1NPRA

Crystal structure of aquifex aeolicus nusg in c222(1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nprA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nprA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nprA01
1VQ4A 1VQLT 3I55A 4CRIA 5J3BA 1XTDA 1Q7YC 4ZN1A 5DM7R 3CCVT 1YJNA 2OUGA 3CCET 1M1KC 1VQKA 1RL2A 2OTLA 3CC4T 3HKSA 1M90U 1VQNT 1UEBA 2JUFA 1NJIC 3QQCD 3LPEA 2JOYA 1VQ8T 1KC8U 4QQDA 1VQPA 3LD7A 3PIPA 1K9MU 1S72T 4RG2A 3LH0A 2QA4A 1YI2A 1Q82C 1VQ6T 3CCLA 3CCMA 3OW2A 1YJ9T 1VQ7T 1VQ5A 1VQLA 2EIFA 3CCUT 1N8RC 1YIJT 3PIOA 3DB3A 5FLXE 1BKBA 5A2QE 3CPWA 1VQ9T 2KDSA 1K8AU 3CCVA 3J7AF 3CCEA 1NPRA 2JNGA 3JAME 3CC7T 2OTJT 1SSFA 3CPWS 1KD1C 5IT9E 3G4ST 5LL6S 1KHIA 1YBYA 3CC4A 1VQNA 3J80E 2E6ZA 1Q81U 1EIFA 1NJIU 1M1GA 1Q86C 1YHQT 1VQ8A 3LGFA 1S72A 1K73C 2XHCA 2DO3A 3CCJA 3CCJT 1XNIA 1YJWT 1VQ6A 1YJ9A 1VQMT 1VQ7A 3H7HB 2LCLA 1NZ8A 2QEXT 3CCUA 1N8RU 3CMAT 3OW2S 3TREA 1YIJA 3CCQT 1VQ9A 1JJ2A 1Q7YU 1M90C 1M1KU 3KBGA 3I56T 3CC7A 2K06A 2OTJA 5J26A 3CCST 1KD1U 1JJ2S 3G4SA 3G6ET 1YITT 1M1HA 1QVFA 3CXCA 1VQOA 2LVMA 2LQ8A 1VQOT 1KC8C 1X6OA 4OBIA 3EWGA 1K9MC 2KPPA 3G71T 3CCRT 5IAYA 1YHQA 2KVQG 3CD6A 3CD6T 3J81E 1IZ6A 1NZ9A 1NPPA 3CMET 1K73U 1VQ4T 1KQSA 3I55T 1W2BA 1YJWA 1Q82U 3A5ZB 1VQMA 4ESNA 1KQSS 2L3RA 4YTLA 1W2BS 1K8AC 5DLQE 2QEXA 1YJNT 2EXUA 3CMAA 4ZN3A 1VQKT 3DLLA 3CCQA 2OTLT 2G3RA 2CKKA 3ER0A 5HY6A 4TVRA 1QVGA 3I56A 2E70A 1Q81C 3DB4A 2MWOA 3CCSA 3G6EA 1YITA 1QVGS 3OYYA 2MWPA 3P8BB 1VQPT 2IG0A 3LGLA 4X34A 2JVVA 3G71A 3CCRA 3CC2A 3CC2T 3CPFA 1Q86U 1QVFS 3CXCS 2QA4T 2MI6A 1YI2T 3CMEA 3CCLT 3CCMT 1VQ5T
chains in the Genus database with same CATH superfamily
4DSLA 3IM9A 3M56A 3CTRA 4ATOA 5LM7E 3TWZA 2DHAA 3DLEA 4LSNA 2PEBA 1YI2Q 1YWXA 4LFBF 1WSVA 1G3TA 4WCIA 5SZTA 3KLIB 4RTVA 3OSPA 1Q78A 2IMOA 5HKCA 3RRKA 4IDKA 5BYQA 3IG1A 3G96A 4OZ1A 4RUCA 1BI0A 5G0RA 2L3QA 1M5VC 4O0NA 2FVQA 4M7DC 1RADB 1NKBA 1KD1T 1A0NB 4NS5A 1CVJA 3PVLA 2UXDJ 4IKFA 4M7DE 4GKJF 2EQMA 4CLTA 2GAHC 3OY9A 1BU1A 1UGSB 1EX8A 4LBHA 1VQ6S 1M5OC 3L2RA 3CD6Q 3BGRA 1JJ2A 3ZZZA 1WJRA 3AXMA 3CCWA 3KBGA 4HTIA 