPDA 4A4FA 4PXDA 1Q1KA 2W4DA 5L1IA 2IC3B 1JLBB 3X1LB 4NRTA 4ZPTR 2YNHA 3IBFB 4UOGA 3M7VA 3RYLA 3QGIA 2HW3A 4PQUB 2PC6A 2HMAA 3T6BA 4M5DB 4CYUA 1EZZB 2KYBA 4ZKAA 4QWAA 2IDEA 1HWKA 4RR5A 1Q78A 3EMTA 4DPOA 2XLKA 3VKIA 3CC2S 2IIHA 3CCJT 1GX5A 5ECAA 3MM9A 2LNVA 1D9AA 1U09A 3MR3A 4F17A 2GO8A 4NYOA 3D4JA 2ZH2A 3O6QA 3V6JA 3K8VA 1Q8IA 1FJGF 1TKZB 5HKCA 4KY3A 3QT5A 3SFGA 1O0PA 2AZVA 2QN6B 2K5IA 4JYAJ 5DQIA 5D0HA 2RQMA 2B5JB 1FRKA 5KFUA 1WC1A 2W24A 3DRRA 3H42A 2EKHA 2KG1A 1R8PA 4DR3J 5D0RA 5GAEI 1FI4A 3D1HA 2R7QA 2CREA 3TZWA 4LFCJ 4H4MB 2WSEC 4Y34A 1RA7A 4C98A 2F5GA 4OB2B 3H5YA 1PC0A 4N7TA 3QLHB 4RLEA 4OZLA 3FC3A 4DR6J 1RACB 5IQ6A 2BIVA 2HQEA 4M7DB 1QAXA 1SV5B 3HSJA 5KTQA 4BY6B 3HKWA 3M0SA 1XNIA 1B70B 4OX6A 3TRGA 4C8QE 2VG5B 1WQWA 2LX7A 4C0DB 2FLLA 1ZOTA 2V26A 1RTJA 2HHHJ 3M8SA 4TKTA 4FT2A 3HVTB 3F44A 2YKPA 1C0TA 1HHQA 1IWGA 4PFOA 2GF7A 4JI3J 1N54B 3HT3A 2C2OB 4FKXA 3C66A 3M30A 1F0XA 1MWZA 3PW7A 3H9NA 1XC9A 3AB4B 3MCSA 5G0RB 3T5KA 3H20A 2Z0WA 2KFYA 1YLXA 2M0GB 1SJ3P 4LIWA 1VQ9S 3Q23A 3CCST 2J7UA 1OS5A 5DZ7A 1HWIA 5I3QA 1HNXF 1MV3A 5CKBA 4N0AA 4C92D 5C24B 4ZIWA 2FPDA 2D9PA 2OTJQ 4OB1B 3M2VB 1BB9A 1M5Q1 4F14A 2QDLA 1R77A 4AFUC 1HJDA 4OYXA 4ZVFA 3HO1A 1IRXA 1VYVA 4FN5A 4N5SA 1VC5A 2WW8A 1J5OA 1HR0F 4H4OA 2GQQA 3JCMQ 2RDJA 4NEZA 2LDMA 3NGPA 3M4GA 2DNMA 1PSDA 4J9PA 1H7WA 2CRLA 3QQCD 1HA1A 1Q82C 3NGUA 4FVCA 3QWPA 2GQVA 2X3XD 4LJMA 3P96A 2WVFA 2VH7A 2LLZA 1QVPA 4BUGA 3OJUA 1CS4A 2HRTA 2E3HA 2KVQE 2KZZA 1TUVA 1NJIT 1JJ2P 1UVMA 4WE1B 4OHWA 4PJOA 1JLEB 3D0IE 3I9ZA 2Z2YB 4EDUA 4JPBW 4QCLA 4NCGB 3V6DA 2EYZA 5IV3A 1H2VZ 3GP9A 1QE1B 3G7ZA 1F9HA 2E5JA 5BJRA 2MB0B 5LMUJ 2DEQA 2CJBA 2ZHBA 3FK4A 4U6PA 2YRDA 3LAMA 3Q8RB 4UF4A 4KGKA 4MKVA 1BC6A 2K2MA 3S3NA 1OYXA 1URNA 5GAOq 2GCFA 3SI8A 2DO0A 2A1BA 4PG6A 1GMUA 2P6SA 3VAGA 2Y1JA 1L5UA 1ZH5A 2MLZA 4ZP6A 1Z9ZA 2B3TB 2AT1B 3QGGA 1SL1A 4CC4B 1UZDA 2ZZMA 3QZ9B 1NJXA 2KTQA 4B3OB 2MZQA 2LEPA 2VPXB 2DXDA 4PZVA 3VV2B 3G96A 4OYBA 4RUBA 3OUYA 1YQHA 4LR7A 2FYXA 4NXMF 1HFEL 1ZUYA 2L48A 1QVFP 2YUQA 3VR1A 2CJ9A 4XTUA 2XDBA 4P7VA 4KPYA 3F56A 4C11B 1AFIA 3KYLA 3PR5B 4ED2A 1NDLA 3CTRA 2I5JA 5LXYA 2YH1A 2ZZNA 4X66J 5AXLA 4DFJA 4BC9A 1UVIA 3QJPA 2HBPA 3DOLB 5CKDA 4DPUA 1R0BG 2ZPHB 3Q1JA 2K3YA 2IRXA 3P6YC 1X6OA 4DR1F 2RAQA 1X6GA 3PYDA 4XO0A 2L3MA 4NS5A 2N3OA 3GP8A 1JJ2S 3SV4A 5GANj 4HI1A 2MWOA 1RHRB 2J6FA 1VQ7S 3KXDA 4DQ2A 3P4UB 4PJMA 1GH8A 1CJKB 4DXLA 1Q7YC 4IUVA 3S8SA 2KSSA 1F3FA 2OD4A 2BV3A 2E12A 1OSCA 2Z57B 4DUTA 4MZMA 5HVGA 1LWCA 3G4ST 4X4RA 3H2UB 2JMAA 3FC9A 1JU5C 1KHCA 5GMKa 2YHTA 1YHQQ 3KG1A 5DZ6A 4DV0J 4TXSA 3TZXA 2RQVA 1HBNB 3HI9A 3TSZA 1I07A 3JRZA 3FQLA 1QVGP 3K5OA 2R58A 5CQXA 2RE1A 3BGLA 4ETZA 2KDSA 1LCKA 1Q8KA 4Q0BB 1I51B 1WFWA 5DGBA 1AZEA 2ZHOA 2IJRA 5H1SV 1VHFA 4K2XA 2D0QB 1S72S 1EHWA 3KLGA 2DEIA 2CPJA 4ZJLA 2FD2A 1TKDA 1UW4A 2OEKA 3M1VA 2ZPIB 1LJOA 2YLCA 1TUWA 2F8EX 2B7BB 4AUKA 4M77E 4WP9A 4LD6A 2XU8A 1M3CA 2OPRB 4JJNK 4LF4F 1JLFA 4CH0S 3CCUS 1QAYA 4B6MA 1I8FA 3EG1A 3RBXA 2FLPA 3AOBA 2BVZA 3KJVA 3UCUP 4HVVA 4MYTA 2HVDA 1FX4A 1JXEA 4ZA1A 3T6JA 4OV1A 3GJRB 3N5BA 4C0BA 4PXEA 2OMLA 4DV3F 3MHYA 4H4KC 3M8PA 2CP7A 3EXYA 1RHQB 3H8ZA 1N6AA 2L08A 1C4AA 3VYGA 4HKEA 1S1UB 2LQBA 2UUAF 1KDNA 3L95X 4LRFA 4YOEA 3FSIA 3PTWA 3PIOA 2YUPA 2WAQD 3KTQA 2PIIA 3RNJA 1V76A 1ZX6A 4FYWB 3TR5A 2KRBA 3G6ES 4DUZF 1IM4A 4KH1B 3ONQA 2UXBJ 1QVGS 2PA3A 2PEHA 3UCGA 5LJ3j 2BYCA 2CQ0A 1U45A 2CP3A 2ZVIA 1CS4B 3PT9A 5B0FA 1RWNB 4AG2C 2DL7A 3META 4JV5J 1JEGA 4DBQA 4RTUA 2MKYA 3TEHB 3AA8A 2CS7A 2CJAA 3IGVA 1PIEA 1X4FA 3V8KA 4DV6J 4Q45A 4A4GA 1RTIB 1MNDA 3I56A 1TVRB 3CDUA 3LX7A 2QXFA 2Y3YA 2W2PP 1X0FA 3CMAQ 2K3XA 2OSQA 1YBAA 2DZCA 4HH0A 2GV1A 4CNZA 2NUPB 1B07A 3CCLS 3I35A 2DX1A 4UUWA 1O5JA 4K4TA 4LF8J 1AROP 4J9SA 2APOA 3V4IA 1N32F 3ZZTA 4D3HA 5GAMj 4EI2A 2CZ1B 3POTA 1N5QA 3AAWB 1M5KC 3C6TA 2YNIB 3FVYA 5CZVA 1YJWQ 4MDWA 4KQZA 1KOHA 3A8HB 3CCEQ 2C2DA 2GJIA 1UW9A 4XU3A 4M77C 4B02A 3KKFA 1U24A 3GU0A 3N9UC 4P2XA 1IM6A 2YWEA 1Y3KA 3M6UA 2XG8A 2VQFJ 3HSZA 2BOAA 4F50A 1YI2A 