1NPRA

Crystal structure of aquifex aeolicus nusg in c222(1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nprA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nprA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nprA01
1VQ5A 4YTLA 4X34A 3OW2S 3CC4A 3G71T 3CMEA 2JVVA 3CMAA 3CC2T 1VQ8T 2EXUA 3JAME 1SSFA 1VQ9T 3DB4A 1W2BA 1K9MC 3HKSA 5A2QE 1JJ2A 1YI2T 2LQ8A 3CCJT 3CCLT 3H7HB 5FLXE 3DB3A 5J3BA 3CC4T 1QVGS 3CXCS 2OTLT 3J81E 1VQOT 1K8AU 3CCQA 2QA4A 3EWGA 3ER0A 3CCST 1M90C 1Q7YU 1NPPA 3KBGA 2OTJT 5IAYA 1M1KU 1NZ8A 1NJIU 3CCVA 1XTDA 1QVFS 3CD6T 3LPEA 1KQSA 1VQNA 1Q81U 1VQOA 3G4SA 3G6ET 1Q81C 1M1GA 2XHCA 3CC7T 1IZ6A 2LCLA 1VQKT 3QQCD 1KC8U 1NZ9A 5LL6S 2OTLA 3OW2A 2JUFA 3P8BB 1VQKA 3J80E 1VQ6T 2KVQG 5HY6A 1YI2A 3CMAT 1M1KC 3CXCA 1Q7YC 2JOYA 1VQPA 1VQLT 1YIJA 3I55T 2OUGA 4TVRA 2MWPA 2KDSA 4ESNA 4ZN1A 1QVGA 2JNGA 3G6EA 3CC7A 4OBIA 3CCMA 1Q86C 1VQNT 2MI6A 1M1HA 1VQMA 3OYYA 3I55A 1K73C 1KC8C 2QEXT 1YBYA 1VQPT 4CRIA 3CCMT 2G3RA 1N8RC 2L3RA 1QVFA 3CCJA 1KQSS 3PIOA 1VQ6A 1VQ7T 1YHQT 3LD7A 1UEBA 1YJ9T 3CCET 4RG2A 3CMET 1NJIC 2KPPA 1Q86U 1VQ9A 3J7AF 1YJWA 2EIFA 3TREA 1K73U 2QEXA 3CD6A 3CCVT 1YITT 1VQMT 1X6OA 3G71A 1KD1C 5DM7R 1N8RU 3G4ST 1KD1U 2K06A 3I56A 1EIFA 2E6ZA 1VQLA 3CCQT 2QA4T 1K8AC 1Q82C 1S72A 1YJWT 1BKBA 3CCRT 1VQ4A 1W2BS 3DLLA 3CCUT 1RL2A 1JJ2S 2IG0A 5DLQE 3PIPA 1YITA 1KHIA 3CPWA 1M90U 1XNIA 4QQDA 3CPFA 2E70A 1YHQA 3CCLA 4ZN3A 3LH0A 1K9MU 3CCEA 3CC2A 1YJ9A 5J26A 3LGFA 1VQ5T 2MWOA 1VQ7A 5IT9E 1VQ8A 1YJNT 3CCSA 1Q82U 3CCUA 3CCRA 1VQ4T 1S72T 3CPWS 1NPRA 2DO3A 2OTJA 1YJNA 1YIJT 2LVMA 3LGLA 3I56T 3A5ZB 2CKKA
chains in the Genus database with same CATH superfamily
2CQIA 2VL1A 3A8IA 2OTLS 3OYEA 4KY3A 2P2CB 3OYMA 2FHJD 3FEOA 1SH2A 5DGBA 1CS4A 3J7YU 5CK9A 2B51A 3KLHB 4O3NA 2KK4A 1V5VA 4X66J 4HCKA 2B5JB 2YUOA 1RTHA 5IZHA 1SV5B 5CKFA 1RTJB 3EGXA 4ATNA 1D3BA 1IGQA 4NXNF 1TS9A 2CUYA 1MMAA 1A0NB 1TKDA 1FEHA 2XYHB 4ED3A 1SJ1A 4OMPA 4DPYA 1LQ9A 3QT6A 2R9LA 3C19A 5C24A 4ZOSA 2HSEB 3V7CA 3K17A 1SB6A 4X4SA 1SVDA 2OO4A 5B09A 3KJFB 3FQLA 2DIGA 5F9LA 2HFOA 2RO0A 2ZCFB 3HFKA 5HMZA 4NCAA 4X4UA 2CJXB 4FN5A 1YRXA 1B07A 3CCUQ 1S1NA 4NL3A 4IG0A 2I1RA 2VQFJ 2X4JA 5KFEA 1OWXA 4WZMA 1VQ7S 1RI7A 1EB0A 1DURA 4USKA 3FDSA 2NUZA 5KG1A 1K44A 2BXJA 4PJOB 5GAGI 4LF6J 3H90A 3SMZA 4JP8A 2MDAA 3KLIB 3WHIA 5LMUF 1K1QA 3PX6A 1R0BG 1S7HA 3TA2A 2BOPA 3A8OB 2O01E 5IHKA 2PFDA 3UA6A 4M75A 4IH5A 4JYAJ 2QGFB 5H9EK 3GB0A 3MR2A 4PUOB 4WBFA 2HFNA 1TL1A 1I5LA 2O88A 3MEDB 4AL7A 2EEYA 2KG1A 1AWWA 4N0AA 4DWIA 2NUHA 1CEZA 3JQJA 5IWAF 4ZA1A 3OBYA 1NK5A 1T9UA 4YFUA 2QQRA 4N56A 2ZPGB 3FSYA 3EE3A 2GQIA 1VYVA 2FL7A 1TUWA 5LL6S 4ZVRB 2XTJP 3H0PA 1SJ4P 2CPJA 5BYRA 3N4WA 4FPRA 3ITHB 5IT0A 2O3DA 4JOUA 2ZJPQ 4NA1A 1NZAA 3VQSA 5F9NA 3W3SA 3LGHA 2GNCA 2DHAA 5D6WA 3NRBA 4LR8A 4NZ0A 3QJLA 3NNAA 4EMKA 3IWXA 3RB6A 3SCKE 2VPWB 2K3KA 2M52A 2QA4T 1NU4A 1Q82C 4IKFA 2EQIA 1RT5A 3WC2A 3GNGA 2E1MC 3TQEA 4OGEA 5KFCA 4B9TA 1JMTA 3BV8A 4CCHA 2Z8QA 2CH4W 2QL5B 4OI4A 3OW2R 3K0JA 1F2HA 3AJDA 1CJKA 1NJYA 1H98A 3CPWS 3CWJA 2ZHOA 3VS2A 3TNVA 2NR0A 4OB0B 5GAMd 3MDFA 4ITSA 3GPLA 1FWLA 1GCQC 4U7CA 3G6XA 1VQ4S 3QT8A 4LDWA 1U4BA 4FNIA 1SHFA 4F4KA 4GKKF 1RI9A 4K59A 3OTOF 2CQ4A 3HHLC 4PWUA 2V67A 1SF9A 4HDHA 2WB4A 3CC4S 4AFQC 1S1UA 4NL2A 3G4SQ 5KFOA 4OJHA 3OJUA 1VIFA 1TKXA 2XIDA 1AZGB 3ZNUA 1BY9A 1LXJA 1MV0B 2EWNA 4M7DC 3AODA 3KJNB 4ZN1A 1AFIA 1FJCA 2KYZA 3FBFA 4F3MA 4KPCA 2QASA 1DZ5A 4HT7A 1UTAA 3DXBA 2UXDF 4N8OA 5IC4B 2ASLA 3X3UA 2IBOA 4IH7A 2IDEA 4WK3A 1TUCA 1UECA 9ATCB 4M7DE 2LTOA 2JS2A 3Q83A 4NA2A 1QKWA 2LA6A 4LRBA 1TKZA 3JQKA 3L2UA 2JEIA 1AROP 2E29A 4IDKA 1T03A 4HI1A 1ZHIA 3MECA 2RS2A 1N32J 2RJFA 4ORZA 1HYOA 3B4DA 1K1SA 2P84A 3UPFA 3GOXA 4H4KA 4OFZA 2OPSB 4HT8A 2XLJA 5HROA 3O8WA 1WNLA 1MUZA 3C95A 3H2VE 2LT1A 1JLEB 3N5FA 4DN9A 4LF9F 1YDLA 3C12A 2X35A 1RISA 3BF4A 4II1A 2DNQA 3S3OA 2GW8A 4P9SA 3NFCA 1M0SA 3DLKB 1JLAA 3TUPA 5DM6Q 4CC3A 3CCLT 2YQ2A 2HMIB 3MM6A 4IUUA 5GANh 3OR1A 2V68A 1RGVA 2JEFA 2QC3A 4B9NA 1TSFA 1D0EA 2A28A 4U8VA 4DSFA 1FNXH 4O3PA 1RAHB 3UNYA 5LM7E 3CJKA 1XMOF 3VVUA 4RW4B 2YUNA 5K20B 1NLOC 3PVLA 1HHTP 1SQEA 1S7IA 2L2PA 4C8MA 2G2ZA 3I5AA 3MEAA 4RTTA 1NH7A 4QU6A 3OYCA 4UF4A 1SC3B 2XMVA 2CP7A 2R2RA 3EZUA 1ZZFA 4RBUA 4CYUB 3PIOA 4DPOA 5GAOq 3PGGA 1C1CB 2GA7A 1IQTA 1ARKA 2LEPA 5KYXB 3CEDA 1VYTA 4RNOA 3ISND 1M5Q1 4R8UB 3EDQB 1ZH5A 2RD1A 1HBMA 1JLBA 3D4JA 3QZ7A 1TUGB 3BSNA 1XNQJ 3DLLA 3TW0A 4DLGA 2ZEJA 2FY1A 3MEEA 2MZ1A 1H3DA 3SBMA 1HD1A 2XS5A 2GAHC 2DGXA 4LF2A 3CGIA 4JRPA 1RT6B 3N28A 4Z89A 2CP3A 3ZBDA 3UWTA 5HP1B 3BYRA 3QBCA 2DY9A 3C14B 1IQZA 1VFJA 3KXTA 1HJDA 4L6V5 4GKJF 3M8RA 4LIRA 3W5YA 1EKSA 1SI9A 3W65A 3JAMY 3OLAA 4X65F 2Z4PA 1K9MR 3OS1A 3M9NB 2WACA 4LFCF 1DTTB 1FKPA 1REGX 4DUZF 3M55A 1Q4RA 1PRLC 4DV7J 2LZ6B 2DXFA 1Q7YT 2XSFA 1J5OB 1J2VA 4ZPWR 2QMXA 1X9SA 3VZIA 2RDIA 1MSWD 1P9YA 4RUHA 3RR8A 3MXHP 3CE8A 3CCJA 2FHJA 1LWFA 3CCZA 4LMZA 3I82A 1S0VA 2W24A 4B02A 3CCET 3OR1B 5GAHU 4LBPA 3GIKA 2EQMA 4QW9A 3G9CA 3RMSA 2PVOB 3CQTA 4KH1B 4QR1A 3AB4B 2JT4A 1OJ4A 4ZP6A 