1S6QB 5D6YA 4FNHA 4OYBA 2B5JB 1QVFA 1N5TA 4H54A 4DA4A 2DNOA 4J9PA 3OT9A 4OMFG 1S6UA 1SB6A 4G3IA 1X8DA 1WLPB 3OFHA 2LT4A 1F60B 3RW6A 3EFRA 1HWUA 4MT1A 2DRDA 4FXWA 3VCDA 4LFAJ 3LYIA 5KFHA 5GAN4 4RPFA 2XZWA 3CD5A 2ZWOA 2MWPA 4Y2MA 2GJIA 1VRTA 4B6MA 1UVLA 1TL7B 3KK1A 4ANEA 4IQXA 2LXIA 3CF5Q 2EVRA 2ZBRA 3QFHA 2NQPA 1HBNA 1GRIA 1WXTA 4X66F 1HNWJ 1YBTA 2PMWA 2BJ3A 3MI7X 1SJ1A 4M75G 1UWBB 2LCWA 1JLAA 3F44A 3LP2A 1R0CB 2CH4A 3OR1A 2J0XA 3R1LA 4DLGA 5A2QE 1RAHB 1IN0A 4B17A 2ACMA 5GAMe 2IVWA 5BYSA 1VQ7Q 1HD0A 1VQKS 4RBUA 4O3SA 5KT7A 1GL5A 3K59A 1KVJA 2DTJA 3M32B 2OEKA 1Y96B 2NUTA 3NAIA 3M9MB 3M4YA 4FVCA 3PRDA 1GH8A 1MNEA 3R9LA 2MHNA 2EFGA 2L0AA 3PX6A 4JP8A 1ARKA 1JXVA 3J7AN 5B0FA 2CZ4A 1RHJB 1CKAA 3IXQA 2W01A 5CH7B 3ZZYA 3OBYA 4LR9A 2UV8G 3IFEA 3DRSA 4C7QA 3V4IB 1PILA 3CPWP 4CC4B 4AFZC 3QNWB 4PJOC 3NY0A 2GV1A 1KHCA 2PA8D 3G6YA 3QJLA 4DV0J 4M78G 2O9SA 3CGIA 2YRDA 4PJOE 4Z89A 2RJFA 1S1UB 4LF7F 4JI7F 1YJNA 4OHXA 4CC7A 2CJXB 1XERA 1GTEA 1R8HA 3PIPA 2DNZA 4ALZA 1Q7YR 2JLEA 3DLHA 4A8YA 2C42A 3DHWC 2CSIA 4WK1A 1RE1B 3OMGA 1CPZA 1RI0A 3QKJA 1GMWD 3WX8A 1OPLA 2VG5A 3NTHA 3JB9J 4LT6A 1TKTA 1CJUB 1TP7A 2V8VA 3IA0A 4P75A 4F0HA 1JLCA 1QTNB 2RHUA 4BI3A 4V2SA 1SL1A 4BE2A 3ENVA 2LECA 2K1RB 1RTIB 5A6PA 4DQPA 1UEVA 3CDAA 4C8YA 4EO6A 3SFMA 3DDKA 2OP5A 2XMAA 4LF7J 1MROB 3R3TA 2HHXA 3JCMe 2QRRA 3R5GA 2BJ7A 2RPNA 1EP4B 4ED8A 2HQCA 4E7JA 2QN6B 4HA8A 3JB9D 2ROPA 3PNWC 3DLMA 1SKWA 5K8MA 4GY5A 3JCMW 4TLRA 4DBQA 2HIYA 4ED3A 1PO6A 2O9VA 1UJ6A 3RBEA 3OHBA 1JLGA 2NSBA 2GGRA 2BXJA 1YWPA 3G6VA 1UGQB 2RQTA 1BQMA 3FRZA 3OYYA 3DFEA 2HBPA 3W2VB 3FC9A 3MECA 3VS3A 1LOUA 3R1HA 4A4JA 1WEYA 3CCLT 5THWA 1U06A 3MURP 3KUEA 2LQ5A 4DR3F 2LP4A 2K3YA 3SDEA 4B3TF 4I2PA 1BWEA 3JYTA 3OFGA 4MAKA 4UOHA 5DM7Q 2RQKA 3ET6B 1UTAA 3QQCD 4FF2A 3DI6A 4FT4A 4J6YA 2D6FA 3PKMA 2JN0A 3V5RA 1T9YA 3FVYA 2KVQE 5I3QA 1VQ8Q 4ZVOB 2DEUA 2V2KA 1LWEB 3DLBA 1AFJA 2Y0SD 2IVMA 3IR7B 5U47A 5CKEA 2DEIA 1Q8IA 1C0TB 1C6VX 3AJ1A 1S9EA 2HWTA 3KJNB 1CC7A 1SIWB 3MEVA 2MGZB 5IZHA 3HHNB 4Y92A 2BOPA 3X24B 2WAQD 3I96A 2XLKA 1BE4A 3QGGA 3OUYA 3IMQJ 5BYRA 4B3TJ 4YS2A 