1K73R 4ED6A 2VG7A 2XI3A 1U02A 4HR2A 3JV3A 2AYMA 4CLZA 3VS3A 1U8RA 2AEFA 2VG6A 3H0HA 2CQ1A 3MCNA 2P0QA 4RW9B 3UNYA 3CJSA 1T9XA 3HKSA 4N77A 3A8OB 3RW7A 1YGYA 4YR0A 5GAN5 2IAJB 1IKYB 2V8HA 4YB7A 4F3MA 2KDOA 1UA1A 5CYQB 2D74B 5IH2A 1Y4ZB 2YNFA 2X3DA 3GFZA 2XNRA 2DHSA 4I64A 3OW2R 2EFNA 4NEYA 2NLUA 3G71A 4E7KA 5CZXA 2JS0A 1Y96A 4JS5A 4AXJA 1RAOA 3IGNA 1MMAA 4B9VA 2EKNA 3H2LA 5HATA 1ZS6A 3DLGB 3EG0A 4YHHJ 2O4XA 2FG0A 2LXIA 4ICLA 5KG6A 1YVFA 2DBKA 2QA4A 5KFAA 3SQGA 2BQUA 1RAFB 1KD1T 1N8RU 3DMJA 4KO0B 4M7AB 2K3BA 2E1RA 3L2RA 4CZCA 1H92A 3ET6A 4DX5A 2L2PA 3H0FA 1T3NA 1RT5A 5GAN4 3RAQA 3NXZA 2G0JA 3JCMP 4LXCA 5FWCA 4A8KA 2H8HA 4U67Q 3KFVA 2B7CB 3TAPA 1ZAXA 3HSGA 3CSKA 2QL9B 1K4US 2QMXA 3CIMA 3R5DA 1RT1B 1N5YB 2W8KA 1Y07A 3NCPA 4LRBA 4ZP9A 2ACMA 1N33F 4G3IA 3BGFA 5F9LA 5GMDA 4RTXA 8RUCA 2XYHB 3RMSA 4LUEA 2IA6A 4FM4B 4LF9J 3BGOP 1VQ8S 2RVJA 2FHDA 5CYMA 3PO4A 2CPEA 1V29B 2RQRA 5GANd 3ILLA 5F8LA 4B9SA 2E10A 2GCXA 8AT1B 3D3BJ 3SCIE 4CO5A 2H5EA 3R5GA 4LFBF 3MP6A 3GIKA 1U1RA 3DKDA 2HNZA 4DWIA 1TQLA 3CGIA 1IBLJ 2HURA 1X5SA 4ZVTB 2EW3A 5L1JA 1PILA 5J39A 2DGXA 4KIAA 2VOPA 4QIFA 3PEHA 2DRDA 1ZYQA 4LF7J 4PJJA 4WYLA 4I6AA 4OHZA 1X6BA 3E19A 4A47A 1WIEA 2H54B 2DD5A 1P9YA 1TXQA 3UDVA 4EMDA 1YZ7A 5C25B 2EFQA 1X4HA 2Z2MA 1SJQA 4BDYA 3OXFA 1KIKA 1GXTA 3VVTA 3F73A 1K0TA 4LDVA 2O9VA 1RT7A 2J0XA 4KHMA 3UWTA 3NTKA 4OYPA 2J7IA 1BI3A 3CCMQ 2OTJS 2R8GA 1NXIA 3DRPB 2E64A 1MROB 3TU4K 1D09B 1OPLA 4DBRA 3ZZYA 2EWNA 2RRBA 2DPPB 3RDVA 3SQOP 4Y91A 2V4JB 4CP5A 2A10A 4LF5J 3PTAA 3M0RA 5CKEA 3UE2A 2V34A 4UY8T 3PKMA 3A8KA 2B9XA 4JJCA 4YB6A 4QKUA 1RP5A 2F7VA 1U1QA 4ECRA 1U47A 2HSEB 2BJ9A 5B0AA 2M16A 2X51A 5GMKh 2MHEA 5IN1A 1JWWA 2V94A 2VZ9A 5K8NA 3PJWA 2N82B 1YRUA 2N3LA 4EYHB 3RKXA 1SJFA 1RT3A 1LW2B 4X4UA 2RQCA 3OVBA 4E0DA 5D4NA 2HAXA 4CLFA 1YITA 3H98A 2GBQA 3TUIC 1MNEA 1VCTA 4UOHA 2JVRA 3SWNB 4B9WA 1RWXB 3LWHA 2IBKA 1JLGB 4DL6A 3BDLA 1YBYA 1ZM2A 4DV5F 3POTB 4ID8A 1NJIU 3DOMB 5HMYA 3W2VB 3OYDA 2CP0A 5L1KA 2F1LA 2KRMA 2YQ3A 2EQJA 3AT1B 1KK7A 1WXTA 5FU7C 3PV8A 1IREB 4B3TJ 1KTVA 3BGRB 4A4JA 3LP0A 5LJ3d 2CPHA 5FDLA 3ENVA 4I7FB 1QVFA 1RL2A 1S6PA 4J9BA 1HW9A 3M8QB 4IFYA 2DJZA 4DPWA 4CLTA 1RWKB 1IBKF 2HFNA 2B4VA 2F40A 1TKXA 1S1VB 1LW0A 5CABA 2Z2ZA 2LU1A 1T03B 2M9UA 4TY9A 4C92F 2CZ4A 3GR1A 1Y0MA 2GHPA 2W7OA 3H5UA 4PLIA 4Q2LA 4ZHRB 4MIBA 4RNFA 2DL5A 2HNIA 1DQ9A 2DFUA 2MQOA 3M6XA 4KBIA 3PGGA 3KHRA 3LA0A 5GAMd 2MKIA 4M63A 2W2MP 4QT7A 2ZUAA 3QZ7A 4DUYF 1X43A 4IIOA 4OB0B 1FMKA 3VGVA 1T8EA 4LD9K 2KAFA 4ICLB 4M7DG 1ZM3A 2DCUB 1HNVB 4WYWA 1ZLMA 4J9VA 3MPYA 5U47A 1V5VA 4IDKA 4R5PB 1G7CB 1LWEB 3GONA 1QWFA 5KFKA 1Q4RA 5DDPC 2CQIA 1SUQB 2FPHX 2YH0A 2FPFA 2DEJA 1NYFA 2OLWA 3I55A 1IVZA 3MM5B 1RT5B 3CC4A 3BB5A 3MFIA 1VQ4T 2R4FA 2EYXA 4M78D 3FMBA 3F0NA 1RTZA 2HGNA 1N8RR 2PZ1A 2CZ7B 2GZOA 3I5BA 1SBRA 5J1EA 1S1TA 3IC1A 4ENOA 5CCMA 3HFVA 4IRDA 4LFCF 2NXNA 2YKNA 2R8KA 1SL2A 4F7UF 2ZPGB 1G8XA 1VQMT 4XTVA 5J2PA 3X28B 2VPZB 4QW2A 4JI4F 1VQ6A 2LA4A 2HVHA 3PG9A 4M4ZA 5JVHQ 2UVUA 3DLLQ 4OBIA 1C2PA 1WELA 5I42A 1S59A 4GKJJ 1T9VA 3PMIA 3G1JA 4Z89A 2CYYA 4ZVOB 3MUMP 3HMJG 3CMET 3W9HA 1CJUA 1YCSB 2OJ2A 3HRTA 3MEDA 5AYFA 2MSSA 3BSAA 4A54A 4J37A 1VS3A 2ZZTA 2C2NA 3K59A 2JOYA 3K5LA 2EGAA 2CA9A 4DFPA 3MFHA 4NLDA 2VPYB 3FCHA 1SL0A 1UHFA 4W4MA 2X1AA 4CIOA 1R27B 2ROGA 2OKQA 1ZBJA 3LP2B 2F65A 1YKWA 3WBZA 3JS9A 1VYAA 3W8PA 1IBMF 2L41A 1YIJQ 2KO1A 3CCVT 1X9MA 1KRPA 2RK2A 3EGDB 2HLUA 2CQ2A 2V2ZA 2QMUB 3BQ0A 1RGVA 2FHOB 2RN8A 5SZTA 3TVTA 2FB0A 4B9XA 3I4HX 1LNXA 4C5GA 3CULA 4DA4A 2NYSA 2K4YA 4DOWA 3FFIB 3W63A 2POKA 3JCMb 1Q82T 3RB4A 3VS0A 4Z7YA 2MQQA 5K9FA 1CC7A 4EMHA 2BKOA 4HXJA 1SQGA 4CO3A 2FEIA 3QO3A 1S1XB 4QR0A 5I2MA 2AWZA 4JI6F 2YUNA 2V6AA 1J3TA 4DR5J 3ILJA 2KR3A 3AA9A 3DRSB 4WXWA 4NX9A 4PABA 1S7HA 3THVA 1OO0B 3IRXA 2WBRA 3AXKA 2E5HA 2E7XA 1SQFA 3CCRQ 1VQNQ 4M78G 3QNWB 2AGOA 2SRCA 1FERA 3CMAS 5J2NA 4QWCA 2XS5A 3BO3A 2EWHA 2IMOA 4U96A 2XZDB 5KT3A 1IB8A 3QT6A 1OX8A 1U26A 1SHFA 1FKAF 1M4ZA 5A0GA 3UCZP 2CYZB 5B08A 5L46A 1X01A 2DNLA 