2V8HA 2V2QA 5HATA 2JL9A 3GMGA 4LSNA 4C8QE 3N6LA 5GMKe 1C1CA 3AD7C 4XDCA 2BE2A 2YQ0A 1SKRA 2DNOA 2QA4S 2GIFA 3IO1A 3FBEA 3RW7A 3I56S 2K1RA 3C0CA 2DBBA 3QPHA 4DUZJ 4F2SA 3GFZA 4DV1F 3UDLA 2ZM6F 5I3PA 2LQNA 3JTPA 4DQRA 1U25A 2XMMA 3MM9B 2ZZDA 1RZMA 3NMRA 3UQSA 2NQPA 2CRLA 2MY7A 3D67A 2MQLA 1CJTB 1TL7B 1TMJA 2MGZB 3TZYA 3TZWA 5H9FK 3MTJA 4QWBA 5IS2A 2AJFE 1KQKA 5KOWA 2ABLA 3MAAB 2EVZA 2IC3A 2P8IA 1XTDA 5A76A 2D8JA 3CPWR 3CC7T 2LNVA 2BW7A 3DLKA 2K9GA 2FVRA 4FKXA 1U0HA 4FYWB 3M4YA 4LSZB 3J7A1 2AT1B 3DRSB 2BQRA 4E0DA 2DL4A 4WFZA 2BBEA 4Y2MA 4F4XA 1EQ0A 1S48A 2BZ8A 5B0AA 5KYYB 1N5YB 3J7YI 4K8RA 4PEOA 5FWBA 1S77D 3PHEA 4F67A 2R2SA 2KI2A 3J81j 3ELHA 1U0SA 3FCWA 3K8VA 1Q86U 2PUKB 3CEYA 2ZH7A 2V63A 3H5UA 2G0CA 3I56A 4ZLLA 1WX6A 2AGOA 2DEJA 4ERDA 1FJEB 4DHVA 2MTLA 4QYZJ 5D8HB 1TG0A 3CDBA 4ZLNA 2MKSA 3HSGA 2UXBF 1URRA 1XERA 5HLFA 4KAIA 4JJDA 4ES1A 2HS4A 3NS7B 2PVGB 3P8DA 1G6BA 2CGHA 4KRWA 2AU0A 1ZTTA 4CLWA 1PC0A 2L0AA 3LGMA 3A5ZB 5IWAJ 3G96A 4ZPVR 3MEGA 1BIAA 2W9BB 2B9WA 3MMAA 2R2TA 3LX7A 1ZM9A 4HACA 1C0TA 1HBNA 1D1AA 2KXNB 4DR4F 3H7HB 4ED5A 3DOKA 5E3QA 1QWEA 3O5TB 2H5IB 2BZYA 4K7QA 1GMWD 2MQQA 2XHCA 2OMLA 2O01C 4QQ6A 4OYOA 1WZOA 3C16A 3VAFA 2D8HA 3D6MB 3VS5A 2DYIA 3L95X 4MT1A 2KQWA 1L3VA 3MM7B 5GAOm 4ESRA 4EK2A 2OPSA 1NDLA 2DXUA 1ZAWA 1D0XA 2ZPEB 3ONQA 4RPFA 5LXRA 5T41A 3UDEA 3I55A 2CJ9A 3ZEHA 2DO0A 1CPZA 1WELA 2FC8A 2GMJA 1XR6A 3T1YJ 3EICA 3I5SA 3MMBB 1T9YA 1YJWQ 1DTQA 1RT5B 5GAN5 3U7JA 5GMKj 1WF2A 2PA3A 1UZDA 4BE1A 1WHJA 5KT2A 1Z2LA 3VQTA 2C0OA 4ED1A 3DLBA 3H5XA 5DZ6A 2F65A 2M5YA 1WHYA 2XS7A 1W2BP 3A3OB 2R57A 3VUBA 3VF0B 2K4YA 3M0RA 2QZ8A 4XU3A 2BABA 5DY9A 4XU0A 4X4QA 4MTPA 4IQXA 2J6TA 2W9BA 1UWBA 2OLWA 2FPHX 2P0QA 1LW2A 2XB2D 4HTIA 2YVSA 1WD6A 4JJBA 4GO5X 2X3WD 2YH0A 3OW2P 3GSDA 4WYWA 3DB4A 1IBCB 5L9XA 2QTXA 1JQGA 1M5SA 2UV8A 1T3OA 4DCJB 5CO7A 3KBGA 3O3LA 3ZZ0A 1W2IA 2RI3A 2LP4A 1E6GA 2JTEA 2W9CB 4X9CA 1NYGA 3MAQA 2MLXA 1JJHA 2DNYA 2V8GA 3BS9A 2QTVA 1SRMA 2ZHAA 2M3DA 2UVWA 2IBKA 3ETMA 3MP1A 1X60A 1WG1A 3F44A 3NAHA 4D3GA 3HX9A 1UUEA 3M8SA 3INZA 4C11A 4Y65A 2FHMA 3K5NA 4J6YA 2AQ4A 1CJUB 2KG0A 4E8UA 5AXNA 1EETA 3ZXWA 1H641 4CQ1A 1K8AR 2YNFB 2R8JA 1RA7A 3OYKA 3HMJG 3H0FA 5FU6B 3H2LA 2HSPA 1LNQA 4O0NA 2KXFA 3VALA 2ZUGA 4KYZA 2C0TA 3W2WB 3CMEQ 3OVBA 5B0CA 3MMAB 3A8KA 5KYYA 2DPJA 4F7UE 1KQFB 2OI3A 4KRTA 2HDAA 3CUNA 3IRXA 4HT5A 1WHGA 5A8WB 2RB6A 2WSFC 3I56T 2A2DA 3OFHA 1PGZA 1I0CA 2DD4A 1X5SA 4DV3J 3BO2A 3QKJA 1K0VA 4H4OA 3HP6A 4NLOA 5CIUA 4J5YA 3RZAA 4RKUC 2IM3A 1T95A 3OVSA 2AZVA 1IHWA 4BCAA 1RKJA 5M2RA 3Q1JA 2HNYA 1RADB 5D3GB 1HQUB 2EYQA 1VQOA 4LBIA 2LDMA 1YJUA 2QL9B 4IUVA 5T7LB 2X1AA 4QBUA 5ADZA 2A0FB 4ZNXA 2YX7A 2FY8A 1XOVA 5CXTA 1FXXA 2QSFA 4HT9A 1LW0B 3U1LA 1VQNT 2DGOA 4ANJA 4UQGA 2BR0A 2DAQA 3VKIA 3MUMP 2CIMA 2K5LA 3LTOA 4ZLJA 1UGVA 2Y4YA 4TY9A 4M77E 3CBOA 3ZZTA 2EKNA 1ZBTA 5KE3A 4WP3A 4C8LA 1K76A 1TAUA 4N8NA 1VQ5Q 1FF2A 2P4TA 1K9MT 3OQ2A 4B08A 4F3QA 3V81A 4HHJA 3RTVA 4RW6A 4NOHA 1B4SA 4MDXA 2FQQB 3CO0P 3SQGB 3CPWA 4ZS6A 5LMNF 3V81B 2ED0A 3EJMA 2V4QA 2E70A 1UEKA 4IOCQ 3RGIA 3L2ZA 1NB2A 4C8QC 1E6VA 3HVWA 3MM9A 2OPRA 4ATOA 2AYGA 4MKVA 3UVJB 2GCFA 1B64A 1RBAA 2EK1A 2LQ9A 1M90R 3E01A 5M2UA 6AT1B 1V5IB 2FPFA 3MPVA 3G6VA 3HPWA 4J9CA 4ID8A 3MMJA 3M0TA 2CDRB 4MFBB 4OB1B 2EFVA 5HVHA 4QW8A 3MHXA 3KMQA 3K8WA 1KQ2A 4WIIA 4C48A 2CPIA 3GTYX 4DA4A 2WVEA 3CCLS 5HP1A 3TR5A 3SIPB 3M6UA 2UUAF 2FZKB 3WVDB 4HH1A 2FRWA 1JLGB 2PMZD 1UKUA 2ZBRA 1EIYB 1TK0A 2F5TX 2OAWA 3GG1A 4QCLA 1RT2A 4KV8A 4UT4A 1RE1B 2HAXA 4EU0A 5LJ5d 1PAUB 3AXMA 3SDZA 1M27C 3GFHA 1S1TA 1N4LA 2DYAA 1UVKA 4OB3B 2VXEA 1DTTA 4PJOC 1FKPB 4AMCA 2LQWA 2HFZA 3POTB 1JXLA 4DQPA 3N6MA 4YP3A 4IUTA 4RMOA 2QN6B 1GFDA 2EIFA 1YJTA 1T03B 4J9MA 4GKKJ 1BHNA 3OQ5A 1KQ1A 2QT7A 2HD0A 4Y00A 1QTMA 3S1TA 1BGXT 2PVDB 4C5EA 1IGUA 3C15B 1SC1B 5IV3A 4ICLB 2CQ1A 2FGCA 2H9ZA 2C3YA 4C92D 4R25A 2PEHA 5ETQA 3NNCA 1VMBA 1FHTA 3HSDA 1ZUUA 2UXCJ 4BB7A 3ILJA 1HQEA 4IFVA 2I2YA 1X6GA 2OGUA 1Q81C 5KFQA 3SV3A 1HQUA 5KYXA 2RHSB 4ZHRB 2CZ6B 1MMLA 4J9LA 4LF7F 3T6JA 4J9NA 2QV6A 4A53A 1YIJA 3KLFB 1S1WB 2JM8A 4XTVA 2HHQA 1Z1ZA 2Y1RI 4MIBA 5MAOA 1CULB 3JB9J 3ZTOA 2WVDA 1DQAA 3LP1B 1WEZA 2DNKA 3P6YC 4M78C 4ECQA 2BE9B 1SL2A 4NLTA 1PIEA 2FVQA 1WQWA 2FG0A 2R58A 1TL3A 2B4OA 4YHHF 1KRPA 3B8HA 4TU8A 3D3BJ 3CDEA 2W4PA 4NLYA 3CJ4A 1S0MA 1LW2B 1C1AA 4DX6A 3W8GA 1JK9B 1D8YA 4IUPA 5IXUA 4B6MA 4Y3CA 1L3SA 3SCIE 2B9EA 1SL0A 1TKXB 2H5EA 4RTXA 1IBKJ 1FJ7A 3JRZA 1SL1A 2MB0B 3NGKA 2KT2A 2E12A 1TOVA 1SSFA 2RS8A 5DO2A 2WVFA 2YWEA 2D0NA 3QT7A 5C2CA 4HA8A 4NLSA 2QYZA 5KFNA 2KAFA 3M1VA 5AXKA 1U1KA 4J9SA 1T02A 3FEYB 3LQVA 3UD3P 2ZHBA 2CNKB 3MAHA 2BANA 3OV7A 5C24B 2ILYA 2ZPBB 3WDOA 2MQOA 4DV2J 3T1YF 1DFDA 2PC6A 2CVEA 1PD1A 2YSQA 2KTQA 5DDPC 3FJPA 3RERA 3VJPA 1QP2A 4KJIA 4J9KA 5F41A 4JI1F 3N5BB 2LVWA 4A47A 1YSJA 4BLGA 4E7HA 1R27B 4C6AA 2QA2A 4M7DA 4PZVA 1VQNS 3HFOA 3DLGB 4JZ3A 3BN7A 5B0GA 4ZIWA 1Q95G 2O9SA 5KG0A 3ET6B 3P45B 5GADI 2NUPA 4ELZC 4WFXA 3CJTA 1KHIA 3HHLD 3GFYA 4LF7J 3S3NA 2PZ1A 3N0VA 1K9MU 3CC2A 3M8WA 3HF5A 2DTIA 