1YHQA 4MTPA 2D3OR 2F2XA 1MWYA 1RWNB 4Q45A 3CMET 4LF6F 1HWKA 2V0NA 5DDQC 4WTYA 2E1AA 3MPWA 1S59A 3RBDA 3KK2A 3V7SA 3PEJA 4A8XA 3K5PA 5KFKA 1K1SA 4OJ3A 2DNKA 2E64A 2O5DA 1YITA 4L3KA 3ZNUA 4JRIA 1XQHA 2V67A 2Z0WA 4CDIA 1VQOS 2QJ3A 3JQKA 4TU9A 5MAOA 2PSZA 2HBYB 4A8QA 5GAMh 4DV7J 4DL7A 3HFKA 5CA5A 4PG5A 4NL5A 1XTDA 5DM7R 3L2UA 2LA4A 3B4DA 2MKCA 4O0IA 2V4RA 1HBMB 4C0BA 3NPFA 2HG4A 4MDXA 1V3SA 3OTOF 2M0YA 3MM7B 4X65J 2O88A 2JT4A 3CC2S 4MZPA 3W9HA 3UD3P 1HMVB 1IBMJ 1LK5A 4HYKA 2SEMA 4LF6J 4ZP7A 4TVAB 2OPPA 2R7SA 5CZVA 3MF5A 2YQ0A 3HLUA 4DQIA 4N77A 4ZOSA 4FSXA 3R6LB 1D3BA 3CB4A 2DJZA 1SUQB 2ABLA 5IT9U 2MEWA 1X69A 1WXBA 1WA7A 4B9SA 1IM6A 1YQHA 1URNA 1M27C 2RJZA 2LRQA 5GMKm 2DXFA 4HKEA 3C14B 4Y2KA 3HHLB 4XTTA 4Q43A 2VPXB 2VPZB 3PV8A 2R5MA 1T3NA 2BACA 4KYZA 2E9TA 4CRJA 1BB9A 4LREA 2OFGX 2MKHA 1N0UA 2DGWA 2HS0A 2LQBA 1HD1A 1WELA 1SXLA 4R56A 2GJ2A 2JM9A 1WKKA 5D0EA 2F4VJ 5FU6B 4FKYA 2E44A 3G71A 4QR0A 1N34J 4Y00A 4M75D 3HD2A 2ZDPA 2CJKA 2LMIA 3MCSA 1QMCA 2ZWPA 2VBWA 2E6NA 4WKRA 2J7UA 1XC9A 2RH3A 1K8AT 3CCMQ 3WIVA 4NRTA 3WIUA 1YBAA 3T5JA 3RG6A 2KK4A 4I7FB 1SQEA 1YDLA 3AA9A 4B9NA 3CBPA 3QWPA 4L74A 1U3OA 3CJRA 3EHRA 3JCMh 4WF9Q 1WUUA 4DV2F 1V1CA 1WG5A 1O6XA 4B3MF 1U6BA 2XI3A 4ECXA 4RTZA 3HL8A 3D6MB 4A54A 1Y5NB 3CCJT 2KY9A 1VQ6A 1VQMT 2ZVSA 2IY5B 3C94A 2MJNA 2P4TA 5GAN8 3INZA 5H9FJ 3W5YA 3M30A 4A8MP 1RLDA 1OO0B 2RJCA 1NK9A 2W9AA 5BR8F 5KFSA 1X9SA 2VG6B 3QGIA 4YB1P 1RTDB 4M78D 3NP5A 2XWXA 1G2BA 2WVEA 3C66A 4HACA 1K8AC 2Q43A 5F8JA 1OV3A 5J1PA 1YIJS 1QE1A 4F4ZA 4ZCLA 2W24A 3R7SB 5B0CA 2KTQA 3O2IA 3UDLA 2XYGB 2V8IA 1RTJA 2NS1B 9RUBA 4RNNA 4DV6F 4B3MJ 4EFAC 1F3FA 2E4HA 3EICA 1U4BA 1VQ4S 3CBOA 2XO7A 2AX0A 2A0FB 1CJKA 1T3OA 5E3RA 2GIFA 2J7WA 2E1PA 2DTOA 1KC8U 4J7FA 1VR6A 2MYSA 1PBUA 1UCNA 1MNDA 1Y4ZB 4YB5A 2O3DA 4CM2A 4KBMB 1KEKA 3QZ7A 2KT3A 5GADU 4ZJOA 3TVKA 5H9EK 2WRMA 1S4FA 2JFDA 2GQQA 4Q44A 4TYAA 5E0OA 4UOGA 4DV5J 5KE2A 3IGNA 1N5ZA 2VYTA 2RQUA 1WC0A 2HNDA 5D3GA 4ETZA 3U1LA 5DS7A 1Y5LB 3WX4A 2DL5A 1IVZA 3N0VA 3CC7S 3C2PA 4MMOA 3WHIA 3ZZRA 2VONA 1OOTA 1NZ9A 4H4KC 3EM1A 4E47A 2OAWA 3PRBA 1JJHA 