2ESWA 3DLEA 3N5FA 2GGPB 3VALA 2UU9F 4C5EA 1YJWS 3KLIB 1UVLA 4M7DE 2V2KA 4RW6A 2LEBA 2CWKA 3CCES 4CH1A 1SH0A 4RW4A 2PI4A 1SJRA 5AXNA 4ZPWR 2PVGB 1U1LA 2YPYA 4EZ9A 1NJIR 3E51A 2EJGA 4PJOD 2ZUGA 1U1MA 3GWCA 4IG0B 1XMQJ 3AD8C 3M2UB 1LK7A 1VBYA 2LNHB 2Y90A 1MWQA 4NA2A 2G0IA 2A36A 5L8RC 1U8SA 3QWXX 2DHHA 2H51B 1XNRJ 1UFWA 3RESA 1VQOQ 1W70A 2EXUA 4BBYA 1T05B 1VRTA 4L6V3 3IN5A 2V1QA 5B7WA 2RHUA 3U1NA 3M8RA 4EBEA 4GKKJ 1NKBA 3FSXA 1H2TZ 3CCWA 3ZTRA 5HN0A 4Z7CA 3G82B 4RNNA 3GR0A 1XMBA 2DNRA 3M54A 2KHDA 3OTBA 2RQ4A 1VRUA 2DNGA 2V9KA 4RNOA 3TAMB 2WBMA 4FSSA 1CQMA 4E7IA 5E3RA 4DFMA 1AT1B 4BI3A 1UVNA 2GC8A 2VUBA 1NK4A 4OZ1A 2LT4A 3ISZA 3DI6B 1OZ2A 2C2RA 2XNQA 3EICA 1S77D 3PR4A 3ZTSA 3HPOA 2J6TA 2AKKA 1RT6B 4RTTA 2E44A 4LSLB 1WF0A 3SIPB 4QPXA 1WHGA 1H7XA 2R7WA 1GCPA 3OV7A 3KLFB 1M9SA 1KD1U 3M9OB 1YCYA 2FO0A 1BQNA 1UWBA 5HVHA 3LAKA 1X2KA 5C42A 4PR6A 5KFSA 4QU6A 1OYDA 3W5XA 1HYOA 2V8GA 2M88A 5DDQC 5IC6B 4P74A 3QRRA 2EYWA 2RJDA 5IV4A 3BSCA 5HLFA 1S57A 3EH2A 4F3QA 1OU9A 3SSQA 2YQ2A 4BY6C 3RTVA 3CNQP 2V50A 1KQGB 1DLOA 2M02A 4JV1A 3TO8A 2J8AA 2LDYA 4E8UA 5DRKA 3NRBA 1K1SA 2IRYA 1PYTA 2ZD1A 4ZLJA 5T7LA 3OLBA 4GO7X 3BY7A 1YFNA 3ZTQA 4O5VA 1NRKA 2XQCA 1RWWB 4QQGA 4NI2A 4ZN1A 3T1AA 3M53A 4KHPF 2ZKTA 4OF1A 4PJOG 1W2BR 3BO4A 2D41A 3ITHA 4IRKA 4KR0B 2FQQB 1I1JA 4O44B 1WPYA 3GIMA 1S4FA 3BYPA 2F8MA 1NO8A 3I5CA 2LC4A 2W9AA 3M5AA 3CCJA 4RW8B 3LW5E 2RJEA 3JCMX 2Y4YA 5HROA 3G6VA 1OPIA 2CP6A 2F5TX 1TTHB 2ACYA 1UFKA 2DCLA 3MI7X 3Q83A 4MAKA 1C0MA 1RXOB 4ZVUB 2RMOA 1V5IB 1RWVB 3LF0A 4DR2F 2BX6A 2AIRB 3W1YC 2PI5A 3SDZA 3OR1A 2QQRA 1VQ5A 1FKOB 3W5ZA 1CKAA 1JLCB 3D0HE 2FDNA 4LSNB 5A0YB 3D28A 1F5BA 4RJVA 2XIDA 4P73A 3FRZA 2XLJA 3J7Z5 3H5SA 4C97A 2ZOGA 4F4WA 2R7XA 3OW2P 4C0FA 2EQUA 2XMAA 3HSBA 2O2OA 4NE9C 3A4TA 2NWMA 4OMFG 5KG4A 1G3TA 3JB9G 1FD8A 3JAME 1RWPB 2DISA 4XTYA 2YQ0A 4ZVEA 4J9HA 2NXJA 2M7SA 3JYTB 3AJ1A 1YHQA 4AL5A 1AVZC 2E41A 3K7RA 3W61A 1UDLA 2C06A 1HBMA 2BKNA 2P4RA 2UV8A 2XZWA 3VAFA 2V8IA 1TU0B 4KKOB 3R6LB 1VIOA 2QLWA 2NXUA 1QQJA 3TZZA 2YWFA 3M59A 1RKIA 1Q5YA 1PRLC 3MD1A 4BE0A 1WF1A 4ZLNA 4QIEA 2GHVC 1TUGB 4MMLA 1TP7A 2CIMA 2VKNA 2MOXA 1K8AC 3B4MA 3JCMg 2XLIA 1OPKA 4DF4A 4HVWA 2YRCA 1VDHA 1RHKB 4ZPCA 3ZFJA 2NS1B 4RW7B 3A8MB 1U49A 3R27A 3PXGa 2WOMA 4XDCA 2OFHX 3CWJA 4O3QA 5DDRC 1O75A 2HK3A 2HHWA 2AGQA 1WXUA 4XU1A 4QYRA 3HVAA 2B6AB 2OPSA 4LFAF 2I0XA 1HNZJ 2DTOA 2EQMA 4RTVA 2PUKB 4K4ZA 2J6SA 2XD0A 4M75B 2PVDB 4FT4A 3LW5C 3QFWA 2G2ZA 2W7PA 2IFXA 2ZBCA 2PEBA 4FW2A 1MN9A 4ZTJA 4P2FA 4DL5A 1NK6A 4OI0A 1R3NA 3CD5A 2PMZD 1U0HA 2E3IA 2CQDA 3QRPA 4DR4J 2JM9A 4NZ0A 1FRMA 2GAHC 4I67A 3IRWP 1GMWA 4NLQA 3C14B 3CCQA 1M1FA 1F9EB 1WHXA 2AYEA 3T5JA 2LECA 5GMKe 3N0VA 2XG8D 3SDEB 2IVMA 2ZOMA 4MK9A 3QGPA 2PN6A 2FZKB 2AHOB 2PUOB 2W0ZA 4H54A 2LQ8A 2KRNA 1YJ9A 3OYFA 4BB7A 2YLBA 2DD4A 3D54A 1VQYA 5AXKA 2I2YA 3MP1A 2V8JA 3J81Y 2IDLA 4JBCA 4V19J 2F2VA 1BIBA 3QIPB 2D1CA 3NOCA 3DOKA 4E7JA 3BN4A 3QPHA 1ABQA 3UPFA 2E7VA 1D0XA 3OYJA 4NOYA 2LQJA 2W9CA 1WHYA 1U1KA 3CJKA 4LRAA 5IT0A 3IWNC 2CT3A 3RZAA 1KD1R 4DS4A 2F2WA 3M0QA 2L8DA 4KJIA 3VAIA 1KEKA 1NHVA 1FDDA 2DRMA 4PWUA 1G3OA 1O51A 5HAOA 1VBKA 3IMQJ 4DCJB 3TZYA 3HK2A 1UWAA 4CC2A 3J81U 1PG5B 3KK3B 4G65A 3REBB 4X62F 5AJ3F 4GLMA 1FT8A 4DL7A 1GXUA 2ZKUA 5JUMA 3GLJA 2XK0A 4CLUA 4C8MA 1QUPA 4YDDB 4ANEA 1H73A 4JLGA 3UFCX 3G4SQ 3DHWC 5E5NA 1LNQA 2J8SA 4QBUA 2L9NA 1OY9A 1U6FA 2WVCA 2UXCF 4EWTA 4ED8A 4FBTA 2D69A 3OL6A 1IKXA 4DSJA 5CIUA 3EM1A 3MJXA 2PO4A 3GYXB 2R7UA 1AOJA 4JS4A 3OL9A 3W7BA 4JOUA 1EAYC 1BWEA 2HZYA 1UEBA 2HHPA 4OI3A 2QL5B 1LV5A 1PYSB 3VS7A 4BLGA 5B0GA 5GAN3 3MTKA 2OI2A 1D1AA 4HDHA 4Q8FA 2WCXA 3QFHA 4GLKA 5DM6Q 3KUHA 3MECA 5HP1A 1A9NB 2QSWA 2IIMA 5IT4A 2VC0A 2VF3A 1KFZA 4DF8A 5FU6B 2O66A 3KWMA 3NBPB 4E7ZA 5DY9A 4M7AE 1F6TA 1R8CA 4ED4A 2MZRA 2QASA 1B7TA 2Q66A 3AY0A 4RUAA 1GCQA 1PD1A 4ZVQB 4ALZA 2I9SA 2LVWA 1S6QB 2VFUA 1VFJA 1Q82U 2XMWA 3CCRS 3C16A 1OY8A 3A8GB 4C5IA 5FRMA 3KMSA 2NUTA 2R7VA 1L3SA 3DCAA 2X1FA 2XSJA 3N01A 4ZJOA 2HNDA 1RTDA 3B54A 1B4SA 4RZRA 