4LQ3A 1X5TA 1HNZF 5F8IA 3CCUA 2MKCA 2RE1A 1KLMB 1AW0A 3E2UA 4P75A 4X62J 4EMGA 3VUZA 1JLFB 1KC8T 1D3BB 3MM7A 1U47A 1VR6A 1APSA 2HS0A 2WSFE 3FBCA 2JW4A 4PR6A 5LJ5h 3V7RA 5KYUA 5E41A 1SC4B 1RTDA 2H4WB 3OVAA 4RKUE 1YJRA 3Q86A 2EW9A 2DRKA 5FDLA 5DRKA 2KT8A 1GFWB 2E5HA 2LU2A 1BK2A 2JJ4D 5D4PA 3FJ2A 4JI3F 5KG3A 5BXIA 2C06A 1ITPA 2E64A 1YCYA 4FYYB 1HI1A 3QDRB 5AE1A 5K14A 4R55A 3CCVQ 1IKYA 2UUTA 1Q8IA 1UAWA 2IRUA 3GZ7A 1FE0A 1FO1A 3A8HB 3I4PA 1VQSA 2OFGX 2W4DA 3MCAB 8RUCA 2CUDA 5J1PA 3PEJA 1RWWB 2DXEA 2POKA 4F7UA 3CCJQ 4FCYA 2ZKTA 1X7VA 3KLGA 4QIVA 3ETOA 5L38A 4DFMA 1QAXA 1OU8A 4QQDA 1T3NA 1UMJA 3B54A 4WIQA 4OF1A 4I56A 4YB7A 3CCQS 2XGQA 1F1BB 2IVMA 2OD4A 4IFVB 3CC2S 2RHIA 2DO4A 4DCPB 2MPXC 4PJNA 3MCNA 3DMJA 1D9DA 3LAMA 3OLBA 5KFUA 5A8WA 3QO9A 1BQXA 3LO3A 2FHDA 2YPYA 3SCLE 3VRYA 1B7FA 1GTEA 3OL6A 3D9BA 1QY7A 5FROA 1X4CA 3DRSA 3QLHB 4UOFA 3CCQQ 3DOMB 2BE7D 2DYBA 1T11A 4HH0A 2ILZA 2J7WA 3AD8C 1FX7A 4DMZA 2JWNA 3QQCD 1S9GA 1H0HB 1NK7A 5HKCA 4O5VA 1HQ2A 3CXCA 5GAMf 1RHQB 2CDQA 1GX6A 4KR0B 1NK6A 2P4RA 4M75D 5GANf 3S3MA 1VQMA 4O4GB 3H5SA 3NTIA 1RT1A 1X2KA 4IO9Q 4P2FA 5KFKA 3CCVS 1YHQT 5JMNA 2DH8A 2RDDA 1NK4A 4CLKA 2RHXA 2X1FA 1CBKA 2EFQA 5DQGA 4YR2A 1RLPC 3KG4A 2RJDA 1YWPA 2B9YA 5F0WA 1R3NA 4G1QB 1LNXA 2MJNA 3CDUA 3OSSC 3U23A 1N8RR 2MZJA 3OBWA 2CT4A 1Y0HA 1FD8A 5CQGA 4LFAJ 2HVHA 4I1TA 4DR5J 4FP9A 1EETB 3GE9A 2OTJA 1D1UA 3KK1B 1KQSP 5K8PA 2MQNA 3MUTP 1QVPA 4FVCA 3JS9A 4M78A 2FTRA 1UEVA 2EQUA 4CO0A 2RA2A 5J3BA 4L5GA 5B0EA 3MP6A 1RYSA 1RWXB 1WNEA 3VZHA 1Y57A 2ADBA 4QWDA 2P9EA 3G4SA 2MAMA 1OO0B 3AJ1A 4MMLA 3M32A 2VGMA 1AWXA 1UE9A 4N4IA 3D7SB 1M1KC 3KNAA 4WTYA 2MMPA 4HCBA 3RU0A 4HL9A 3VS4A 4O4RA 1BI0A 2H1YA 1IJEB 1R6VA 1KC8C 3JSMA 3PM9A 4DZ6A 2HZVA 1R8AA 4B9UA 5F8GA 5T14A 8ATCB 1CKAA 2I38A 3WIVA 3KYLA 4GBQA 2J0QD 2L89A 3MEWA 3MTKA 4ZMMA 1N6QB 4JI7F 4OQJA 4OYXA 3CCRT 4LUBA 3TO8A 4A4GA 1H7XA 1UHFA 2DJWA 1PHTA 4O6JA 4BI3A 1TV6A 1ZUKA 3VS7A 4DX7A 3JB9G 3H20A 3FVYA 1N34F 2ALYB 1J5EJ 2RQKA 5B08A 1RHMB 3ITHA 1ZZNA 3M8YA 2BJ3A 3CC4A 3R6GB 1HHQA 1IB8A 3JAMU 2QO3A 1HNXJ 2OKQA 5L1IA 4E7KA 4DFJA 1GCPA 1ZLMA 3DB3A 1R6YA 2CQHA 4XU2A 1EJ7L 4DL6A 3MECB 3EG9A 1M1KT 2MZTA 2VKNA 2FB7A 1R0AB 1PBUA 3IGVA 5D4OA 2X51A 1B3QA 3M30B 5FU6C 2Q3PA 1QSLA 3J80E 2WONA 2JDJA 1YI2A 1T0TV 3ME9A 3V5RA 1WWHA 4DOZA 4RW9B 2HKQB 1HHSA 3DHXA 3L1AA 4JRQA 5AXMA 2AKKA 4J8OA 2HZYA 2HQGA 4OYBA 4HR2A 2E7VA 3OXFA 4USUA 1Y9OA 1T8EA 3RRKA 1VBXA 3SWNB 2AMCB 3MM5B 2CJKA 3MMBA 1LWCA 4WXOA 4M5IA 3KJVB 4K4TA 1TKTB 3HHTB 1FRLA 4A8XA 2J7UA 2L9NA 1UW4A 3NKYA 1ZBXA 1P8GA 2R7RA 4J9OA 2V69A 3OTDA 3BSCA 2NXNA 2GAGC 2ZBCA 3I55Q 2QQBA 1G3SA 1U06A 2W9CA 1RU2A 4ILLA 4DX5A 2DVEA 2ZE2B 2QRRA 3FKBA 5BJRA 1F3FA 2KN4A 3H25A 2P6SA 2RK2A 2YNGB 4M78E 3U27A 1WC1A 3R5JB 2YNHB 4M75B 2H5JB 2QGGA 1VLOA 4P7VA 3V4IB 4RW8B 3KLEB 1F5AA 4Q2MA 4P71A 2G2YA 2BUNA 3DLGA 1X0FA 1DHMA 3G7ZA 2BACA 5IAYA 2AWZA 5GANd 3DU5A 2EFPA 3EXCX 1QSYA 1YJVA 1IKVA 3EGNA 4OX7A 3DRPA 3UD4P 4OZ1A 4LF8F 5KFZA 1J27A 4TQRA 4IFYB 4DL5A 2SRCA 3A1YG 5CCMA 4G1QA 2JC1A 4CM2A 2MCNA 1WG5A 2IAJB 3QGHA 5FD1A 4NEYA 2RQUA 3VYGA 1CJTA 4J90A 1UPMB 2DT9A 4Y6IA 1KVJA 1E6HA 4P2SA 5L8RE 3EGDB 5LT5A 3PMIA 2JOQA 3W66A 5D7UA 2KPPA 4ZPTR 4DBFA 1NE8A 1XN9A 2DCUB 5LSOA 3ADAC 1BBZA 4K5SA 1EX4A 3QZ9B 3G1JA 3R5CA 2GJ2A 3R6NA 3GV7B 4NRTA 1SQFA 3PHTA 2VFTA 4FS1A 4RU2A 1T9WA 1VRUA 1ZTWA 2JN0A 5HI7A 5I3UA 2D69A 4TKTA 2R8KA 2WOMA 4DEXA 1VQ5T 4CLLA 2VBWA 1X5PA 1Q82U 5B0FA 1I81A 1MN7A 4J9VA 4C8QF 2CKKA 3MWBA 2DILA 4DV0J 2WW8A 3CMAA 4W92B 3NY0A 1T05A 5CAIA 2JNJA 1L5UA 1P6TA 4RTWA 3SEMA 3P5BP 2PMHA 2DH9A 1EARA 3JTNA 3QYGB 2RKIA 2MZSA 2DTJA 4ALZA 3TJ8A 2NZCA 2IY5B 2DL7A 2F8HA 3ASKA 2HWIA 1WJRA 1VBZA 2JUFA 4LF5F 1VQKA 2RVJA 2CA9A 1FKOB 1XTZA 3V2UC 2EYYA 2QQAA 2DETA 2BRKA 3NHNA 1PILA 5CYJA 2A6MA 2HNIA 3TEGA 4NS5A 4KHPJ 4NLQA 4XIUA 2EQJA 1YNZA 2XLIA 1P9QC 1K73C 2KFZA 1HQEB 2C0IA 3FUYA 1B0VA 1JKHB 1NXIA 2D3O1 3DGVA 5HSPA 3GWCA 1WSVA 4IURA 2R2UA 4GVBA 1NSPA 2DE0X 2N4DA 3H9NA 1S1TB 1KFDA 2E44A 4N76A 4XTWA 3G71A 4DFKA 2YKNB 1RUWA 4M75E 1K8AC 4J7FA 1VQ4A 4L3NA 3FC9A 4E7LA 1PKUA 5I42B 1PRMC 4TYBA 2J6UA 3D0GE 1W70A 1OULA 1RTZA 1D1BA 1NHKL 2P9CA 3RB4A 4U6PA 1PWTA 2IC3B 4JV0A 4ILRA 4RUAA 3FK4A 2XWYA 4AXJA 4C97A 2FYKA 3DOMA 4DSLA 3PJXA 3QSUA 1TL5A 3IWNC 2MGZA 1S99A 3D54A 2HFUA 4ZDNA 3PW5A 2HBPA 2GHWA 1JLQB 2YKMB 4HDGA 4IR9A 2CZ0B 2FVPA 5D0GA 4WF2A 3TANA 2W2MP 1OV3A 1T9VA 4M78B 1AWJA 2ZNYA 2EBEA 3LH5A 1CC7A 2HHXA 1U2RA 4ZP8A 4IG3B 3Q8YA 4FS2A 3KDNA 1WDTA 4VUBA 2UV8G 1KHWA 1T94A 3A98A 4DEZA 4U67Q 1OQ3A 1WC4A 2CPZA 3H0IA 4NLDA 4KHMA 3HSJA 3L2WA 1TXQA 3KHGA 2YX1A 1G8XA 2MLYA 4NMLA 3PY8A 3QGPA 2IRYA 3C4SA 4NA3A 5IT9Y 3E8OA 2FJEB 1YBAA 1JLFA 3KLEA 3A1PA 4QIEA 1M90U 2VDIA 2XMUA 4C3LA 2M7SA 5CKBA 4L76A 5IT9E 2G9OA 3CMQA 1W26A 2LQJA 2RHYA 3IM9A 4D8KA 1KTQA 1YIJT 4C8NA 5KH6A 2QK0A 3VGUA 4KC5A 2OHDA 2IFXA 4DUYF 1BLUA 4PWDB 3A3PB 4EIKA 1D8ZA 3EWGA 2DR9A 4L59A 2H65B 2JX2A 1UB4A 3M2UB 2NXEA 1H3HA 3NGRA 3CCVA 3RESA 3QGGA 3AHPA 4PQAA 3ZFVA 3HD2A 5DQHA 2XYGB 4F7UG 3ZZZA 2E9TA 