4ED7A 1D9FA 4EMKC 1LW0B 2CQPA 2HHTA 3BH6B 5J1EB 2CNLB 2XSJB 2QEXS 4UZBA 1N5SA 3IRWP 2JXBA 5L23A 1VJWA 3I56S 4DZ6A 2I8EA 2ZH3A 1H74A 4BC9A 5K5MA 4KV8B 3MCAB 2A2CA 3KLHB 4ECZA 3HFOA 4ER8A 1ZPWX 1KQGB 1MSWD 4C5EA 4K8RA 1JU5C 2ZCFB 4W98A 1WDDA 4M77B 2ED0A 1T05A 2HKEA 3KOAA 4OYMA 4BE1A 5LMUF 3DYAA 3GIBA 2DEJA 2L5QA 1FMWA 2DA9A 1S97A 3CCVQ 4OHVA 5K14B 2MB0B 4ELVA 2X7IA 5ETVA 2G0JA 2HFVA 3TA0A 3M2UB 4BACA 1VQLS 2OO4A 2JEFA 1PJ7A 2QI2A 2U2FA 2LX7A 2AV5A 1RLQC 1WYXA 2XICA 3CW2C 3BSNA 3QJJA 5HBMB 5GAOr 1NH8A 1RT6A 2YWFA 4M5LA 1S1XA 2E41A 2EBPA 2KI7A 1VQNS 4YR2A 5D4OA 4YTLA 1LK7A 2DO0A 4QVZA 2VFTA 5I3UA 3OVSA 4OYOA 2HMAA 3TSZA 1LV5A 1WF0A 1VIOA 1XNQF 4FF3A 4PJLA 4HVWA 3X1LB 5HJYA 2K5IA 1I0CA 3GWCA 2GZOA 3CJ8A 1NPKA 3FRYA 3HHLC 3UDEA 2N4DA 3VF0B 2RDIA 1SJ3P 2MKYA 3D68A 2QA4Q 3JQJA 3NS7B 3GYXB 2RB7A 1VLOA 1KSPA 5CR2A 3LP0B 2QE5A 3POTB 5FU6C 2CJBA 5GANh 4DPUA 4USIA 1X0FA 1YI2S 1KHVA 1BQNA 4KPYA 3GYGA 1WC5A 2UXCF 3Q22A 2LJ3A 5GJVB 2YWGA 4MFBA 4JI6F 1X4FA 4ZPDA 4ZK7M 5HI7A 3NMAA 3THVA 3CXCR 1XNQJ 3UQSA 2YRVA 4A8KA 2EGAA 2ZH8A 3MOJB 1KQSR 5HATA 1FVSA 3QIPB 5GAEI 1ZH5A 3REAB 1JJCB 2FC9A 4AFQC 5J2QA 1UG1A 4CC3A 1S7IA 3WBZA 1XBWA 5FIIA 2K79A 5AXMA 1H0HB 1P8GA 4J9LA 4X84A 2IM3A 5D15A 3DLLQ 2Q6BA 3CDEA 5IXFA 4IUTA 1Q86T 4QW9A 3LPYA 2VXEA 2DHGA 2OELA 2A7YA 4IYQA 2D3UA 3DNCA 2MJUA 2DE0X 4NLPA 2YX4A 2DIQA 4WE1B 4QBUA 5F0WA 4DSEA 5LL6d 4IH6A 3Q2TC 4BBYA 2RD1A 4R0KA 2R4FA 2CA9A 4ZITA 2KZMA 1Q53A 3A98A 2Z8QA 3DLKB 4ZVHA 4JI6J 4O4GB 2KJVA 4EPCA 4NEZA 1PM3A 3V81A 2K57A 3VS0A 2IYIA 4O3NA 3U23A 2KKHA 1X9WA 2GQVA 4PG8A 4GRSA 4OB2B 2YPZA 4PQAA 4GVBA 5C25A 4HEA9 4TLQA 3GJSB 4M7AF 2OPRB 4XU3A 1W2BP 2QX0A 2XGPA 3N6MA 2OH2A 3MEDA 3RKYA 3SEMA 3JAMY 4LFCJ 3LH5A 3OXGA 1H7XA 2YKNA 3JSYA 3TUIC 2HNIA 3DMJA 5H1SV 1IRXA 2HHQA 5HN0A 1QTMA 3BREA 1WQWA 1Q86C 4TU8A 3CXCP 2UUBF 2RJDA 1W7WA 1V3RA 2EPDA 1VS3A 1KD1R 4PJMA 3H41A 4ZTJA 3ZZUA 2RRNA 3J80U 1VQ7S 1GMWA 5KT6A 2KI2A 3SSQA 1KQFB 5GAOl 1YP5A 5FD1A 4ANCA 2NPIA 2ZH6A 3CJ4A 1LXJA 1GXTA 2F1LA 3P3DA 1ZBJA 4KFBB 3EG9A 2BRLA 5EC7A 5CQYA 5JVGQ 4X4QA 4LSLA 1N6QB 5AT1B 3CCQA 