3MUVP 4JI0F 4AXIA 1W7WA 4PG8A 2COLA 2WONA 1OEBA 2YQ1A 5G4DA 2DNQA 2QA4G 3A3PB 2ROEA 2CZ0B 3ZZ0A 4LF6F 3MR5A 2Y8YA 3D68A 3CXCR 4P52A 4RCCA 5CCAA 4KT0C 2W7AA 3E01A 2O3DA 4NL5A 2VXFA 4DLEA 4RX6A 1Q8LA 1M5PC 4L3KA 5CK9A 4BC7A 3JSMB 2QA2A 2V4QA 2AMCB 3X24B 1M2OA 2NPFA 3C46A 2OTLA 1OQ3A 3A3NB 4XK8E 2R5AA 1YRXA 2A0FB 2X4JA 2XSFA 2WVBA 4V1Ak 4M77F 4F3OA 1HBUB 3SYZA 2KGTA 2ASLA 2RHZA 3SHWA 3R6OA 3O44A 4XTWA 5AE3A 2E1MC 2W10A 2EAYA 1B7YB 3W3SA 3BSNA 2K9GA 3NGTA 3C2PA 4HCBA 1WC6A 4Q7AA 3U02A 2H3EB 2KK4A 4AG1C 2BANB 3TREA 4B08A 3CCMA 1Y71A 3FMWA 1KN6A 1HMVB 4C8YA 4ELTA 3OVSA 2HBZB 5GAGU 3MD3A 3DYAB 2PFFB 2VA3A 2E1AA 2JM8A 1DTQA 2RH2A 4IFVA 1FK9A 2VGMA 1GNKA 1GQEA 1RHUB 2MYSA 4I2PB 3HTRA 1QKWA 2D8HA 2YSQA 3H0IA 1SPBP 1M1GA 4RL1A 2DNHA 3OFEA 5F9NA 3KHHA 3D7SB 1OI1A 1O9SA 1FCAA 2KROA 2ZM6J 4QYZK 4GVBB 2ERRA 2VVKA 2XEXA 3X26B 1BQXA 3E2EA 2DBBA 4A8XA 5KYYB 1UEKA 4ZJQA 1OZ3A 1T0TV 1UP1A 2KT5A 5C5JA 4YY3F 1AEYA 3R5AA 2DXFA 4O3OA 1BU1A 3SCKE 4YEAA 3TP2A 4DU7A 3N4WA 3HPWA 4WU2A 4ANCA 4R0EA 4Q5VA 1V3RA 5J1NA 3MMBA 4USTA 3OA6A 1KVKA 1W25A 1TKTB 1KVJA 1RUWA 3TQEA 4X4TA 4UZCA 4WFNQ 1X4GA 1YI2T 3JCMf 3U1MA 2DR7A 2K3IA 3AD7C 3RUBL 4J9RA 4NLPA 3M58A 1CG2A 3K5PA 5D78A 4F7UA 1UPPA 3NWRA 4FNHA 3ILOA 4UOCA 3RBZA 3AQOA 2KXCA 2F4VJ 3CPWR 3LGFA 3I32A 1KQSR 1XNQF 2MQ8A 1F5AA 2OH2A 1PRMC 1WDXA 3GFXA 3KLHB 2RRNA 2FHJA 4HA8A 3HHLA 2IM0A 5EDWA 2R9LA 2CH4W 2A28A 4K0KJ 3R5JB 1BY9A 5FLXE 4RUCA 2ZC3A 1Y00A 2QGFB 4PKDB 5I11A 2L3QA 3URGA 2R2TA 5GMEA 2HHSA 3FJPA 5LJ5j 3EWGA 5FD1A 5F8JA 2QA4T 3VZIA 5KYXB 3MMAA 1HD1A 2MPUA 4A4KA 1I94F 1C1CB 1HQEB 3KK2A 2ABLA 2RQWA 3AH6A 1HBOA 5GAN8 3PYFA 2X1BA 3OW2A 2M4MA 3JTOA 3M0UA 1NAQA 3FBFA 2OPQB 1U3OA 3VS4A 1X5OA 1B0TA 5HSPA 2B0GA 3A13A 4ZGEB 3GMGA 1KLMB 2DPJA 3CD6A 4MT1A 2J6KA 3LYIA 1Q81R 1UGSB 4X4OA 5KFWA 2UXDJ 1EKSA 2YRVA 3GYGA 2CJQA 1DARA 1H641 3OB9A 1EQMA 1L3TA 4USHA 5BXIA 3VQSA 2HHUA 1PM3A 5KE2A 1VHIA 4N8OA 2HIQA 2KYXA 3KJNB 5ITHA 4HT8A 3CVKA 3G86A 2JNGA 1WEYA 3D6HB 2Z56B 4QIVA 1QP3A 1D1BA 3T9NA 3CCSS 1Q82R 1LEOA 3HJVA 1NZAA 1I0CA 4FDFA 4R8UB 3IA0A 2HFSA 5IWAJ 2XGQA 4E98A 3PE0A 1IBCB 3DLLA 1HD0A 4TU9A 1NDCA 4ECVA 1S9GA 3PX0A 2HD0A 2UUBF 1JKHB 1S1WA 2LP5A 1HNIA 4IR9A 5IXBA 2XS2A 4EEYA 1VQLA 2L3PA 2O01E 4A8YA 1XNRF 4DL0C 2DR5A 1KLNA 1UTAA 2FVSA 1DTTA 1U5SA 1BMQB 2N4CA 3IR6B 1S9EA 1SB6A 1HYSB 3MXHP 3EGWB 2QGGA 4YUDA 3CC2Q 3GF5A 4PL6A 3EFOB 1SG5A 3DB3A 2ZDOA 3CBOA 3MZIA 4FF4A 2XKOC 2HQCA 5DQHA 4OX8A 1YIJA 5DETA 2D9TA 4RTZA 3I0RB 3NNAA 1IKWA 4XTZA 2G13A 1QCOA 1J2VA 3QDFA 3V81A 2EKYA 3FIFA 4PWDB 5E7OB 1NE8A 1CJTA 4KC5A 1ZSZA 2I2LA 1XMOF 2DHAA 5LMNJ 2ZWOA 3M0TA 1M3AA 3UT1A 3D6MB 1W2BP 3GJTB 1BK2A 4DV2J 1RT4A 1S99A 5IHIA 1PC4A 3JB9J 1YWXA 4NWBA 4I69A 2VKRA 4C92B 1S79A 2JJ9A 3P8BB 1CULA 5HMWA 3DGVA 4QZVB 2ED0A 1R0AB 4K7QA 4ELYC 2AV5A 5CAIA 5IT9Y 5GAGI 5CA5A 3QAEA 2LDIA 4WU3A 1GCQC 2E6ZA 4ECWA 4Y2MA 2AJ0A 3DHXA 1YITT 1WG5A 4O23A 1WUUA 4JI2J 1HK9A 3HZGA 4DCPB 1VQNA 1YJTA 4KFBA 2PMWA 4WF9Q 2PT0A 3VRYA 3CJ2A 1RTHB 3KUEA 1D3BB 1B3QA 1BWVA 2LQ5A 1VQ9Q 3QO9A 2EPDA 1D9FA 1G2EA 1S97A 3VAKA 4NLUA 3HULA 1NB7A 1NJYA 3RG6A 3EZ5A 5GANf 2F9JA 3LP1B 2KN4A 2UUCJ 2QK0A 2C3MA 5EUHA 5IT9U 3ZZUA 5IS2A 4OMOA 3W2WA 5KYWA 1Q86T 2PE8A 5ETKA 2MHNA 3CC7A 1GMVA 3CUNA 4XPEA 3MHXA 2Y8WA 1KQFB 2YUOA 4IKFA 3G4SS 3JCMh 2DVIA 3UDEA 2CT4A 4YR2A 4M5JA 2HGLA 2FL7A 4IQXA 2JT4A 4BD3A 5D3GB 2C0IA 1Y10A 2XMKA 4RO0A 1X4EA 1B34A 2EQIA 1W2BS 2K6DA 5K8MA 1VQOA 1BXNA 4B17A 2J0WA 1YRTA 4MMOA 1IHVA 3C15A 2HQIA 1WG4A 5DQGA 1D0YA 4URSA 2CQPA 3TA0A 1M2VA 4MKYA 4C0HA 3BQ1A 3M9QA 1LWFB 1DHMA 6AT1B 2VJVA 2RU9A 2L3RA 4JI5J 2JSXA 2DH7A 1RI7A 2H65B 2FB7A 3I55T 3CC4T 4CRJA 1V6HA 3HFOA 5GMKj 4M95A 3OYAA 1YG0A 1Q95G 5EX3A 3LWLA 1UVJA 1I4K1 2LXFA 4NYZA 4L74A 1JLQA 2DE0X 4ZCIA 1MV0B 4GBQA 4C8LA 2JH3A 2JMCA 4URQU 3HFZB 3CMEA 1N34F 3OMCA 4CC3A 5DGAA 3ZTPA 1ZBXA 3QBCA 4UOFA 1VQ6T 2Y1RI 1FWKA 1W6XA 3CCVQ 2RD5C 3GSDA 3PW4A 3KDNA 3GFYA 4WF2A 3GIJA 1YNZA 4FPIA 5A6PA 4U8YA 1K8AT 2EG2A 1TL1A 4HHHA 4IYQA 2MMYA 2QMWA 