3OSVA 3S8SA 4FT4A 2DGUA 3A8JA 2FUG9 2OTLA 3SZ2A 5DLGA 3META 5CCAA 2UVUA 2XK0A 3HT0A 3RRGA 1VUBA 4LF8J 4TVRA 2VD3A 3K5MA 3DI6B 2HFVA 2HBQB 3M2VA 4ZIVA 3RAMA 4A8QA 1FMKA 1IBLF 3M30A 5CCLA 3R97A 1NK0A 2DCLA 1VIXA 1W6XA 1ZSZA 1HPZA 2FLOA 2HNZA 1PO6A 3N01A 3PKYA 1OMSA 2ZH1A 1YN8A 2EYXA 4Q0BB 4HCZA 1ZOTA 4RTUA 4BE0A 4J9BA 4DEYA 2F3JA 3DOLB 3CULA 3DNCA 1W2BS 2RQVA 5HLFB 2CQPA 2DX1A 3CMAQ 3EG3A 4Z7YA 4PFOA 4XTTA 2CPXA 2E7XA 2Z2MA 1S4FA 3QIDA 2XCAA 5GJVB 4DCOB 1UVMA 5D4LA 3THTA 1QAYA 3AOCA 4X4PA 1S72T 3UCUP 1LOJA 2K3YA 4CRJA 4RW9A 3LOUA 4M5GA 3M2VB 4F2RA 1OU9A 3G71T 3DRRB 4ZGEB 2WZ1A 1SIWB 4BUGA 3UW1A 2HVIA 1JLEA 2RF2A 2DY1A 4DF8A 2UUCF 3PMTA 1ZM3A 3RJMB 3I9QA 3W7BA 2UUCJ 2FJBB 1BB9A 3UI3A 5KT6A 5L1JA 4D8DA 5JVHQ 3T3FA 3W9HA 3FGVA 1MWYA 2NXUA 4UY85 1Z4UA 3HO1A 4YHHJ 2GJFA 4K4UA 2Q66A 1KLNA 2HG4A 3Q2TC 3A8EA 3OSPA 3WX4A 2E65A 2DZ9A 3DXSX 2A6OA 2NYIA 2RNAA 1S97A 3LALA 2HLTA 1AOJA 4JS4A 1UJ6A 2LRQA 2QEXA 2P5VA 2XY6A 2HQEA 1URNA 4TY8A 4ECYA 2KU7A 1UL3A 1NKCA 1CSKA 1PYTA 4PK4A 2WRMA 3SCJE 1VHFA 3FJ5A 4BBYA 4USHA 2HVZA 3KLIA 3R5DA 4AL5A 2B8AA 2F2VA 2XO7A 5HCKA 4C92F 2WTFA 1F9EB 1UPPA 1GBRA 2A7YA 4LVOP 4RW8A 4Q8FA 3R5AA 2H48B 3ZZRA 2GNKA 4DU8A 3US5A 1S10A 3IG1A 5A6PA 1WDDA 2ZD1A 2M51A 1S0OA 2ZC3A 1U1QA 4IG3A 2XY5A 1H2VZ 2M02A 3TVKA 3M0PA 1OX9A 2K2MA 3PE0A 3VR1A 3W9IA 3NS5A 1NZ8A 2KI7A 3DRXA 4MIWA 4PWWA 2DJQA 1XIQA 2FJDB 3FFIA 2VZ9A 1HNIA 2JLGA 4JI5F 4LF1A 2LXUA 2OP5A 2IM0A 3TOQA 3W2VA 4J5OA 1S6QB 4CC2A 4EGLA 1U6ZA 2HYIB 3ZTSA 3W61A 1AUDA 3OT9A 3EYZA 3PV8A 1RT2B 3TVYA 3ZO7A 2RF0A 1AZEA 2F1FA 3FCVA 1BQMA 4YUDA 4OL8A 4C8QB 2DR5A 1V3ZA 3SSRA 3IR6B 4ES3A 5E7OB 2ATCB 2UXCF 3M8PA 1VQPS 1UWAA 2GIRA 3AQPA 4WTOB 3OS2A 1IBMF 1WJ9A 4OYIA 1WOOA 1WHWA 3PIPA 2VYTA 3CXCR 4QW2A 2CNNB 1VDHA 2XNRA 2ZOMA 3QYHB 2DGTA 1U6FA 1JLBB 2CPYA 3A8MB 1NMEB 1X4EA 2A18A 2VFRA 4A8FA 2XSJB 3LGLA 4YTLA 4J9GA 2RI2A 4R5PB 2RRNA 4ZTFA 1VQ8T 2DBMA 4GLKA 4R5PA 1W2BA 1G3OA 3MZIA 4PUOA 2LQ8A 3DI6A 4LQ9A 3S01A 3PDNA 3GIBA 3JCMg 4KKOB 1RXOB 3CT9A 1IR0A 1Y4ZB 4DV3F 3GU0A 3O1LA 5LJ3h 2ROLA 4A48A 2OH2A 3QRRA 2CXEA 4M1KA 4PAAA 3R2DJ 4J6WA 2R7VA 2YWFA 4ZCIA 2COLA 4ZPDA 4GVBB 3EHRA 1NEBA 3I5RA 2DNRA 2GFAA 4M75F 4I4BA 3LWLA 3E1SA 3B78A 4IOBA 1XK8A 2WBRA 1KQSS 4R0EA 2VICA 2GMLA 4NL5A 1UEBA 1T9TA 4H4MB 5E0OA 4RG2A 1ZS6A 3LPYA 2HNYB 1TL7A 2HBZB 3LUYA 2LMJA 4F16A 2MYFA 3T5KA 4ZVTB 1WC3A 2XD0A 3M2RB 3FEXB 3BFMA 2L3MA 3QPIA 5HMYA 1IHVA 2C28A 2CYZB 4A0UA 1MNEA 3HDSA 3M56A 1U49A 3OYBA 2J9DE 1OYDA 2DGQA 3HLUA 2GX8A 5KYWA 2RH2A 4DG1B 3MFIA 4DQ2A 1I6JA 3GLJA 2K7JA 3M8ZA 4M75C 2F9JA 3M8PB 3ISNC 2ZH5A 1IM6A 2AD9A 4OIXA 2HQXA 3FLGA 1OZ3A 5B0DA 2HL3A 1X4AA 1JXEA 5C5JA 2NPFA 2GBQA 5KYNA 4C8KA 1WHVA 1Q81U 1CJUA 2Q6CA 2V5HG 2V6AA 1HIYA 4D6WA 3UN3A 2NYSA 1U1PA 2IMOA 4QR2A 2KR3A 4V1Ak 4YMEA 2LJ3A 2GQCA 1VQ6T 3PFSA 1GTHA 2YKQA 5KOXA 2R3VA 3PYFA 2OEKA 1B7TA 3PR5B 2D9OA 1AT1B 1WXBA 2CAJA 2L9WA 3BQ0A 4JI8J 3VCDA 4I68A 2ZH6A 1NB7A 2GTOA 2DHXA 3CMET 2VG6B 3FMBA 2J0WA 2W7AA 3HM9A 1WSRA 5I21A 4ZK7M 1LVKA 1HNIB 1MNDA 4QQGA 1DBDA 5KT7A 1VQ4Q 5CYMB 4PG4A 4FL6A 1YITA 2W7OA 2VQEF 3RNJA 1RAJA 2XBPA 1TMMA 2N4CA 3G71Q 2WVBA 1AEYA 2LCWA 5DM7Q 4Q45A 2GV1A 1KONA 3RBXA 4BC7A 5EHHA 1VQLQ 2HK2A 1IXDA 1TU0B 1S49A 1QVFR 1KBRA 4CTAB 2CPFA 2IJRA 3EFRA 1W1FA 3L2VA 4CT9A 4R0JA 4F4YA 5K8OA 5IQQA 4UOGA 2YHTA 4LF9J 1VQKS 3FRNA 2RUGA 3QWUA 3V6HA 2JS0A 1KS2A 2KT1A 3M05A 1MMGA 1L3UA 1VQNQ 1TQLA 2QQSA 1BI2A 4OHVA 3KNGA 4PQUA 3FFIB 5D77A 1HARA 2AK5A 3EAEA 4A4JA 3GV8B 3FRZA 2KRBA 5F3ZA 1S1WA 3EGDA 1PCAA 1P1TA 4O44B 3EFOA 4CO2A 1Q7YR 3H42A 2IYGA 3OFGA 3AXKA 3HD1A 4F50A 3VS6A 3MM8A 5AXLA 1KFZA 5CH7B 4EZ9A 3B82A 3IBFB 5HO4A 2VB6A 4GVLA 2UXDJ 2QA1A 2RILA 4HLBA 5GAEU 3TREA 2HIQA 2DNUA 5CR2A 1VQMT 4LN2A 1DLOA 1AA1B 1M2VB 4OYZA 3BGRA 1DY3A 3IQLA 4F4WA 1H38A 2J76E 4M77B 4JDSA 4EBEA 1YJ9Q 2I5JB 1Q53A 4AXIA 1M1FA 4UZBA 2I5JA 3LH0A 3PIPQ 3QSIA 1QAIA 3M2UA 2RIJA 2IMWP 2SEMA 1YHQQ 2LDIA 1BUXA 4QKUA 3PKMA 5I2MA 5FIIA 2OX7A 2B56A 3OA6A 2QXFA 3G8SA 2CT3A 1ZX6A 3TAMB 2NUUG 3M0SA 3PO5A 2Q43A 3O6QA 4CZCA 2AP6A 3QAUA 4X4RA 4XTUA 4TXSA 1V76A 2BZ2A 3BPDA 1U6BA 2ZWOA 1CLFA 4ZGDB 5U47A 2V8JA 2EKYA 1EP4A 4M7DB 4LNPA 3I0SA 1NM2A 3PR4A 4LF6F 1CSJA 4USMA 3ICLA 2RSQA 3MMCA 4JI6F 3BN4A 2E5LF 1HWLA 2Z58B 4C0GA 2UUAJ 4I0WA 2D3ZA 1W2BR 2ZE2A 4OYPA 1U48A 3SI8A 3UFCX 3PO4A 1UGRB 1IWGA 1F3VA 2DEUA 5IN1A 2AHOB 5IHIA 4LR7A 4HVUA 4CI0B 1S9EB 3T5HA 2RAQA 5A2QY 1YJ9A 4OYAA 5CZXA 1BD6A 3GJQB 2ZZMA 4PYAA 4LSLA 2E4HA 4IRCA 3EGXB 1RT1B 2YX4A 2YXLA 4B17A 3E51A 4X65J 3LP2A 2RMOA 3MD3A 2AJ1A 2IIMA 5A2QE 2C2EA 2QLXA 4PJOF 1OI1A 1Q1KA 3NP5A 4ILMA 4TLQA 3VVTA 3Q0AA 2DGSA 3T5LA 4PXBA 1Q7YU 2CP5A 4ANCA 2L3PA 1O6XA 1OOTA 1KQSA 3GYNA 1KR4A 3G87A 2B86A 5DETA 4HACB 2F2WA 4YR0A 3U02A 4AQYJ 5K8MA 4WZQA 4MFBA 2EJGA 1U26A 5J2MB 3NGSA 3JB9I 1HNWJ 2K7AA 2XU8A 1S4EA 1UETA 2YKNA 1K0SA 1T3SA 1DRZA 5CD4H 5CYMA 4EMDA 5LJ3j 1UJ5A 4C5GA 1OPZA 2Y0BB 3WXMB 2M9KA 4IG0B 5D0EA 2XG8A 3REBB 3M0QA 3QT5A 1NJIC 4GY5A 5H9FJ 1S9FA 3TA1A 5F8LA 4MYTA 1ULRA 2XY7A 1R7IA 1MROB 1YITQ 2G0IA 3TWZA 