1S12A 3SQGA 1FFGB 2AJ2A 1YKWA 2VUBA 4J9VA 1UUEA 4PXCA 4MK7A 2GMLA 1QCFA 1ZUUA 4JRPA 2JMCA 1B70B 5KT2A 4OZNA 2WVBA 2AKLA 2ZITA 3QUIA 2VFRA 4HCZA 5HO4A 3GSDA 2HQGA 1K1QA 3O8VA 5I4MA 2EQUA 2V50A 4C8LA 1QSYA 2QA4G 1R77A 2KAFA 1NJIT 2J7IA 2CPZA 1Q5VA 2JOQA 2AJ1A 1J5OB 3OPKA 3DDNA 4J9FA 2W25A 1H3ZA 3TVTA 1WJQA 1QLYA 4M77C 1N9RA 4OYWA 4F36A 1MMAA 2L41A 3MM9B 5KYNA 4MH8A 1HPZA 4NE9C 1ZM4A 4P7VA 1ZBTA 1PNJA 4CLWA 3KDNA 4CI0B 2UU9F 4FVMA 4LF2A 4ME7A 1FRIA 4IFYB 2LQKA 4L73A 4P10A 4M5NA 4OBIA 4B3SJ 2DKOB 4LRFA 3W5ZA 4P2SA 3E51A 2BZ8A 2PFFB 4DL6A 1NLKL 1D3WA 3DOKB 1NKEA 3J7YU 4OZ2A 2OKQA 5C24B 1QVPA 4A53A 2VBZA 1LFWA 1X27A 3GE9A 4RW4A 3D54A 1XR7A 2R8GA 4QW2A 2XBPA 2J6SA 1HQEA 2LEBA 2IAJB 2CAJA 1MUZA 4F8RA 2G13A 1H6KX 4XDCA 1VQ4A 1NXIA 2VV5A 5HL7Q 3CCET 4HL9A 4YB7A 2M2BA 2A3LA 4CLYA 4F0MA 2FJWA 3CCLQ 4G1QA 4PCQA 3V6DA 4F7UF 3MO8A 4WFNQ 4NA1A 2BQ3A 2MPXC 3W66A 3K2YA 3LWMA 4ZTFA 2JFKA 2E65A 4J9BA 1WNEA 5CCAA 2HSPA 4KUIA 4QW8A 1YJUA 1BKBA 3KG0A 2VQEJ 4W92B 2VIHA 1QUPA 3LWLA 4DV4F 3QHSA 1HBOA 2FLPA 1U0HA 1ZZNA 3I5CA 2ZJRQ 4P2MA 2KBTA 4NA2A 3OSVA 1BWVA 3QFWA 4DR7J 1LKZA 1UFKA 2UUTA 1CKBA 4IOAQ 1C0UB 5KFOA 3F0NA 5HAOA 3SCIE 3L7OA 1M5SA 3QO3A 2LKZA 3CC7A 2VBXA 1X4AA 4UQGA 4RO0A 2GQCA 2Q1LA 3PE0A 4C8QF 3IRXA 4PLLA 3OVBA 4OZ5A 2V63A 3VGTA 4C92B 3M9OB 4L3NA 2QEXA 4PYAA 1VQKT 1WG4A 4E7KA 4R8UA 1ZAVA 3CMEQ 2PD1A 2EAYA 5IH2A 3I56A 4QWAA 2RVJA 1Z4UA 1JEGA 3VAJA 1BYMA 1W70A 3J7ZT 1WTFA 4Y0FA 2JH3A 2FJAB 1AZSA 3C0CA 2KRSA 1FX7A 2KT2A 1VQ5T 1GXLA 2I0NA 1HYOA 2R7OA 2CPDA 2X3WD 4G65A 1YJ7A 2LC4A 1RL2A 2DNGA 3O5ZA 4C8MA 1IKVA 5F8LA 2IDLA 1UFFA 4OX7A 7FD1A 4PPDA 1F2GA 1V9OA 2MQPA 4NYOA 2CUYA 2EWHA 2AHOB 1WDTA 4NXMF 1IBCB 3IC1A 1VQLA 1QKXA 4OHZA 1N8RC 1FNOA 3ELHA 1X4EA 2MMPA 2RAQA 4PAAA 3VAFA 2EGCA 1KVKA 3OHAA 2W9CB 5ETOA 4NASA 2ESWA 3Q8YA 3W61A 4ED4A 2KH9A 3QJYA 4C3MA 5CKBA 4F26A 1RABB 2YNGB 3N5FA 3O6QA 1V29B 2N3OA 1LWCB 1X6GA 1WDXA 4HVUA 4NXNF 4DQRA 4U96A 1WC4A 4OQJA 3LGMA 3GU0A 1OY9A 1XIQA 1TMMA 3QATA 4ECYA 2MZQA 3BGLA 2HVIA 1PSDA 1NO8A 1RAOA 4P7TA 2KVQG 2NZCA 3CC4S 4AXJA 3JAMU 3HKWA 1VBZA 1FDBA 2VU5A 