2E5LF 5KFGA 3H59A 4MFBA 2QYZA 1N36J 2RDIA 2IYGA 3I5AA 4OI4A 2DNZA 2GA7A 1PGZA 4K5SA 1U7LA 4P5NA 5IM0A 3UW1A 5LJ3f 1RQ0A 2MYFA 4D8KA 4TQSA 3BDEA 2MGZA 5JJBA 1TL3B 1VQ7Q 2B4OA 1Q79A 3S7RA 2OUGA 2Z8QA 3PX4A 1H2UX 1KTQA 4KUIA 5A76A 2QDYB 3O5ZA 2E1PA 3UI3A 2HRYA 2RU3A 4PG5A 4DN0A 3HHLC 3UR0A 2AJ4A 2NZCA 1T0JA 2V69A 1JB0E 5F3ZA 2VU5A 1RT2B 3MEEB 1K9MC 1CSKA 5ETOA 3FBCA 3SSRA 5CKHA 5C0MA 5GAMf 1K73C 5J26A 1NU4A 2HFZA 3L1AA 4WTYA 1KR4A 4DG1A 1FKPB 3JTNA 3FGVA 2ZHAA 4JZ4A 4XQ3A 2EGEA 1WTBA 1EJ7L 1J5EF 3A1PA 4DOVA 2JUFA 4TYBA 3VU3C 3RBEA 7AT1B 1EETA 3M55A 1S72Q 4C8QA 3OMGA 3VS5A 2M8DB 3H4DA 3A8EA 5J2QB 3M57A 5KFEA 2K2PA 4CO2A 2ZVSA 2RF0A 2KY9A 3TVKA 1VQKA 3EG3A 3DRXA 4B3MF 3NAIA 1E6VB 4JDSA 2CPYA 4F04B 1A7GE 4OHVA 2EBPA 3QYYA 2M8HA 4NCAA 2PMHA 2RI3A 2DKGA 3AD9C 1KBRA 4BWMA 3GIIA 3HFNA 1YJNQ 2IRUA 2OJ3A 2WSFC 5MAOA 4OYMA 2C22A 4J9EA 1IUJA 2WSCE 4U9RA 4N4IA 2RQKA 1FFSB 1GMWD 1QMCA 3SZ2A 3HT0A 5A2QY 1QTMA 4D3GA 3NMRA 2YX4A 4X4VA 1MW7A 1GT8A 4OX7A 3DFEA 3JCMc 3NCQA 2VC8A 1M5SA 4EU0A 5DLQE 5KFXA 3MDFA 3K58A 1SPKA 4ID5B 5EX0A 1ZHIA 2K06A 3P5BP 2CNNB 4AFQC 1LK5A 1WC0A 3ISNC 2OP5A 5IHNA 2RKIA 4J5OA 2HWIA 5HANA 4P72A 2EFGA 4NXNJ 4KRWA 3D6FB 4YTLA 2DL3A 3H8YA 1RLPC 3OYHA 1CSJA 4FF1A 3VS6A 2DIVA 4PJLA 1TV6B 2A37A 3DLKA 2QEXA 2HZAA 5KE3A 4DPTA 5GANh 1U2RA 4JI8F 2RB6A 1P1TA 2DAQA 1BIAA 2DGSA 3OHAA 2LCLA 2KQWA 1MU2B 5A2QU 1JB0C 4X65J 4LBHA 2F69A 4AFSC 1UPMB 4G1QB 4M75E 2UV8G 1VYUA 1WEZA 2ADCA 5F0WA 3CXCP 1EX4A 2W9BA 3RKYA 2NQPA 2OAUA 2YNGB 3MPWA 3CCLQ 4O0NA 1G4CA 2QFIA 1QD1A 2R7RA 4HACA 2CSIA 1RYSA 4M5HA 4OJ1A 1ZSZC 2COYA 1ZETA 1GXIE 5I3UB 3ELHA 2CZ6B 2CDRB 1UTIA 2Z30B 4NLGA 4FP9A 2M52A 2K1RA 3KUFA 4HCZA 2QLBB 3GILA 1GK8A 5LT5A 5HY6A 3GOXA 4ZMMA 4DR7J 4F4YA 2RI5A 2YWKA 5K14A 3FB9A 3DM2B 2BUNA 5A8KB 1HWLA 1IGQA 3CDBA 2QFJA 4EMKB 4I6WA 4GC7A 1GAOA 2MQNA 2QV6A 3PIPA 2ECZA 4C0GA 2WSCC 1NUEA 3CJ3A 2P5VA 5KFBA 3R2CJ 5DS7A 2OAWA 4R0KA 4LRCA 4PNOA 3RW6A 2DNUA 2HDAA 1WNEA 1I5OB 2X4WA 2LJ3A 4HT5A 1VQPA 1DJ0A 1GBQA 1N5ZA 5KG1A 2A6OA 1T95A 1U2CA 4Z88A 4H4KA 2AD9A 4I2QA 4PEOA 3EH1A 2DF6A 2DHXA 3U27A 5KG3A 2D3UA 4KB7A 4ECXA 3OYNA 3NGKA 2VBWA 3H0PA 3M32A 1ZA1B 4OMNA 5K5MA 4O4RA 2DTHA 3KHLA 4M1KA 3U1LA 4YMEA 1RYRA 2FHMA 3CXCS 1RAHB 2QG9B 3C6UB 2NPIA 3ZNJ1 5HBMB 3G2XA 3MPVA 2V5HG 3MM8A 4M75C 3EGXA 5LJ3h 4M5NA 2IVYA 2RM4A 1Y3JA 1YP5A 3C0CA 2GGRA 2FJWA 1IJFB 3GYNA 1Z4UA 4ZS6A 3A8IA 4O4GA 5EN1A 4CTAA 1SRLA 1ELOA 5A8RA 2DLPA 2HGMA 1UJYA 4LRDA 3M8ZA 2XI2A 3BDPA 1NB2A 1JNZB 2KXDA 2ABYA 4B3SJ 3SD4A 1VQ5T 2DIUA 2WZ1A 3CPWP 1KQSP 1IJEB 1B64A 3VJPA 3LPYA 1F9FA 4KAIA 4TY8B 2AYBA 2ZBRA 4O3RA 1ITPA 1BCOA 1M1KT 1WC3A 3PFSA 2XMMA 3K57A 2RHYA 5FWBA 4RMOA 1VQ8Q 3MMCB 3NEKA 2GVZA 4M77A 3A8JA 4X2BA 1TK5A 1EX8A 2XDPA 4OLOA 2C2ZB 1TELA 2KJWA 5KT4A 4QIGA 1YHQT 4RCBA 2HFVA 3VUZA 1WD6A 3D6TB 1XTDA 3WX8A 4OL8A 3A98A 3H90A 1XR5A 3MAAA 2DB1A 3ASKA 5KYNA 3TJ8A 2JVVA 5D4PA 4L6V5 2LKZA 4J7IA 2DGOA 3BH7B 2MMPA 1LQ9A 3DGPB 4ATOA 2CQHA 3JB9H 1GL5A 3IG1A 1V3ZA 1VJWA 3TARA 2VQEF 1VA7A 4QW8A 1VUBA 4A63B 2JNJA 3GPLA 1PJ5A 1TAQA 1LFWA 2HBRB 2ZJPQ 3NMZC 1X0PA 3V7SA 3OR2A 2CNLB 1WHLA 3S6EA 2BJ7A 3RERA 1FTRA 4K5RA 2D3ZA 2DXEA 3FSYA 1H3HA 3UVJB 2XMFA 4K4UA 2MLYA 4A4HA 4TYAA 4Y2IA 1HXDA 2XHWA 5C6SA 4OYWA 4K0KF 1S1NA 4DEYA 4NZ6A 4PUOA 1N5TA 4QVZA 3D66A 1VQ4S 2KZMA 1FA0A 3SBMA 2JEIA 2K57A 5DG9A 2WVEA 2DD8S 4KV8B 4I4BA 2NUUG 3CPWS 1KQSS 3T1HF 4OZ3A 2HL5C 2RHQB 3WXMB 1ZSGA 2VONA 3M6VA 1VQMS 2R3VA 4BI8B 3CCQT 2C0TA 2GHWA 2D3O1 1FNXH 1Q86U 1HQUB 2B43A 3UATA 2W4PA 2P9EA 1IKVA 1WXBA 5CQYA 3PNIA 4RWXA 4DV7J 1SJ1A 2RJZA 2Y9HA 3NAHA 4HI2A 5FU6C 3KK1B 1YJ9T 2LQWA 3N6LA 4I68A 3VS1A 2FJDB 4QYZJ 3CMES 4C8QC 2QLFB 1R8BA 1MN7A 1Y57A 1R0CB 2GAGC 3BBBA 2FGCA 3NGSA 3NOGA 2FHJD 3HP6A 4ZP8A 2YKMA 3HHLD 1KOOA 2CUDA 5LSOA 3OYGA 3ULRB 1DY3A 1JLAB 2CPZA 4IR1A 4UQTA 2XCAA 5KYUA 3KLEB 1M3BA 3OYEA 1UE9A 4NYPA 1H38A 4G1PA 5L23A 3CMAT 5C2GA 2DY1A 5A8WA 2JZ2A 1NZ9A 3AJDA 4FF2A 3H7HB 4AT1B 3CCVS 2Y4XA 4L73A 1JIHA 4M78B 3PVLA 4I0WA 4WCEQ 1PCXA 4C0OC 5D15A 