3KTQA 1RWUA 4DL2A 2B7CB 3AAWB 1B34A 3UATA 5ITHA 3AB2B 3J81U 4AFZC 1YJNA 2RQRA 2B5JA 4X9DA 4M4ZA 1VQ5A 2FPEA 1IVZA 1GNKA 2QLWA 4ICLA 1OPIA 5C6SA 4Z7CA 3J81E 3H4BA 2GQQA 3CCST 2X3DA 1RT6A 3W5ZA 2GVDA 4ECTA 1Y7PA 2FZGB 3IS9B 4X4NA 1N8RT 3F56A 2K3XA 4OYWA 2HCKA 5KFAA 1HL6A 2VC8A 3P96A 4F04B 4JI5J 2DTHA 2B9XA 3V8JA 2KXCA 2J8SA 1YWXA 3HKWA 1F5BA 1VI7A 4U7UD 4O23A 2CJQA 3R3TA 2KZMA 1D0YA 1QVFA 1N54B 1HNWF 4DV4J 2K2VA 1YITS 1M4ZA 2EVRA 4KV8B 2CWKA 4JV5J 3J7ZT 1T05B 3DLHA 1UP1A 1MV3A 1YI2Q 2J9DA 1NK9A 2F2XA 4D3HA 4DSEA 4DR3J 4KFBB 1Y00A 3ET6A 2DLPA 1VQMS 4LE9A 1WHLA 2VA2A 3JB9H 2P9GA 4C8QG 3RBBB 4NASA 2WCXA 2DIVA 1RT4A 3RBEA 2ADCA 2HL5C 2PQWA 2SXLA 2DEQA 2QE5A 2HBWA 1RLQC 1LWXA 3CO9A 3MFHA 4BE2A 1S76D 3CCMQ 1QVGR 1C4AA 2XQCA 2WAQD 4DSJA 2U1AA 2R7TA 1VQ8S 1QSSA 1WC6A 2RK1A 3A13A 4JBCA 3KK3A 1ZETA 5HBMB 5KFLA 3MO8A 1BXNA 4EEYA 5GAMg 3QWYA 3CF5Q 3W2VB 3Q8UA 4OMNA 3KUGA 1WACA 1RSCA 2XMKA 1YJNQ 3DLLQ 3CCMS 1VQPA 3MUVP 1P27B 4QVZA 1BQNB 5E3RA 1ZM4A 1RCOB 2FC9A 4F14A 2DERA 5LJ5f 2OAUA 1N8RC 3JB9D 5IM0B 1AUSL 1KDNA 3UDVA 2X4XA 2JMAA 2FIUA 3BGOP 1X2QA 1WHMA 3Q8PB 1KVKA 1HMVA 4DR2J 2ZPFB 1JB0C 2CNLB 2H4YB 1UFFA 5BYQA 1HD3A 3REAB 5FRNA 1WG4A 3BKTA 5GMKi 1S12A 2MKJA 3JV3A 3A12A 4UUWA 4DDFA 5LJ5g 3TZXA 5KFPA 3R2CJ 1X01A 4IUFA 1YWOA 4WP8A 1IKXB 8AT1B 4PJOD 3G82A 2I8EA 3BGUA 2CADA 3QIPA 3CMEA 4P2MA 5K5MA 3FCHA 1PG5B 5F0UA 1SEMA 4UW2A 2LEBA 5LJ3e 3W8PA 4OHWA 1KD1R 1N34J 2C3UA 2D1XA 5KG5A 5LSLA 1YBTA 4XQ3A 2XEXA 3OMGA 5GAN4 4JV2A 2GFUA 4JYAF 3GJRB 3QJ6A 3QDFA 1N6AA 3SXLA 4NCBA 4C92C 3UE2A 3X24B 4P72A 2GVZA 3W63A 1QVGA 3CCMA 3MURP 2AF6A 1RQ0A 4W98A 2VQEJ 1SSHA 5GAN8 5J1EA 2QSWA 1NYFA 1VQ7T 3LD7A 5LJ5j 3KHHA 4N7TA 3HHLB 5BYSA 3IBWA 3L4BC 2Y1IA 5BR8J 4WK1A 1JJ2R 3C6TA 1UVIA 5DM7R 4C0HA 2K8GA 4NLXA 2F8MA 2E6ZA 3Q8SB 2IVFB 3MR6A 1RL2A 1L3KA 3EVMA 3K2YA 3OXGA 5GVQA 2HQIA 3UNGC 2DHGA 1GQEA 1GXUA 4DR2F 2F7VA 2DM1A 5KFGA 3M9QA 3G82B 3C2PA 1WF0A 4M5DA 2K1RB 1U1SA 5IM0A 2VODA 3MI7X 1R31A 4J9QA 4FXDA 4M78D 2O2OA 4J9IA 4OZJA 3PRDA 4LRDA 2M88A 2MZQA 3ENWA 1S1XA 2KRNA 2OEJA 2CZ7B 1S0NA 1R8HA 4EI2A 3OFEA 2IDLA 2I0XA 2E1HA 3R7SB 1BWVA 1WHXA 4RWXA 1R8CA 1ABOA 2FDNA 3H6ZA 1H92A 4DR7F 1DTQB 3LP0B 2D9TA 1FRKA 1YIJQ 5M2PA 1PC5A 2KDSA 2DIQA 3N79A 4DX8H 1C0UB 2VHGA 2HQFA 2VGNA 5EDWA 4U96A 4CRIA 3PEHA 3DN9A 4YDDB 1VQLS 1LWEA 4IH6A 1RLCL 1MMNA 2YKMA 4J7CA 4NLVA 4ZVEA 2FEIA 1JRIA 3RBZA 1RTHB 2ROEA 3CD6A 1YITT 2C1EB 1IBLJ 1KD1U 3SSSA 5CQXA 3EG0A 1WOPA 1ZSZC 4FF1A 3MHYA 5KFTA 3CPWP 1Q5YA 2XG8D 3NMZC 3JSCA 2D41A 2G1DA 2V94A 3CJ5A 2C3MA 4JB8B 2C22A 3QRQA 2CJAA 4KTQA 2CYYA 4M8LA 2J7IA 2WVCA 4LSNB 2VFVA 4YY3J 4HEA9 2BJ7A 4OMFG 2HVDA 4DV5F 4K4SA 1ZA2B 2UXBJ 4FU6A 3O8VA 2M0OA 4G1PA 4HCCA 4URSA 2DNMA 1H2UX 3QFHA 3M7VA 2DD8S 1YGYA 1QVFS 3TX0A 3BY7A 2OPPB 5ETNA 1TFWA 1XNRJ 4OMQA 4LDUA 5IT4A 1WDXA 3IR7B 1FKOA 2OTLQ 2E1CA 5J2PB 1EFNA 2KVQG 3SB2A 3E3XA 4DR1J 4LDXA 1ZSGA 1WKKA 1SPKA 2XZTB 2OSQA 1MMDA 3NL0A 1GBQA 4M7AF 4LRAA 1HLWA 4EYHB 2ZFHA 4FSXA 1KC8R 5C25B 1IM4A 5GAN7 3OBIA 4ED6A 3L09A 5C25A 4BS2A 1FMVA 1LW0A 3R1HA 3C94A 5L39A 2AX0A 3HPOA 4OMMA 3DYAA 4ZVUB 4PG6A 1A0OB 4QR0A 3JSYA 2RQCA 1AFJA 3DRYA 5KFFA 4C4WA 3VRZA 3RB3A 4ETXA 4GO7X 2X3GA 1LPLA 2DNNA 5A8RA 2ZWPA 3THPA 4J9UE 4PCQA 4NWBA 2YKOA 2KEAA 3UDCA 4USVA 2ASDA 3VAIA 1NLKL 2C3PA 4YEAA 5THWA 1GX5A 2KT5A 3CCSA 4QZVB 4AD6A 5I3QA 2D6FA 4N4GA 2B8PA 2XHWA 1PC4A 3EG2A 3IC1A 4DI6A 2COWA 1VRTB 4OLOA 1OY6A 5EN1A 3DM2B 1SKSA 2V50A 4DPXA 3M8QB 3MEKA 2XI2A 3HI9A 5K9FA 3IR5B 1AWOA 3D6TB 3T41A 1AXQA 2OPPA 4AFUC 4GKJJ 3OFFA 2XCPA 4JV1A 1T0JA 4JI3J 3K57A 4CLYA 4DR6J 2NUPB 4R0KA 2VASA 1BMQB 1JLCB 5FU7B 4WFNQ 3EG1A 3VS3A 1M5VC 1BQMB 1H8KA 4DQSA 1JO8A 1HNVB 2XWXA 2KYXA 2YNIB 2XNQA 4OI1A 5EG2A 4J7IA 3I0RB 3EGVA 2QFIA 1R8PA 1LWEB 2L08A 4OB2B 1K73U 4LF4J 4DFPA 3SV4A 1RWMB 4KO0B 2VJUA 3V6KA 2LFVA 1I1JA 5GAN6 2ZPHB 2DL8A 3CBMA 1HNZJ 2VPZB 4YQWA 2DJZA 4RNHA 2W0ZA 3OTBA 4EO6A 5AE3A 1ZYQA 2ATLA 1S5ZA 2DXDA 2CQCA 1FWKA 2X3XD 1HYSB 1FJGF 4QT7A 4LR9A 3CNQP 3F70A 1VBYA 1RHJB 2AJQA 2VC0A 1SJFA 2ZDOA 4WU3A 4A4HA 3CCEQ 3IWLA 3DMJB 4U7UK 3MF5A 2LP5A 2Q79A 3RMQA 5CZVA 2EFGA 3S6EA 4XDDA 2VPYB 3CMAS 3G6ET 1TVRA 3EPGA 3BW1A 2DXCA 3FDRA 3QG1A 3GJTB 2EJ9A 4FBUA 4M77D 2KROA 2V8VA 3Q89A 1MN9A 1N0VC 5KTQA 2CPEA 1XBWA 2EK6A 4P10A 2XZDB 1U45A 5IQ6A 4O44A 2DHSA 4M5DB 4KGMA 3PW4A 3N5BA 3EZOA 3HVTA 2DBKA 5E5NA 4M5MA 4HXJA 2HPUA 2KH9A 1ZBJA 2GJIA 2XZWA 2V8PA 5J2NB 4QWEA 1O51A 2EYZA 2LQBA 3DDKA 1B99A 1FTCA 2RD5C 3SWNA 3MM5A 1X6OA 3OYFA 2P0PA 5GAOr 4K2JA 2FLLA 3KKFA 4XTXA 3BGRB 1VBKA 3PFOA 1JNZB 1XNIA 4IFYA 3NEKA 3NG8A 3DRRA 3CB4A 2M9UA 1B7YB 1X43A 4ANDA 2XMWA 2DVJA 5FU7C 3FMWA 3R7NB 3JCMd 1QCNA 1XWLA 2KO1A 2QEXQ 1V3SA 3KJQB 4M77A 5DGAA 2VBZA 2RU3A 2YRCA 4J9FA 2BJ8A 1N56A 2EPDA 2P0KA 2R42A 1FT8A 4KGXB 1KHVA 4C3KA 1MWZA 2YNHA 4X64J 4USIA 4Q0BA 1MGQA 1U1MA 1HKAA 2DXTA 2QDLA 3QBYA 5E33A 3FC3A 4E7IA 5B7WA 1GXTA 4AE5A 3B4MA 1PAEX 2MQMA 3D6FB 4ED4A 2G1HA 4PFPA 2XMFA 4F02A 3VAKA 1F60B 3TEHB 2DGVA 1RAFB 4ELUA 5F3TA 1NJXA 1QDUB 2YPZA 1RAIB 3QIPB 5D15A 