1CC8A 1S77D 4K7QA 5IM0B 2RA2A 1LXNA 2I0XA 2I5JB 4M7DF 5HK0A 2MCNA 4NXMJ 3UN5A 1XMQF 1KDNA 4ZVGA 2V94A 3HFNA 1P27B 3P4UB 4M78A 4ZLJA 1PGZA 3MM6A 5ETTA 5T41A 3MUMP 3T6JA 2QZ8A 3E9GA 2QT7A 4PNOA 2EYYA 5IC6B 3TJAA 1GK8A 1NB7A 2BE2A 3EFOB 1I07A 4ZIWA 1KKHA 2OGUA 1N48A 5RUBA 3MEEB 2AYGA 5LJ5f 4HR2A 1YI2A 2DGOA 1YSJA 4E2FB 1IUJA 4CT8A 1RBAA 5FLXY 1RGVA 1HNXJ 4KUDK 5IOLA 5DQGA 1FKOA 1HYSB 4ZA1A 2B4PA 4JI0J 5KOWA 4UC4A 4DPOA 2H9ZA 1VI7A 5KT3A 4C98A 2CT4A 4GO5X 2IRYA 2BZYA 4QYZK 1R8BA 2SRCA 5HP1A 4RW8B 5GAOn 4LSNB 1HNIB 4J7IA 4ZHRA 4EBEA 2ZBCA 3GONA 2VOPA 2XLIA 3TZZA 2RH2A 2CJQA 3EXYA 4IDKB 3IG1B 1VQMQ 4NWBA 4DU7A 3LUYA 3CCRT 4RU2A 1G5VA 4LUEA 1S57A 2I2YA 5G0RB 3CD6A 2ZNZA 4CO4A 2JZ5A 3E8OA 2RQMA 2FL7A 4GBQA 1MG7A 4XU1A 3TYTA 5F8NA 3UPFA 4CI0C 4ZLNA 4B3OB 3MGJA 1J5EJ 2BX6A 3GPAA 4RKUC 1TSFA 2ZGWA 2M3DA 1M8VA 1U1KA 1QSSA 5IT4A 4PQUB 2CGHA 4IG3A 3KJFB 2RILA 4UY8T 3QSYB 2K3XA 1IR2A 1RA6A 4RBVA 5EUHA 3FDRA 2NR0A 4DX7A 4NZ6A 1FEHA 1URRA 4IO1A 2DBBA 1VIXA 3KJVA 1EB0A 3HVTB 3FMWA 2XGQA 2BOAA 3LF0A 2W2QP 5GAN6 1RT2A 1R31A 3D6TB 1I94F 2B4VA 1U1OA 1K8AR 2G1HA 2VFVA 4ZMMA 1U47A 4LMZA 3BR9A 3D0GE 3ZZOA 2ERRA 2Z30B 4JI5F 4J9UE 2DD4A 2DTHA 3QZ8A 1IREB 3KK1B 1FJCA 3QZ9B 2KVIA 4NOYA 3BBFA 1VQPS 1JNRB 2V5HG 1VQ7A 4LSZB 1L3VA 2FVSA 3ENQA 2M52A 2GO9A 2C2OB 1X75C 3T1HF 1JLAB 2XC9A 2HSEB 3LP2B 4M75F 2FZGB 2ASDA 1FE0A 2EKNA 4ED5A 2J06A 2XEXA 4I2QA 2IA6A 2ZDOA 1RWMB 1DLOA 4JI2F 3FFIA 5LT5A 1E6GA 3DXBA 4TYBA 2DTIA 5A8KA 3VAGA 4O44A 4NLXA 3M8SA 1YJVA 1KOOA 4IUUA 5DQHA 3EGXB 2DPJA 1JXEA 4NA3A 2B3TB 2IC3A 4Q0BB 2HZCA 4F02A 3CULA 2D9PA 3QSIA 2CQ0A 2AJFE 4DF4A 4AMCA 5GANd 3PW7A 5I2MA 4URSA 1YCYA 2APOA 4C92C 5KTQA 3LQVA 2CPEA 1HKAA 3NEKA 1JQGA 3META 3QMQA 1FX4A 2XSFA 2JUFA 4C92E 2EQIA 4BDYA 2KT5A 1DBDA 1I6JA 2LXUA 5KFMA 1RXOB 2XS7A 3GV8B 1M2VA 1FK9A 4KHPF 3MUTP 2QG9B 5A2QY 1F5BA 3FDSA 1KQ1A 2E1MC 3E9FA 4DSJA 3CCVS 3MPVA 2XMWA 2E6ZA 4IURA 2FC8A 2ATCB 2IIMA 3BPSP 3CWJA 2XIDA 2AMCB 1XN9A 3K5OA 2FEIA 1X2QA 1VIFA 4A4FA 2OI2A 2DXCA 2FGOA 1DQ8A 2XDDA 4C48A 2D3ZA 1IZ6A 2EKOA 2B4UA 4LR8A 4Z7CA 3I5BA 3OYMA 4LQ3A 1DURA 