2VBXA 2OEMA 5E3AA 1FE0A 2RHIA 2W1BA 2CKWA 2JC0A 2YXLA 2BKDN 4DV1F 1VBXA 5JXSA 2GVDA 4OFZA 2VL1A 1GX6A 2BABA 2QE5A 3UA6A 2R57A 4N8NA 1HNXJ 4F4ZA 4OI6A 1FRIA 3JCMe 2YNHB 5EHHA 4C92G 3D67A 1G6BA 1BQMA 1NSAA 4QWDA 1JXLA 4LNPA 5GJWB 3KG0A 2FYKA 2X4YA 1U0SA 4DHVA 1K8AU 3Q8VA 4CYUB 2ZE2A 4DJBA 1XJWB 1NZ8A 5D4LA 1HR0J 4X9DA 1QAIA 2A2CA 2MZJA 1YZ6A 2KXHA 3NMAA 3MM9B 1C1BA 2BA9A 3QYGB 3EG9A 4KSEB 1KJWA 3L7PA 1T02A 3NY0A 2J76E 4MZPA 1T3OA 1FJCA 2R8HA 2DETA 1R6VA 1KONA 4P75A 2ZH5A 2KI2A 4DV2F 3ISND 4ECQA 2NUZA 4FS2A 3LWMA 3DRRB 3L09A 3EUNA 1X9WA 2Q6BA 2JLGA 1M30A 1HLWA 3MR6A 1LFPA 4WZMA 4DS5A 3U7JA 2QLXA 1AZSA 2IYIA 1O8BA 1L3UA 1SC3B 1B0VA 3PM9A 1PJ6A 2PU9B 3V2UC 2XI9A 2G9OA 4BHQA 1KWMA 4FSXA 4F7UG 2HAIA 2WB1D 1RTJB 2I1RA 1BE4A 2DH8A 3LH0A 3ME9A 3JQJA 2BZYA 2EK6A 1VK8A 3MM6A 1XIQA 4WXOA 5L38A 1REVA 1C0TB 2ZH6A 2HWHA 2GIQA 1UGVA 2X1GA 1YJNS 3OFHA 1U48A 4M7AF 3W60A 3IS9A 2EC2A 3M30B 4OX9F 2DK3A 4WFXA 3OSNA 1XTZA 3REAB 2G6FX 1NK9A 4FPRA 2LXUA 4L59A 1ZUUA 4DL4A 3OJSA 2B8PA 5IAYA 2QX0A 3I6PA 1WDDA 4A48A 1NHUA 2ATLA 2ZDPA 4AQYF 1IHWA 3PIOQ 2XY5A 3IR5B 5CAAA 1TMMA 3Q22A 4GC6A 1VMBA 3VVUA 2HMIA 4WWSA 2CADA 3OYCA 1PWTA 3HHTB 4ETXA 2BZ8A 3IAM9 1J5OB 4H4OB 2OTLT 1CKBA 2J9DE 2RIJA 2PTKA 3TUJC 5GMKm 4RNMA 3E3XA 4PWWA 4C0ZA 4DX7A 2MKJA 1UGRB 2F63A 1FX7A 2ZFHA 1O6XA 3I56Q 4K11A 2ASYA 3ER0A 3BKUA 2DL8A 4DDFA 1XWLA 2V8VA 2DGVA 3RU0A 1S6OA 4PJOB 3CC2A 2VICA 3KJQB 1C0UA 3MGJA 1Q53A 4YDXA 1JXMA 1SKUB 1T3LA 2HZVA 3V6DB 4DSFA 2E5KA 3HVRA 3M2RA 1N6QA 3CCMT 1RLQC 5DLOA 4GO5X 4NLOA 2QI2A 4O0IA 2KT1A 1L3KA 2J9CA 1TWBA 1QVFR 2ZAEA 5JMNA 4L3NA 3RAXA 2RF2A 2C3UA 3A1YG 1X7VA 1PKTA 3OBWA 2RJFA 1U1NA 3V8LA 2CJKA 2H48B 2Z58B 1PKSA 2VD3A 3UWNA 1Q86R 3QPIA 1GFCA 2GTJA 2B8AA 3MEGA 4RBVA 4C92E 2BE2A 4CWBA 2Z4PA 5E0OA 4ZGJB 2ASDA 3KG4A 3IXQA 2RT3A 3I87A 4BCAA 2LQNA 4ESRA 1LWXA 1SC4B 3OUYB 2KT3A 4II1A 2UVWA 4ANJA 3G6YA 1HNWF 4OMFB 4Y28E 5D6GA 4LF4J 3G71Q 1T7PA 3CJQA 5CXTA 1FD2A 2ZPEB 1GTEA 2FLNA 4QVDA 4X4NA 1CJVA 2W2OP 1NLOC 1EARA 2N7CA 3GZ7A 2I5JB 3X3UA 4DQRA 1WHJA 3V6HA 2RQTA 1VQ9A 2BW7A 2LCCA 4TLRA 5GANe 4NL3A 3TWZA 1UJ0A 2MEWA 2JC1A 4DU8A 4RWWA 1SHGA 2JL9A 4IG3A 4DV3J 5A6WA 1VIFA 1ZTTA 4JZ3A 4A8MP 2BACA 4RU2A 1AW0A 3FEYB 2UUAJ 1HPZA 1IO6A 1D9DA 3CB4A 2ZPBB 3FJ5A 2BTTA 1R7IA 1JQGA 1K9MT 1TL7A 4DUZJ 1LWCB 3K2YA 4C3KA 1K73T 2M70A 1DQ8A 2AQ4A 4R25A 4C7QA 1KKHA 3OHBA 2FVCA 1EP4A 4ECYA 2DIGA 4NMLA 1DJ7B 2HAFA 2VB6A 2EGCA 1RE1B 4USMA 3UNGC 2M9KA 2QQAA 4ED1A 4PYAA 2VXEA 2XS7A 2EI5A 1K76A 1Y0HA 1TUCA 1ZQ1A 1IR1A 3HVWA 2W01A 2DA9A 4ZP7A 1AYEA 3HXMA 2NR0A 2J9EA 2C3OA 4WP8A 2JLEA 3KLGB 2O5DA 3AFGA 3O1LA 5KFZA 5KFRA 5DDOC 4USKA 1N32J 3CD6T 3MM7A 3RJMB 5EG2A 3VTIA 2K2VA 5FU7B 1KC8T 3M1VB 3OYIA 4JUVA 4VUBA 2CUYA 1PHTA 1TZ0A 4NRUA 4OZJA 1FMWA 2BQRA 2DYIA 5HQLA 1WHWA 3I82A 2RB7A 1NCLA 1SKSA 1X27A 2QQBA 2V2VA 1JLFB 3LPEA 2AZSA 1XK8A 4YN3B 2RS8A 1M1KU 3IS9B 1WKLA 2I8EA 2QYCA 3OFFA 2CPFA 3PY8A 5KFJA 1R8HA 2X7IA 3QIDA 2VV5A 2CH4A 1AUSL 3KJVB 3WIVA 4M8LA 4NMXA 4CLLA 4PPDA 2DJQA 1RISA 2JS2A 3RB0A 4ZN3A 4F4XA 2MZ1A 3GJQB 1UJ5A 4CT8A 3W65A 4A53A 4C8QD 2HNYA 3TYTA 4Y2AA 3DLBA 3QDRB 5I21A 3N5BB 3L9ZA 2IC3A 1JLBA 4FW1A 1ZZFA 3NS7B 3TAQA 3M8PB 1VQLT 4E7HA 5E41A 1WACA 3J80Y 1D0EA 2GTOA 2QYGA 2Q43A 1HI8A 4ZCKA 5LJ3e 4KYZA 1PO6A 4LUDA 4HCCA 2D1XA 4PQUA 4Y92A 2R7TA 4X65F 1XOVA 4M5DA 5LL6d 1NH8A 2C28A 3MURP 3JB9k 5ETLA 1AFJA 3VAHA 1JJ2A 2ZJQQ 1NPKA 1QDUB 1X31C 5A0DA 1KD1C 1VQ7A 3VHQA 3CJTA 3LANA 3LGHA 4F7VA 1RABB 4IUTA 1YIJT 2EBGA 4PCQA 1TKZA 4WCIA 1VLOA 3EPGA 2MIOA 2MJNA 2KB2A 4UW2A 4FNIA 3TJ9A 3DU6A 3FCWA 3R1HA 3TVZA 4QU7A 2E6NA 2B5JA 1B7FA 4LDXA 1PAUB 3J80U 2PGCA 4H4MA 3V4IB 2UUTA 4M5LA 2DXTA 3QLHA 4TN2A 1N33J 3D9BA 2C1EB 3D1OA 4DFKA 4DR7F 4M7DA 5GAHU 2P0PA 1SV5A 4DV4F 3C6TB 3EZOA 2SEMA 4M94A 2HHQA 5KFIA 1MSWD 3PHTA 4ITSA 2VG5A 4W90B 3R5BA 4KE5A 1WF2A 1RAIB 1VGYA 1WI7A 3O3LA 3HVTA 1Y7PA 3T1YJ 2ZZDA 2E65A 1JO8A 1JXVA 4LFBJ 4V19X 4J9QA 3CCRT 1VQNT 1SXLA 3EGNA 3L2ZA 2VG7B 5B0BA 1T9YA 2FRYA 2VG6B 2QJ3A 3QWYA 3CCUA 