1QD1A 2HWTA 1TVRB 4UUXA 1JWWA 2KVQE 4EPCA 4YR3A 1TAQA 3OTEA 4M7AA 4ZPBA 2XI9A 3QXEB 3NBPA 2F4FA 4ZVFA 1FYNA 4M78G 4EWTA 1REVA 3V8LA 1G1XA 2HURA 3WX8A 1NEEA 4ZVQB 2XDPA 1JBMA 4F26A 2KFNA 2QYCA 5SZTA 5DLQE 2YQ3A 1JLCA 5HJYA 4NZ7A 3NCQA 4X4TA 1JJ2P 1CKBA 4K4XA 5AJ3F 1YX2A 4XPCA 2QL7B 3IAS9 1JJCB 5KG4A 5HBMA 3CD0A 2QMWA 2J5AA 4C3MA 2CZ9A 4XK8E 1UW9A 2P6TA 4M77F 2PA8D 4JI8F 1DJ0A 4A8KA 2CZ4A 2B43A 4PKCC 3HHEA 4KSEB 1VQ9T 4USJC 2O1PA 3DFEA 4Q44A 2PN6A 2OELA 3IGNA 4DV1J 4PQUB 3JYTB 1N36J 2OTLT 4CP5A 5CYQA 4XK8C 1FDDA 5CKEA 1D3WA 4DXLA 1RT4B 5D6YA 1AZSB 2M8HA 2ZNZA 1YFNA 3PFEA 3T6BA 5A2QU 1UCNA 4MZTA 2KT3A 2W8KA 4JS5A 1FRJA 3CCSQ 2CKWA 1UA0A 1S9GB 3VGTA 1N5VA 5H9EJ 3JCMP 3V6JA 3E19A 3H0HA 1Y7XA 3DOKB 2J9EA 2PUOB 1UVJA 5DG8A 2YWGA 4CLSA 1IKWB 5LMUJ 2DNPA 3MEGB 4LT6A 3GBQA 4MKAA 2A3JA 4G1IA 3TX8A 1UFWA 4C2MA 2K3BA 3DCAA 1UJ0A 2CDTA 3MCSA 4FKYA 1XNQF 4KBIA 3RUXA 1N0UA 4M7AC 4LREA 2Z2LA 3RW6A 2E6NA 3TAQA 1XEZA 4MH8A 3R27A 4FNHA 4O3RA 1Y5IB 2R4FA 5JXSA 2KXDA 1XJWB 1Z9QA 2JEGA 2EGEA 4PXEA 3BEGB 5HQ8A 1NJIR 4P6QA 5C42A 3PW7A 4PXCA 1Q8KA 3KLGB 4C98A 2PTKA 3BR8A 1VYAA 4YB1P 4V19X 4OZ3A 3TJAA 1E6VB 3V7SA 1RK8A 1K8AU 4Z88A 1Y3JA 3J7Z5 3A4TA 2Z0WA 3RYLA 4YN3B 3QO9B 3LPEA 2W01A 1WI8A 1X69A 3QIIA 2QQ9A 1DQ8A 3A8GB 5GANj 4CO5A 2MSTA 2CP0A 2AYBA 4DQQA 5HVFA 3CMAT 4Z37A 2JC0A 1F6TA 2JOYA 1MW7A 5HMXA 1RJJA 5L8RC 4DS4A 2HQDA 4XAKA 4OZ0A 2AGQA 2NYHA 3R8YA 3CW2C 4PL6A 7FD1A 3NPFA 2OMOA 5GAMj 3Q8RB 1TUVA 1FRXA 2Z56B 3M2RA 4QPTA 4ZJQA 4Q43A 3J81Y 2DD5A 3BGLA 4PNOA 3CCUT 4F4AA 1QW1A 4KHPF 5H1SV 3SDEA 2VA3A 3NOGA 4K5RA 4KGKA 2V9WA 4ECZA 4N47A 2LJ0A 3OJSA 2XULA 2RM4A 4LF5J 5ETKA 3Q2SC 2AZ1A 1U7LA 2RRAA 1WYXA 2VOPA 4LBHA 2MJUA 5KYUB 1PJ7A 2YT6A 3OHAA 4OV6A 2CZ1B 3I32A 3DC2A 2CPHA 5ETTA 3VAJA 2N3OA 4Z8AA 2EKHA 2QA4Q 4N41A 2KB2A 4YOEA 3IAM9 1N88A 2AEJA 2KY9A 2VG7B 3V4IA 3UR0A 3BKFA 1X75C 1HBMB 1GFCA 4B3TJ 4TU9A 5G4DA 2FLNA 2V4JA 3SFMA 1FVQA 3LP0A 4E7ZA 4FF4A 3VAGA 2HHVA 3TVTA 2VXFA 2HHPA 2X4YA 3EFSA 1T3LA 2DVIA 4W4MA 3LYIA 3JYTA 1FXLA 2IIHA 3MPUB 4QIGA 1VQ9A 1VLYA 3QATA 4P73A 3LF0A 3HFNA 1VQ7Q 1IR2A 2HRYA 5C2GA 4OZ2A 1HWIA 4QVCA 2VIHA 1MLAA 2MQ8A 2ZOFA 1B0TA 4ANEA 4DV0F 1K1ZA 1M5HA 2YBVA 3MM6B 3H98A 1UFKA 4OI3A 4EUVA 2E1RA 3CCTA 3OTOJ 5T7LA 2DNLA 2MWOA 4LXCA 4PPZA 1SPBP 2LVMA 4CI0C 1OPKA 1IWAA 4ECXA 3M9OB 1WHKA 4CWBA 3GONA 2C2MB 3NOCA 4LIWA 4ZITA 1NHVA 1OQ6A 5GAGU 2HLUA 3W64A 3GSIA 4IR1A 2YWWA 2CP6A 4X1VA 5CA5A 1E6YA 4EMKC 1WJSA 4H4KC 2Z2ZA 4RW7A 2D7SA 4OZNA 2CSQA 4PRFA 1K73T 3IMQJ 2DA9A 1HSQA 2O67A 5HAOA 3C16B 4NOYA 1OY8A 5LXYA 1QE1A 4X2BA 3RDVA 4YB5A 2PSZA 3C66A 1VISA 1G7CB 3S6WA 2JSXA 1RA6A 1UJ4A 2YQ1A 2GCXA 2EKOA 1RT3A 1TL3B 4K4WA 3SSQA 4EFAC 4IRDA 2DR7A 5I2SA 5GANg 2FB0A 3KJVA 1VQ8Q 3G8QA 3HXMA 1MU2A 2K5IA 3PYDA 1Q8BA 3QMQA 5G0RA 1JJ4A 2RB7A 4I2QB 1VJWA 2QMUB 2UP1A 1XMBA 5CKDA 5ETMA 4C0FA 2XGPA 5E3AA 1AHJB 1VQKQ 2UUBJ 1X31C 2DITA 1VQ9Q 2YRDA 3DLMA 2O4XA 4E47A 4M5JA 4HHHA 3M59A 2CZVC 2HQHA 4MAKA 3QZ8A 4BY6C 1CJVA 2AYEA 1WORA 4RTVA 4EZ6A 4F25A 4C92A 3R9LA 3EUNA 5GANe 5J2QA 2GTJA 1YRUA 3BDEA 4DL7A 5L9NA 3HL8A 3JAME 3DM2A 1OIAA 1YI2T 2KYBA 4KT0C 3MEVA 3AH6A 2ZM6J 1QVGS 3HCXA 1VQ6Q 3M6VA 3Q8VA 2ZOGA 3TUZC 3V6DA 1RKIA 2C2OB 3T5JA 3EHQA 3I0RA 3BZQA 4I6AA 5KFIA 4ER8A 5KFXA 3KHRA 1OQKA 4LRCA 5D0RA 1RAAB 5CKHA 2BKOA 1QM9A 4CLPA 3P5TL 1TL1B 1U0HB 1N5ZA 2V8IA 2HHSA 5IOLA 1YHQS 2VV5A 1HBOA 2B8QA 3I5BA 1BE4A 3I5CA 2BTTA 4J91A 1X5OA 2QIFA 2VVKA 3HJVA 2LECA 1RDRA 3MJXA 1BYMA 1KQSR 4DV4F 2L3QA 1C0MA 1RTIB 4NZ6A 3CD7A 3LW5C 3NLCA 4JI2J 1HD0A 3H8YA 5J2NA 3QAEA 3EH1A 1W25A 3MKDA 3CCES 4WF9Q 5ETLA 5KFJA 2JFKA 2OPQB 1NSAA 3JSBA 4EBCA 1NNDA 2PEBA 1WTFA 2E10A 3LW5E 5LMNJ 3CCUS 4B3MJ 1G83A 2ZPIB 4UY8T 4N0AC 4YB6A 5F8NA 2EW3A 3WZ0A 1M90C 4CIOA 2CNOB 1OEBA 3CD6Q 1YRTA 2VOOA 5C7PA 2HAIA 4NRUA 2DNGA 5IT9U 5GMKa 3J7AN 5HK4A 4NXNJ 4YY3F 4B9WA 4FF2A 4KHRA 1C1BB 2QLFB 2ZBPA 1C1BA 1FRIA 2A3LA 1VQNA 1HNVA 4ECRA 1WQ7A 2NSCA 2BUDA 5HJXA 2HQ3A 2MYSA 4JLGA 2OPRB 1VGYA 1SQGA 4X4OA 1R8OB 4ESNA 2M4MA 3MR3A 4B3SF 2EG2A 2AZ3A 3SQGA 2Z0GA 2I2LA 2PDAA 4K4VA 1NCLA 4Y28E 3RB0A 2DF6A 3TQ1A 2HK3A 2F63A 3BBCA 2VONA 2J6SA 2IJNA 4Z2XA 1WEXA 4B3TF 2E3IA 3CXCP 3POTA 2KBTA 2LXFA 2V8DA 1D09B 4WP9A 1H6KX 1H73A 3LLRA 1XMOJ 5ECAA 2AYMA 2LMIA 4OX9F 4F4ZA 1S57A 3BJYA 2GO9A 1IKYB 2ENMA 5LOQA 4X66F 2HVEA 3PTAA 3ZTQA 1H7WA 4OJ3A 1CS4B 3C14A 4IYQA 4F8RA 4NX9A 1SHGA 1UTIA 2W25A 4LVNP 1NPRA 4DU7A 2KM8C 3D5MA 3M58A 2PGCA 1V3RA 5C42B 3GIJA 2PU9B 5F8MA 4PJLA 4ZLPA 2IJFA 2DPIA 5J39A 3BGFA 3TEEA 5FLXU 3JCMJ 4G3IA 2HRTA 2BM0A 1ICEB 2YDLA 2XM3A 2AKLA 2ESWA 4DV7F 5CYQB 5J1NA 2WHOA 1M5KC 4I7FA 3M54A 4NEZA 3UVJA 3UA7A 1KHCA 1KC8U 1KWMA 3KFVA 2E66A 2G13A 2RKIB 3AA8A 1S79A 1HWUA 2D3UA 3FNNA 2E5KA 2MQPA 3IS9A 2KZZA 4I6WA 3KLHA 3NTKA 4RLEA 2ZH2A 3UD5A 5AJ3J 3H40A 4TVAB 1TELA 5IHNA 2HGNA 3ZTPA 1A7GE 2L8DA 2PT0A 1O0PA 4IUQA 3CJRA 3JCMc 2RQWA 4PLLA 1YBUA 5GAMe 4OX9J 4B3RF 4M7DF 3CCQT 3OXLA 4NLPA 5K14B 3MR7A 1AVZC 4EBDA 1N36F 4DV6J 4CLUA 2JLEA 5A0YB 2AW0A 1RT3B 3W1YC 1RAEB 3LWHA 3PYEA 1I94J 2J06A 1S6PA 