1KQSS 3O8WA 2CNKB 2VG5B 4ORZA 1IQTA 1RHRB 5IXBA 3LX7A 2D41A 2G3RA 3JCMQ 1TKTB 3HP6A 4DCPB 2QSWA 4KHPJ 2QQBA 5EHHA 3ICLA 2BUNA 1JLCB 4RW9A 4RG8A 2PEHA 2BKOA 1L3TA 2GQ2A 5CKFA 4HVVA 1R0AA 1X4HA 1WF1A 2LT1A 1RT4A 3HHTB 2LP5A 3WVDB 4ECVA 3PX4A 2GTJA 4O3PA 4C3KA 3NOGA 4OYZA 3PZPA 1S1TA 3S01A 1JJ2P 3PFEA 1QVFP 4PJNA 4NLUA 4ES3A 2MYFA 4M5KA 2JZ2A 1ELOA 2CG4A 3A3PB 3OBIA 3OYKA 2X1BA 2QA4S 3QLHA 1YIJT 4AFFA 1VGYA 5FW9A 2O2OA 4K5RA 3EZ5A 2IHR1 1KHIA 2JJ9A 4A47A 4OX9F 1R89A 4OYIA 1VQ8A 4PPZA 2LJ0A 2HGLA 3JYTB 3OR2A 2ZOFA 2JVRA 4FM4B 3RKXA 4TY9A 2IM0A 1NZ8A 2CQ2A 3CO9A 4RL1A 4UUXA 3TREA 3UD5A 4U8YA 1CBKA 3GJRB 1L5UA 1CQNA 1X5OA 1B0PA 4ZP6A 4C2MA 3RYLA 3VV0A 5FLXU 1SC3B 2WK4A 2HAIA 4F2SA 2ZZTA 3EVOA 4CP5A 3GFXA 5DLQE 4OP0A 1S9EB 2KT8A 3L95X 2A6MA 4TU7A 2OTLT 2LXFA 1QAIA 2NCKL 2B9XA 5L1JA 2PQWA 3MKDA 2VJVA 1NK5A 4DFJA 4X34A 2I1RA 1JBMA 2XMVA 1J2VA 5FWBA 3CO0P 4ZPTR 1MMDA 4FXVA 3ZZTA 2EQKA 3LP1A 1KOHA 4JOUA 4DG1B 4B9TA 2CNNB 2QIFA 4OB1B 5FDLA 4ID5B 3EE3A 3PW2A 3RAQA 3KJQB 2YSQA 4JJBA 3S3MA 2D1CA 2RUGA 1YK9A 5LJ5Y 4LVNP 5KFXA 4QWCA 4J9EA 4ELZC 2HURA 4IH7A 5E3CA 1KQ2A 3QRRA 4QR1A 1NJYA 1QKWA 5ETKA 2UVVA 3G4ST 1NCLA 1TVRA 3NNHA 1F5CA 3U1MA 3QO9A 2PZ1A 5KG4A 2O4XA 4P71A 4N8NA 1E6YA 3ILLA 4J90A 3C95A 2HGNA 2QYCA 3PJ9A 5J1NA 3R2CJ 4FU6A 3QZ5B 4I4BA 1RWKB 1ZSZA 2MLYA 1DTTB 2KGTA 4DFMA 1Y57A 1SEMA 3JRZA 4F3OA 4ZPAA 5DLOA 1V6HA 1HNVA 2OPPB 1FKAF 2QDYB 2AEMA 3T5KA 3V6KA 4J9SA 1Q8KA 2ZD1A 1KONA 3I0RB 3A8MB 1HFEL 2V2ZA 1LEOA 3JS9A 4DR4F 4KHMA 4DEYA 1Q86R 3VTIA 3QGHA 1EJ7L 1ZM2A 4F17A 5KFFA 5EX3A 4ECRA 4JJDA 1TH7A 1D8ZA 5CKHA 1PC0A 3OS5A 3PT9A 5GADI 2VUGA 3KFWX 4GVLA 3FEXB 4AUKA 5HQLA 1IWAA 1VQNT 5HJXA 3MJXA 5JXSA 1U1NA 3DN9A 1GFCA 3C3LA 3RBXA 2ZKTA 3CCMA 1RU2A 2JS0A 4I56A 3CCUT 1RLCL 3MPDA 1JLQA 3CIMA 3TX0A 4JJNK 3BV8A 1D1AA 5E33A 3G86A 1RP5A 2OSQA 2P0QA 2HK2A 1YNZA 5GANj 5D0RA 3K5LA 1ZA1B 3HRSA 3TAMA 3F73A 1PBAA 4UOFA 2Y4XA 2BM0A 3S8SA 1P1LA 1RAIB 3RUXA 1FKPA 2AW0A 2W9BA 3OW2S 1VRUB 3I9ZA 2RHIA 2RF0A 1OU9A 4LDVA 4FT2A 4MMLA 1KD1U 3IO1A 2EBEA 3EWGA 2MK5A 3DKDA 3JB9I 2V2QA 5JJBA 2OJ3A 1UJ5A 3EGNA 