2DXUA 2HL3A 1B99A 4OYOA 3L2QA 4DLGA 3CT9A 5CD4H 2YNFB 1VC0A 5C24A 1Q7LB 3T5HA 1Y96B 2HRUA 1HSQA 2HLTA 3M2VA 2AP6A 2XY6A 1KHIA 1UFFA 5FLXY 3CPFA 3Q8PB 4LVOP 4UZBA 2DERA 4CRIA 1DURA 2R7SA 4C8QG 4WFBQ 3OFGA 3K5MA 4IURA 1QTNB 2O4XB 3CC7T 3I55Q 1NEGA 4ES2A 5AE1A 4F02A 3CC4Q 5FJ4A 3SQGB 2XULA 5LSLA 3RR8A 3DMJB 4HCKA 2CSQA 2E4HA 2XY7A 2DITA 2ZEJA 4PAAA 3CMQA 1RDRA 3OYYA 3ET6B 3PRVA 3G6EA 3DN9A 4WE1A 1P27B 3SCLE 4CDIA 4JYAF 1NHKL 1JLEA 1VQOT 1QVGA 3BPSP 1K0VA 2OD6A 4NCGA 3KNAA 4ILLA 2I38A 4DR3F 1QE1A 2L9WA 3C8YA 2U1AA 5HJXA 2ZH3A 2VFTA 4AL7A 3GV5B 1T9TA 1DFDA 4ERDA 2MF2A 2IG0A 4DR6F 2NYHA 5L9XA 2JVOA 4DPXA 1QM9A 3QT7A 4OGCA 1CPZA 2NSCA 4XAKA 4Y6IA 4QR1A 2CQGA 2HHHF 2AEMA 5CYMB 2FHKA 2AYGA 1SEMA 4J6XA 2HEQA 4NZ7A 2D7SA 4CI0B 4DV5J 2LQKA 3OS5A 2DIQA 4CCHA 4JI3F 4B3OA 3X25B 2VODA 3WQPA 2FZCB 1KNZA 2HNZB 3JQKA 4DMZA 3GIBA 3GNGA 4X84A 3J7ZT 3W9IA 4TU8A 4E7SA 5HCKA 4LUBA 2WTFA 1M90C 1BYMA 1ICEB 1FEHA 1XBWA 4C11A 1TL4A 4QVCA 2LT1A 1TFYA 1YK9A 2NCKL 3SFUA 1IBKJ 3Q24A 4O3PA 5H9EK 4OVAA 1M1KR 4J5YA 1E6GA 1N48A 3DOLA 1RT7B 4BDZA 2A3JA 3I5SA 4M77D 1JK9B 2G4BA 3J7AF 1U1OA 4NLTA 1BI1A 1PBAA 1MWYA 3UQSA 3SMZA 2VASA 4PLLA 2YT6A 4JP8A 1QUVA 3UDLA 4FIBA 4DUYJ 4TU7A 1CJKA 1FJEB 3B78A 4AFFA 3BSOA 3TNVA 3NNCA 4OP0A 5ETSA 3I56S 4QR2A 4Q2MA 2GIRA 3R3TA 1VR6A 1UCNA 1TFWA 1HBNA 3ZXWA 3UD3P 4CH7A 4WFZA 5LMUF 2XICA 2GX8A 1VI7A 2J7KA 3WDOA 4DV7F 2UZAA 4JI1J 1NK5A 4ED5A 1RT3B 2R5MA 1E6YA 4Q0BA 1S12A 3QGHA 4LIRA 1RCOB 3VGUA 2GFFA 3LH5A 4K50A 2P4TA 1FNOA 4LR8A 4J91A 1GFDA 2KXNB 3EVOA 4V2SA 2MKKA 4FXVA 4CO4A 4JI4J 4P2MA 3LGMA 3FDSA 1X9SA 3DU5A 1VQKT 1R43A 3MR2A 3IR7B 1HW8A 1IZ6A 4OMLA 2KYMA 1UEUA 3R8YA 3W64A 2JN0A 5LL6S 1YI2S 1VQ8A 3BKTA 2OSRA 3QZ8A 3FCVA 2M1HA 4U8VA 5GAHI 2CWXA 3LP0B 4EBDA 2HBWA 5FDLB 1RB0A 4BE1A 2OPRA 2RH3A 4EMKC 4R0JA 4I56A 3N28A 1H98A 4DSKA 3TA1A 1S6PB 5B09A 1M5VC 4J83A 2JFDA 4IFYB 3BH6B 2GQ2A 3QATA 3HHNB 5B0CA 3I31A 1TKXB 1UB4A 1LW0B 4NLVA 4X66F 1WSVA 3G71S 4RKUE 3L7OA 1RJJA 3OLAA 1N5SA 3FBBA 5LJ5f 3FKBA 3PRDA 1PYOB 1HL6A 5C2CA 1OU8A 1Q81C 3ZFVA 2KBTA 3ICLA 1IBMJ 4GRSA 3OL7A 2AKLA 2QA4S 3S01A 1APSA 2FZGB 3FJ2A 2CJYB 1S1UA 5J2MA 1OULA 1S9FA 2EIFA 2O31A 1R31A 2F3JA 1Q7YT 5I3PA 1RADB 2QEXT 4JI7J 4FCYA 3MKDA 2OTJA 3DC2A 1KHWA 2CP5A 4M77G 4WTOB 3UA7A 4IDKB 1UFLA 3GJSB 2J6OA 4HL9A 1WKJA 4LSZB 4DV0F 1JMTA 4N76A 2EFOA 5KFLA 4JI6J 1NK7A 1Y5IB 2LFVA 2QSFA 3UPUA 4OV6A 5KFVA 3M56A 3OTEA 1RTIA 3AQPA 2GMLA 5J1EB 1S1TB 1TVRA 1S7IA 2EYQA 3AODA 4X34A 4F4AA 3LH2S 2V4RA 1UUEA 2J7WA 3Q86A 2YKNB 2NUPA 2RRAA 1X5PA 1FESA 5K8OA 5J2PB 2DEUA 5GAOp 3A3OB 4E47A 2KE9A 4M75F 1RAEB 2BJ3A 2LCWA 1K9MU 4UQGA 2YNIA 1ZM4A 4PPZA 3MPUB 3HRSA 4KPCA 3QIIA 1K73U 2GO9A 2MY7A 5I42B 4M7DC 1WJRA 3JXOA 4IOCQ 1D8YA 4IUUA 1IXDA 1M8VA 2ZBPA 3QJJA 4KGZB 1CJUB 2B56A 2DRKA 4C0DC 3HZEA 3MEDB 4M5IA 2UU9J 2HIYA 3FDRA 3HRUA 2KI7A 2MZTA 3HHDA 3R97A 2FIUA 2AZ3A 2PFDA 3NTHA 3RR7A 5HJYA 1WHVA 4XPCA 3US5A 1U8WA 2HS3A 1P8GA 2GFUA 3Q8QB 4ME7A 4RKUC 5L39A 3QBYA 1TS9A 4C4WA 2QTVA 2QT7A 3CCJQ 4RW9A 4OJGA 4X64J 2JJ4D 2IAJA 1IKYA 1VQPT 2JEGA 2ZCFB 5CYQA 1SIWB 2ROPA 1RA6A 1KC8U 4M78E 4GMKA 5IXUA 2DKOB 2ED1A 2CAJA 2WHOA 3AOCA 1VYTA 2VKZG 4WBFA 1WJQA 1VQ5Q 1I81A 3J7YU 3TX8A 2QQSA 1I3OB 3C19A 3DLGA 2E9ZA 3CO0P 2L9DA 1WOSA 1F2GA 1FNMA 2UXBF 2PDAA 3THKA 3L3CA 4U95A 4KO0A 4M7AA 1X4DA 4JV5F 2FPEA 1S76D 2GMHA 3NNHA 3MUTP 3A8LB 4KTQA 4DV6F 2LVMA 1T3SA 1S0OA 4OYAA 4RBTA 3IRXB 3EE3A 3TVYA 2ZH8A 3TEEA 3KHGA 1YITS 2C42A 4J8OA 2QA1A 2YX1A 4LF8F 1T0HA 1RK8A 1RT1A 1N5YA 2KJVA 3A5ZB 1Q5VA 1E6YB 4FXWA 3MO8A 2JX2A 5K20B 5J2NB 4K4WA 4WJBA 1E7OA 4USWA 1RKJA 3TSWA 4KGXB 1S0MA 2LMJA 2V67A 3CCSQ 3L7UA 3NP5A 3IWLA 3OYMA 1ZBTA 4ZPVR 1AB8A 4A8SA 4E2FB 4MJKA 3PMTA 1PCAA 1PJ7A 1N9SA 4Y2CA 3DLEB 1QVFS 2LMIA 4C6AA 4FXDA 3JCMd 2VQFF 4RW6B 3THPA 4RW4B 4USUA 3EDRB 3I9QA 3I5RA 2DPIA 1HI1A 4NL2A 3PW0A 2D3OR 2YKQA 3V7CA 2VDIA 3OQ2A 4G6VB 1K0SA 3H6ZA 2M2BA 2AEJA 3NWGA 2XMTA 2DNPA 1A0NB 1T9UA 1VIEA 1NKEA 4C8QF 1TR0A 5F3TA 2R2SA 3SEOA 5C25A 4M78C 5THWA 2HBQB 