2F4VF 1N32F 2AZSA 4DV2F 1S59A 4BWJA 2FJAB 2YH1A 1U1NA 2NZ4A 2QYGA 2X1GA 5D3GA 2XLKA 1CJVB 3VS0A 1UHCA 3H4DA 1VHIA 2NUTA 1N27A 1LK5A 5CD4A 5KT5A 2KVIA 1U1TA 4ME7A 1DAXA 1S1VB 4UC4A 2Y90A 4ECSA 4KH0B 1Q0NA 1V6HA 5SUHA 4RW4A 4RJVA 5DJBA 2KSSA 4RCCA 3OW2A 1Q86T 3I0SB 1MU2B 4E6RA 2GVZB 1PYOB 2K6DA 4QU7A 4FXVA 3TYTA 2JNGA 3BO3A 2X1BA 1SG5A 1K0XA 2ZD1B 4WCIA 4F0MA 1CC8A 1N33J 2DRBA 1Q86R 2VU5A 3AFGA 2BIVA 2MKIA 3NNHA 2WOMB 5J2QB 1TH7A 2KRRA 4S0MA 2B7BB 1ZPWX 1BU1A 5CVIA 2MHEA 4WXWA 3D1OA 4BD3A 3JCMe 1U8WA 1C6VX 3Q22A 4WKRA 5HROB 1Z9ZA 1X27A 2ZVSA 1QLNA 4M7AB 1EZZB 2DK2A 4KPYA 5DG9A 4ECUA 2M8DB 4PLIA 3NWGA 3O2IA 3TP2A 1NDPA 1YJ7A 1FDBA 3PJWA 5KE2A 3CJKB 4OGCA 1SJ3P 4KIAA 1ZSZB 2XDDA 1HPZB 2GHVC 3OR2B 4USTA 1KSPA 3UPUA 1JB0E 1PKTA 1HBUB 4U95A 3GNFB 2JMCA 2Z30B 1NKEA 1O5JA 1NPPA 4JI7J 2JH3A 1UG1A 1WGSA 1IKVB 3G6YA 2MMYA 1OS5A 3R5BA 2KRMA 1RWNB 2AV5A 4AYBD 2YNIA 1VOMA 4TY8B 4WJBA 1S72Q 4BDYA 3I56Q 5IH2A 3JSMB 1U1OA 1FJGJ 1LOUA 2E5JA 1M5PC 4B9LA 2WBMA 2JTMA 2A1BA 3UO0A 1C0TB 3GF5A 4FYVB 3G4SS 1WUUA 1WHHA 4R56A 3CCRS 3UT1A 3CCLQ 1N33F 3PXGa 4B9XA 1FRHA 2V8KA 1IKXA 3FRYA 2H54B 5LL6d 3PW2A 1I1GA 3TUIC 1N48A 1RWVB 1K8AT 2AJ2A 4M5NA 4MJKA 1VC6A 4RX6A 4ECVA 1M8VA 3BSOA 1GRIA 2VG5A 1VQ7A 1ZA1B 2G2OA 2D3OR 1S1UB 3TA0A 4LDYA 5DG7A 1PNJA 1RHUB 5HQMA 1UGQB 1LFWA 4FZVA 5I4MA 1XQIA 2J6FA 2AGPA 1V29B 4KFBA 3GQCA 4DPTA 4ZCLA 1M3BA 1NEGA 1QUPA 3CCWA 3PVXA 2VFSA 1WA7A 3A3NB 1Y3KA 2BJ9A 4DG1A 1NJIT 3DLEA 5ETSA 4KE5A 5HANA 4KGVB 2FHKA 3BSAA 5ETPA 3AOAA 3C46A 4PKDB 1KN6A 1WXUA 1RT7A 3SFGA 3IXQA 3HVTB 3SYZA 2DRMA 3LH2S 1EX8A 3M4GA 2M2BA 2ROGA 4X84A 2HNZB 2VG6A 1WJQA 2CFXA 1WLPB 3NXZA 1FK9A 4HVZA 1I51B 5FLXY 2JZ5A 1ZAVA 3CJSA 3P3DA 1WFWA 4LJMA 3M0UA 5KCHA 1TTHB 3I6PA 1ZPVA 3EVOA 2E5GA 2H3EB 4DL0C 5FJ4A 2EAYA 6FDRA 5EWFA 4O3QA 3HULA 4L73A 5HQLA 1LWFB 2BQUA 1RABB 3HKZD 1KVIA 2C2RA 3SQOP 3BB5A 3CJ8A 3C8YA 4B3RJ 1TUDA 3CPFA 5EWEA 1HW9A 1MWQA 4QYRA 3CCEA 2Q1LA 5J26A 2EQKA 1Y11A 4FIBA 2AIRB 1K0TA 1MROA 4N4HA 3KWMA 4I7FB 2YTCA 4B9SA 1GAOA 4I64A 4NYOA 5F8JA 1FNMA 3IP0A 4FF3A 2DL3A 4OJGA 3EVWA 2V9KA 3E2EA 2J05A 1V1CA 2CP2A 3M32B 2ZDPA 5HK3A 4CDIA 1Q5VA 3PZPA 1B0PA 1AZSA 2OTJT 2VBXA 5IV4A 3M9MB 1FESA 1X4FA 4OMLA 1YI2S 4P5NA 3HRTA 3IFEA 4H4OB 2ZZNA 2GHPA 5EX0A 2DKOB 4M7AD 4M5LA 4K4YA 2A10A 4ETZA 3BBFA 3BE3A 2Z2YB 3FZBA 4PXDA 3PG9A 4PJOA 1N5SA 2N7YA 3RKXA 2EFIA 4ZCMA 4IQMA 3Q8QB 4M5KA 3OL8A 4C8YA 2HWHA 4A4EA 4OV1A 4Q7AA 4KB7A 1Q78A 2ZH9A 4J37A 7AT1B 1Y5NB 3W5XA 1RTDB 3OYDA 1GK8A 3K89A 2L3SA 3MGJA 2D74B 3C6UA 4CNZA 4WWSA 3EMTA 1PSEA 2K79A 3M6XA 1R77A 1GL5A 9RUBA 5LJ5e 1VQ5S 2KRSA 3ISZA 2J6OA 3PNWC 3JCMQ 5KFBA 2MLZA 3BDLA 2R8GA 4FSSA 5CHCB 4FBTA 4Y28C 4ZVHA 1RT7B 3HTRA 2RHUA 3GPAA 2LJ1A 4J6XA 1FDAA 4RNFA 4QOTA 3AT1B 2D1CA 2I6WA 2HW3A 4X34A 4HVWA 1VC0A 2E1PA 2I0NA 2OI2A 2CUBA 2BMBA 1SH3A 4JUZA 2O9VA 4RTZA 3CXCS 4Y2KA 4OHZA 1FVSA 2FVCA 1OX8A 4HI2A 5LJ5Y 3QUIA 2EFOA 2BQ3A 1NHUA 4C0DC 4ZJOA 4LDVA 4I2QA 1YK9A 3R6LB 1KSWA 2VBYA 3QRPA 5AYFA 4K0KJ 3MP8A 3NWRA 2KNBB 1QQJA 2MWPA 2OPQA 2HBRB 2QDYB 2NS1B 5HL7Q 2YY3A 4OI6A 5AE2A 3D3CJ 2CQ0A 1M30A 5DQIA 1FD2A 2BDPA 2DKGA 2MIOA 5I3UB 5DLFA 3RR6A 2CREA 3FEZA 1U5SA 2V26A 5D78A 3JCMh 3SFUA 2KL8A 3EFOB 4IO1A 5LSRA 3HHLA 2IPOB 2MEWA 1OYEA 2LU1A 3HK2A 4H54A 1F2GA 3OY9A 3IRWP 4XO0A 5HMWA 4TNOA 2VC1A 1Y96A 3IRXB 3NGUA 3HHDA 2LCCA 3QWXX 6FD1A 1QLYA 4OI2A 2UU9J 3A8LB 2R5MA 2PFFB 1HK9A 3GYGA 4RO0A 2JTFA 2EG1A 4JI1J 1YZ6A 4C9DA 2XICA 5HN0A 2J6KA 2F8EX 3T1HF 1CVJA 4IIMA 4U9RA 4WPAA 1IR1A 4IKAA 3DGPA 3ILOA 1I5OB 2XMTA 2ZJRQ 3SHWA 3LAKA 4ELVA 3L9ZA 2RQTA 2ZVIA 1UZHA 1M1KU 4KBMB 3CVKA 1VRUB 4Q8EA 2RUSA 2YRVA 4C0DB 1G3WA 1VRQC 4F0HA 2M1HA 3CTRA 2QJ3A 1VQYA 4ZPCA 4BC9A 2BJDA 1YKWA 4LSLB 5RUBA 1CULA 4ENOA 1DJ7B 4A8MP 5K8NA 2M16A 1FXRA 5GMKh 5E3CA 1SXLA 2CSIA 4JI2F 5G0RB 1DQ9A 1Q79A 3PW0A 5ETVA 3RRHA 2GF7A 1PD0A 3OL7A 1QVGP 1S1XB 2A37A 5BR8F 3P4UB 1KIKA 3RG6A 2OIHA 1YZ7A 3LWMA 4UZCA 5DLOA 2RDJA 1X0PA 4YDXA 1BCOA 2VG5B 2L9DA 1JXMA 3U1NA 5B0BA 3ILIA 2FVSA 3M5AA 3J80U 3E9GA 1YVFA 1N5TA 3AD9C 4A4KA 4M7DG 1DLOB 4Y2AA 4HVVA 2QX0A 1H2TZ 3DKDA 2LEAA 4PG8A 5GAOn 2IVWA 4JI0J 4RCBA 3CCJT 4ID5B 1J5EF 3CDAA 4WFYA 1NJZA 3OHBA 2ALZA 2V0NA 3FZ2A 3CD6T 1VJQA 3BH6B 2FO0A 4UOCA 2WSEC 3QO3A 3P8BB 1JEGA 1O9SA 1VK3A 4ELTA 1NDCA 1Q86C 5LJ3g 3L7PA 3DDIA 4DL4A 4MMKA 3RAQA 2WSEE 2DNHA 2PNIA 3OSNA 3GCXP 5KG7A 3QZ5B 3D2WA 5ETOA 1NO8A 2W2PP 4F3OA 2B4VA 4OX8A 2CG4A 4PWDA 3NGDA 2BX6A 3N9UC 3CCVT 2VQFF 3OD2A 4DBRA 4NLUA 1BI1A 4DZDA 3PCOB 2NXJA 2LXIA 2ERRA 5EC7A 1R0AA 4NCGB 4WE1B 4QWCA 2H3JA 3EZ5A 3ULRB 2YLBA 4MK9A 3G71S 2L41A 1M9SA 5JUMA 1E7OA 1RHRB 3C15A 2D0QB 2ASYA 3T19A 4QWAA 3TZZA 3TCJA 2W10A 4QIWD 1RAOA 1KOHA 4BDPA 4PJJA 2E9ZA 4H4MA 4CNYA 1HR0J 3UN5A 4NLWA 3AJ2A 3BQ2A 2M70A 2IM2A 4EYIB 4NE9C 3TVZA 1M1GA 1QCFA 1IZ6A 3UR3C 5DDQC 3EPIA 2VG7A 2J9CA 4RBTA 1XMQJ 2COZA 4JZ4A 1F9FA 1RWKB 1N9RA 1D0ZA 4F7VA 4NXMJ 2W4CA 2V1RA 1G2EA 2BM1A 2ZBIA 2OD6A 1BQNA 2RU9A 1YJ9S 1Q16B 1S1VA 3HSBA 1QVFP 3PRVA 2W8LA 3BO4A 4RBVA 2HZAA 4LFAF 2VF3A 3K5LA 1BC6A 3MPWA 4R8UA 5EX3A 1YJWA 2NREA 1GMVA 3SEOA 1VA7A 4J9DA 3G4ST 2YUQA 1VS3A 2Y1LB 2RQ4A 4ZVPB 3TUJC 1ROFA 3VV2B 2DFUA 4B3SJ 1T7PA 4AUKA 4JUVA 2K2PA 1YQHA 3ZL7C 3E01B 2KKHA 3CCLA 2PI4A 2YLCA 2DL5A 1RU1A 3I35A 2AEMA 2FJXA 2O5DA 1IRXA 1VQOS 2QLBB 3MEEB 1LKZA 4OVAA 5KG6A 3OUYB 1IKWA 4RW6B 4DR5F 3J80Y 1G5VA 2BJEA 2H8HA 2BVZA 3CCRQ 1N5QA 3C3LA 4RZRA 3BKUA 3EGZA 1GT8A 1MHNA 1Q7LB 4I2PB 3KG0A 3X25B 2R8IA 3GJSB 4CYUA 2YKAA 4MDWA 3IM8A 4ECWA 3K5OA 1XR5A 2GQ2A 4CM0A 2HKNA 2PI5A 1NSQA 1RHKB 4P74A 4EDUA 3OYYA 2RJZA 3EDRB 1VQPT 2NCKL 4KKOA 3IN5A 3QNWB 4CH1A 1TK8A 1LCKA 2FRYA 1Y5LB 3BDUA 1HR0F 1R8BA 3J7AF 1BI3A 1IBMJ 5KAKA 1PM3A 2COYA 1FI4A 4NYZA 3E9FA 2K06A 1NG2A 2XMJA 2FJWA 3GIRA 3I96A 2FD2A 4AFFA 2L48A 1WOSA 1U24A 1JU5C 2GIQA 4C8QA 1YHQA 1N52B 3MMCB 4JI6J 2QAZA 3KG1A 2C2ZB 2HQCA 4QIFA 2J0SD 1WTBA 4NCGA 2XKOC 4WFBQ 2ZITA 1XC9A 4NXMF 5I22A 4KUIA 3CJQA 2GGPB 3D68A 3KUHA 1BCMA 3CC2T 3FB9A 2VJVA 1TFYA 3W62A 4JI4J 5L46A 1JXVA 1JLAB 4DSIA 3FSXA 2M0GB 4E98A 3HZEA 4DR7J 2K3IA 1XNRF 1TKZB 2A2CA 4A4FA 1G2BA 2OTJS 2XSJA 4B3OA 3LA0A 2CWXA 1LV5A 3C6TB 4GC7A 3CD6S 1TK5A 1VIEA 2C2KB 3QYYA 4JRKA 5D4NA 4ZP9A 1RCXB 4OJ1A 3DOLA 1M8MA 2F40A 1SBRA 2UZAA 4CT8A 2V4RA 2CS7A 2DPPB 4IIOA 1LK7A 5KT3A 2Y1JA 2APOA 3OS0A 5KG2A 2IA0A 3TRGA 3OYGA 2MY8A 2QG9B 1HWKA 1HI8A 1REVB 5EUHA 2V2VA 3CIMA 1QAJA 4B9MA 2RF2B 4JJCA 3NMAA 1FEEA 3HVAA 4AT1B 4K4ZA 4NLGA 3M57A 2HHUA 2A08A 2HMIA 2R7QA 4OX6A 3RBDA 1MG7A 2KFYA 2I9SA 3D66A 2HNDB 3HRSA 5KFSA 2GZOA 3JQMA 2QI2A 2R7UA 1U02A 3X20B 3T1AA 3L42A 3WVEB 4ZPAA 2BOAA 4XAXB 5IC6B 3PYGA 2OFHX 2XC9A 1VYUA 3AOBA 2IVYA 1G3YA 2Y4XA 1FFWB 4AL6A 2A36A 2ZH4A 3VAHA 3S7RA 4BY6B 2G0JA 4L3KA 4PJOG 2GFFA 5A8KB 2BJ1A 2ZAEA 3RKYA 1VQ6S 2E7WA 3GYXB 1GXLA 3CJ0A 2R7SA 3ZFJA 3NGTA 1GMUA 3BQ1A 3HP9A 3PJ9A 2E5IA 1M3CA 3GCWP 4LRFA 3F41A 4DV6F 2B3TB 1K47A 2MOXA 3TU4K 4K2XA 1RWOB 1PCXA 2AHJB 3K58A 4DBHA 1Y96B 2MXYA 2VPXB 1YJ9T 3MOJB 4P2XA 3H2UB 4F7UF 3X1LB 2YWKA 2LA4A 1FCAA 2EI5A 3CC7Q 1YTYA 1Z2ZA 1HBUA 5ETRA 1U3OA 4B3OB 4M77C 2BW2A 1S72A 3VTIA 3GIMA 1LXNA 2KE9A 1YP5A 4I69A 1TWBA 2W9AA 3MR5A 3R1LA 1U1LA 3WIUA 2KHDA 4JI0F 3JB9F 1TV6B 3L2RA 4Y2IA 1FFGB 2JVRA 5CAAA 1KP6A 1RWPB 2LDYA 4ZVGA 4EMHA 2HHTA 3MD1A 4RUBA 4J83A 2HBYB 3CDWA 3KLFA 1A6LA 2EXUA 3ILLA 3JCMX 1UA1A 4K0KF 3HFVA 1ZQ1A 1O8BA 4AG2C 1NSKL 2J8AA 2QA4A 4V2SA 2CJYB 4C92E 3L7OA 4TLRA 1TZ0A 1QTNB 2V34A 4N77A 2YXYA 1TR0A 3IA0A 2FJVA 4LUDA 4JI4F 2DZCA 4CTAA 1FERA 4ZVOB 2OTJQ 2KYMA 4M95A 1TP7A 2R7OA 3QHSA 2ZC4A 2FPDA 2OUGA 3RAXA 5CQYA 4GMKA 2MF2A 3GP9A 4CH0S 3I9ZA 2EBGA 3V8KA 2AX1A 1M90T 3EGUA 1VCTA 1JIHA 2MKKA 1SV5A 4O4GA 4ZKAA 5IFMA 1WC0A 2ZZTA 2BE2B 2WB1D 3DKMA 5F8HA 1NAQA 3HVRA 2GVDB 1PSFA 1WEYA 3OYNA 3TAPA 1H3ZA 2W2QP 3HJFA 3PVQA 2DH7A 1U8RA 4P7TA 1ELOA 2LNHB 2LX9A 2RI5A 5A0YA 1N6QA 2R5AA 2NLWA 2DEIA 5L1KA 3T9NA 4CO3A 4ZVSB 5I42A 4NPOA 3QLHA 5EGYA 1N5YA 5GAN2 1SIZA 1YLXA 1Q82T 1JX4A 2AKWB 3KFWX 2B6AA 1RACB 2ZH3A 2NSBA 3M4XA 1C4CA 1U8SA 4AQYF 3MPYA 1VIOA 5FLXE 4GC6A 2ZKUA 1XMQF 1T9XA 4DJBA 5FW9A 4LFCJ 2K5FA 2CG8A 2Y3YA 5DDOC 3KUEA 2CQ2A 3DU6A 2MK5A 3CCJS 5GAOp 1C2PA 3GP8A 2GGRA 4J9RA 3R6OA 4PPDA 1NPKA 4FVMA 1ZUYA 4M5HA 2O31A 5E3PA 3TARA 5IXFA 1Q7YC 3I4HX 3EM1A 2F1LA 2JZ2A 5DZ7A 2MI6A 3GR0A 5GAMh 2HZCA 2UVVA 1UFLA 4K50A 2F69A 5JVGQ 3JCMb 3I87A 1WI6A 2CQGA 1M1KR 1RTJA 1HXDA 5GJWB 2X7IA 5KFRA 2QTWA 3PACA 5IXBA 5J2MA 3OYHA 3B6BA 2XMAA 1BIBA 1CQNA 3KK2A 2XI3A 3PX0A 4DUTA 2LLZA 1NDKA 1YJWT 3BH7B 2EC2A 2V1QA 5GAHI 2CQ3A 2E5LJ 1JNRB 2K57A 3X26B 1VQ8A 1F9HA 2GC8A 1ACMB 5A0LA 1HW8A 4XPEA 5CABA 1RB0A 1JQQA 1KQGB 1VRTA 3ENQA 1S72S 2FVUA 1UEUA 5KFYA 4A8YA 3SD4A 2GQVA 3ZZUA 2GO8A 4I6YA 2R7XA 3DDNA 4ZGJB 1S9EA 4O0IA 1PKSA 2QA4G 3THKA 2F9DA 1ZAXA 4WE1A 1FTRA 2RRBA 2VKZG 4FW2A 1O75A 1M3AA 1NK8A 2WW4A 2ROTA 3JCMV 1FX2A 1QCOA 4HYKA 2MHNA 5A8RB 3VV0A 2EYWA 1WXTA 5KT4A 4TU7A 2NXCA 4X64F 2PD1A 2JRSA 2BKNA 1SUQA 3G6EA 1M1HA 2ZH8A 2N3LA 1IXKA 2HGMA 1P1LA 3OUYA 1A9NB 4U8YA 2G3RA 3H8ZA 2G4BA 2C2DA 5KFVA 4C11B 4ZP7A 3NBPB 3PT9A 4MZMA 3VAMA 3NAIA 1EIFA 4RU9A 1Q81R 1PJ6A 2HHHJ 2JHEA 3VGSA 2YNFA 1JJ2S 1KLMA 1UVNA 5J2PA 1XQHA 4L74A 2E41A 1FDNA 3D1HA 2BANB 3KMSA 5D6GA 4OZ5A 1SJRA 4RWWA 4OP0A 2PMWA 4CH7A 2BV3A 2WK4A 3CSKA 4CO4A 3CBPA 3BR9A 2VFUA 2HHWA 3CCSS 5D0HA 1SC6A 3G2XA 3UN2A 2B6AB 1IJFB 3AHUA 1VQOT 1UWBB 2LT4A 4CLTA 4C92B 4NMXA 1EP4B 3R7BB 1Y07A 1TL4A 4JJNK 2EGCA 1U2FA 4WCEQ 4OHYA 2K7KA 5LJ3Y 2UUBF 3MCMA 4J9EA 4UQTA 1QWFA 5KFHA 2C3OA 2WONB 3I55T 2MZRA 5A0GA 1QE1B 1N9SA 1YG0A 3ZTRA 3HFZB 4A63B 2L5QA 3TSZA 3M1VB 4MYUA 2RQMA 3M53A 2PIIA 2V2KA 2BEFA 1CJKB 2KDOA 2KMTA 2J7KA 3CJ3A 1SKUB 1FA0A 2OEMA 5HVGA 3G6EQ 3BM7A 1LWCB 4RTYA 4DUYJ 4WFAQ 2DGWA 2VDHA 2JJ9A 4ZTJA 3JCMf 2X4WA 4OMOA 4M7DD 4W90B 4EMKB 2Z57B 4J9PA 3G8TA 3IG1B 1YJNT 1RP5A 4RW7B 2Y8YA 1P92A 1HMVB 1FE4A 2GMHA 4MK7A 1X4HA 3JSRA 1UGPB 3OW2S 1V9OA 3RR7A 3PTWA 3JCMW 2DR6A 4WYLA 2LKZA 3MM8B 5GAN3 1KNZA 1YIJS 3L3CA 1X4GA 2HEQA 1NBEB 1M5OC 4A46A 3VHQA 2QLJB 3K5PA 1NH8A 4L6V3 3JB9k 2V2ZA 1AYEA 3QFWA 2HNDA 1SUQB 3CJ2A 3HSZA 1S6OA 4HTJA 2EBPA 1NLPC 4DOWA 3BPS