4NPOA 2YVSA 2XB2D 4KHPJ 2IJNA 5H9FK 1WHKA 4WIIA 2P2CB 5KT7A 2W2QP 1VRTB 3B82A 4OI1A 3HSDA 3CCQQ 4YHHF 4ZK7M 3FQKA 3ZTOA 3DRPA 1OOTA 1D3WA 5J2MB 1MROA 1VISA 2ALYB 4F4KA 2FGOA 5LJ5h 1VRUB 2VFRA 3RB6A 1GEHA 2V4JA 2F1FA 4YQWA 3I55S 4RUGA 3CC4S 2YBVA 1YJ9Q 3W8GA 1X69A 4XU2A 2O1PA 2EFVA 1SKWA 2G2OA 3D2WA 4N4GA 3GFHA 3IP0A 4DR2J 1KS2A 5D0GA 4OIXA 2BJ1A 2K8GA 3A12A 2FJVA 2MLXA 2V63A 1WJSA 4L72B 1FWPA 3CBMA 1IXKA 1VQ6S 5HO4A 1LW2A 4PJOE 2BZXA 3UN2A 2ZNZA 4XTXA 4LF9F 2OELA 2J06A 4F26A 4W92B 3SWNA 1BQNB 3PYEA 5BYSA 1UWBB 1JLGA 3CMAA 5C42B 4P7TA 1UHCA 3OS0A 2MQMA 2B9YA 5IT9E 3DOMA 1CVJA 5CQGA 3W2VA 4A8WA 1OV3A 1R8AA 5HLFB 5CVIA 5DLFA 2QRRA 1IBLF 2PQWA 3B4DA 1DLOB 3BGRA 1G2BA 1K9MR 4I7FA 4LF7F 2EG1A 3TA2A 1VIXA 3V5RA 1YJWA 3E9GA 2L5QA 3CCEA 2ZD1B 3M8QA 5T7LB 4M5GA 4IO9Q 3QSUA 3M4YA 2DNKA 4K8RA 3BW1A 1S1VA 5LM7E 1JRIA 3CDWA 4ZDNA 4NI2B 1T03A 1VK3A 1LOUA 1Y5NB 1TH7A 3ITHB 2HQFA 1FVSA 5KFDA 1TSFA 4ZHRA 3OYKA 2CG4A 2F2XA 4Y3CA 4OI2A 2UP1A 4ZCLA 2V1RA 1JXOA 4LFAJ 1FXDA 2F9DA 1YDLA 2E7WA 3G8QA 4N0AC 1G5VA 4OYZA 5HROB 2NLWA 4IIMA 4O3NA 3NTIA 1P6TA 3EGZA 3BJYA 2H4WB 4LF5F 2DGTA 1S48A 2IM3A 1WOPA 3GSIA 2GQIA 4HKQA 1QSLA 2DXCA 2BM0A 1KC8R 3L4BC 1CEZA 1HNVA 4B9LA 1ACMB 2MAMA 2IA0A 2XTJP 3OR1B 4R5PA 1LWEA 1X8DA 1PNJA 3RIRA 4ZITA 1SUQA 3J7YI 4B9NA 2P9CA 1UAWA 3BO2A 3MM5A 4CC7A 1FXRA 3SEMA 5D7UA 2KHCA 3CBPA 5HI7A 1REGX 2AX1A 3V4MA 3MOZA 3C95A 1FYNA 4PJOC 4MK8A 2DR9A 1XEZA 1RWOB 4LDUA 2ASJA 1QY7A 2U2FA 3NHNA 4F0KA 4ANDA 2EVRA 5F41A 1NPPA 5IOLA 1IQZA 4IO1A 2QTXA 2XCPA 1HBMB 2E9TA 3FBEA 1DZ5A 3GV7B 1YSJA 1QSSA 4XAXB 2Z2LA 4MIWA 4E6RA 2PSZA 1UG1A 3UD5A 4J9UE 3LD7A 3T1YF 1WEXA 2DM1A 4B3TF 4O6JA 2DR8A 3WX4A 1RSCA 2JW4A 1YBUA 4JUZA 3M05A 3UD4P 5GANg 1KSWA 1G83A 2ZWPA 5BYRA 2UUWA 2FY1A 3Q8SB 4FBUA 4KUDK 3OY9A 2OFGX 4DX8H 2OTLQ 1UEVA 1PBUA 3OSVA 1WLPB 4IUFA 2N4DA 2XMVA 2MJUA 4URGA 2WOMB 3LP2A 3R2DJ 2EFIA 4KBMB 4X62J 5AJ3J 2XBPA 1J27A 2OPSB 4A4EA 2MWPA 2JHEA 3EGDA 3Q2TC 4PXCA 5IZHA 3ETMA 4PYDA 2FJAB 1D1UA 4M7DD 4ZTFA 4ZOSA 2C2MB 2P0KA 3GBQA 5ETVA 2CG8A 2M3DA 2DYAA 2ATCB 1HD3A 2UXCJ 2CPIA 5HK0A 1FE4A 3FFIA 1UVKA 1U0HB 5ETPA 4YB5A 4ES1A 4ED7A 4C8KA 4LDYA 1ZTWA 4IOBA 2NYIA 3I9V9 2RD1A 4JRIA 2KYZA 1S1XA 2LQ9A 4TQRA 1ARKA 4ZPAA 2C0OA 2KH9A 1DAXA 3HF5A 4OB3B 2CQBA 1M5OC 1MMLA 4M7AC 1FHTA 4PKCC 2VOOA 9RUBA 5ETRA 3DRSA 1B3TA 1N88A 2HYIB 2BDPA 1FEEA 3CC2T 3AOAA 4ELZC 1FRJA 4IUPA 1FX2A 2F4FA 4HVUA 3T5LA 4ED0A 1Q7YU 3FLGA 4XDDA 4EGLA 4DSLA 2FC9A 3DOKB 2LTOA 4MKAA 1OSDA 2XM3A 1NLKL 1QLYA 3JCMV 4GKJF 4ZLLA 5LOQA 1NM2A 1DQAA 1OIAA 1AZGB 4EUVA 1NBEB 1EIYB 2W9CB 2LRQA 1C1AA 3CJKB 2GGPA 4HVZA 3VUBA 1U1TA 2IM1A 2QTWA 2K79A 1WWHA 5GMKl 3KLIA 2XGPA 3OVAA 2V8DA 4JI0J 2HEKA 3ENWA 3PKYA 2FVRA 2NUHA 3EYZA 1TMJA 3S6WA 3P49B 3EDQB 3JSCA 2K5LA 3IFEA 4ZLPA 1PAEX 4QWBA 4X4QA 4LVNP 1M90T 4ZVRB 4IG0A 4F8RA 5LJ3g 4ESNA 4PG7A 3BKFA 5A2QE 4LF6J 2MDAA 3M2UA 2FTRA 3X20B 2M0OA 4XK8C 3THTA 2FVPA 2W25A 3VV0A 3PCOB 1YJVA 2E5IA 3ZZZA 4Y00A 3CCJS 2BKPA 4DQQA 2BQ3A 2CQ4A 3H41A 3BBCA 3BV8A 3CJ5A 1T05A 1ZAVA 5F8IA 4CLYA 1QP2A 1IR2A 1VQ9T 3O8WA 1IKXB 3ENQA 2RSQA 4IRCA 3KBGA 4LR9A 4XTTA 3MCAB 3G82A 3W5YA 1M0SA 2Q1LA 4OZ2A 5GAMg 3HL8A 1VQ5S 2GNKA 2EFPA 5KFHA 3WHIA 2D8JA 4E7LA 4C3MA 4N4HA 2ZNYA 2AF6A 4DR5F 1NKCA 3TAMA 2H5JB 4WK1A 3BR8A 1FO1A 3MECB 2W2NP 5F8NA 5HP1B 3S1TA 3CD6Q 3OTOJ 1GXLA 2DYBA 2XYPB 3MR7A 4DBFA 4FL6A 3DI6A 4NLXA 3NGRA 4JI1F 1H6KX 2O67A 5KOWA 2EQKA 2BJ8A 2YPZA 1YHQS 5FRNA 3LTOA 3I4PA 1RT6A 2ZOFA 3MOJB 2RQUA 1IGUA 5GAOl 4LSLA 3NG8A 3KLFA 1NM7A 1BLUA 3C16B 2RMLA 1U4BA 2KM8B 2WB4A 2NUTB 1UL3A 4CLKA 1R6YA 2XSJB 2HNDB 1RTDB 4Z37A 3OD2A 4PRFA 1X60A 2V68A 4QQBA 3SWNC 4C5HA 2K5FA 1WC4A 4ZNXA 4J6WA 5E2QA 1NSPA 3T3FA 2WONB 3L2UA 4YY3J 1U6BA 1VQLQ 3NS5A 1PSFA 5L9NA 1XMQF 2FRWA 3G87A 1RI9A 1HWUA 2JEJA 4L76A 2HZCA 3FEOA 1Y5LB 1OMSA 3M4XA 2HSPA 1JJHA 3E01B 5H9EJ 1OY6A 1X5TA 5I4MA 4WFAQ 3MWBA 4A8FA 4L5GA 1RWMB 3UF4A 2CVEA 2LA6A 1Q81T 2ZBIA 3M8YA 1H3ZA 5CD4A 5KOXA 4O44A 1Y9OA 3OSPA 4GKKF 5L8RE 3LQVA 1JBMA 2D9OA 2QQ9A 1XNQJ