5A2QU 2F9JA 2MTLA 3C6TB 4K2JA 3KUFA 2ADCA 4DOVA 1KWMA 1JLEA 3KLEA 1TS9A 4HHHA 4ES2A 2P84A 4DR6J 2KZZA 1JLFB 2I9SA 5HSPA 3CUNA 1RWWB 3C6UA 4DN9A 3CNQP 4LVOP 4DZDA 4FS1A 4DR1F 3DKMA 3M30B 4LDWA 4V19X 2H5EA 1HHTP 5M2UA 3HI9A 4IUVA 4Q5VA 4J5YA 3M6UA 1ABQA 4U95A 3W8GA 4OYXA 2C2MB 3SFGA 3S6EA 4HACB 3H4DA 2ATLA 3TW0A 3OYDA 5L46A 3VGUA 1KRPA 4LF4F 3RGIA 1NJIR 2J8AA 4MYTA 3CCLS 2BQUA 5IFMA 1S1WA 2ZPIB 1M1KT 2KL8A 2RT3A 1WC1A 5M2RA 3DM2A 4Y2IA 3OJSA 2NXEA 1YCSB 2AK5A 2QQSA 3MM8A 4PG4A 1FVQA 4AL6A 5FRNA 3N6LA 3MCNA 2LU1A 4F7VA 1EFNA 4U7UD 1ZX6A 1WSRA 3VQTA 3EFSA 2HCKA 2EVZA 3KFVA 1WI8A 1ZS6A 4MIBA 2WVFA 1WJ9A 2RE1A 1UGPB 2D3O1 2MKIA 2IYGA 1LJOA 3G1JA 2R7RA 4K0KF 2HNDB 5I11A 3M1VB 4XPEA 4NCGA 3VHQA 4M77G 4WYLA 5ETLA 1VQKQ 3N28A 4UUWA 2X1FA 2A28A 3EDRB 4EZ9A 3PHTA 3CMES 4K50A 2OJ2A 1UA0A 4OMLA 1M1KC 2CDRB 2CQ4A 4LDXA 1VQ5Q 5IC4B 1N5QA 3UR0A 2OX7A 1U1QA 4RBTA 3TU4K 2EG1A 4WKYA 3MAAB 4RJVA 1REVA 2B51A 5CQGA 5KFEA 2VOOA 1KHWA 3CCVA 3H25A 1YJTA 5H9FK 4PK4A 2B7BB 2HNYB 3EMTA 3GIKA 5IXUA 4DS4A 2YTCA 1H73A 1LNQA 1T05B 4QIFA 2JEJA 2F8HA 4ZGDB 1CJVA 2RJEA 3DYAB 2L9NA 4YY3J 4PYDA 3RTVA 4KGZB 2XCPA 2G0CA 3CXCA 4K59A 4CLLA 1Y07A 4OYAA 2FJVA 1I81A 2NUPA 1KQSA 3EDQB 1W6XA 3V7RA 3V8KA 2VHGA 1NB2A 1LW2B 5I22A 5AE3A 2DISA 1YJ9S 3HO1A 1WOPA 5SUHA 3Q8SB 1TXQA 1FRJA 2HHWA 4LXCA 1RT3A 1OPKA 4OLOA 1MU2A 5A0YA 4EBDA 2JVVA 4DL5A 4OI1A 4WFXA 1D09B 2HNZA 2GBQA 2FIUA 1RAJA 3RJMB 5KFGA 1S1XB 1C0MA 1GXUA 3HVAA 5L8RC 1B34A 3GFYA 4JYAF 1S99A 2OPSA 5A6WA 1Y7PA 2DNMA 3BQ0A 3IS9A 5L8RE 2QA4A 3M0QA 4QQ6A 5I3UB 2HZAA 1U8RA 1AFIA 1HSQA 3MM5A 5KG3A 3H5XA 1NLOC 1UJ0A 1BUXA 2D0QB 2EKYA 2E29A 4FKXA 2DEQA 5EWFA 3OQ5A 4PWWA 1B3TA 5KCHA 5L1LA 2HHSA 4WJBA 3TAPA 3LAMA 2CZ9A 2IMWP 1HA1A 1VC5A 5C0MA 5LJ3h 1N33F 2R7VA 4LUBA 3H7HB 3PW5A 4DFPA 2CPYA 3P45B 4ENOA 4PWUA 4OLPA 4CTAA 4MK9A 3EPIA 1B0TA 5HK4A 3RBZA 5CYQB 2DRMA 1V5IB 4YMEA 1N9SA 4RUGA 4BY6B 5F3TA 4F4YA 4QWDA 4GKKF 3HVRA 2KXDA 3AB4B 4MFBB 3CCJS 1UECA 3CCRQ 2CQDA 4ZN3A 3BO3A 1VQMS 3HPWA 4AG2C 3DLLA 4PUOA 4J5OA 4PABA 3VV2B 2E1HA 3K57A 1RHMB 3H8YA 3AAWB 1IKXB 1G83A 4ZPVR 1T03A 3FEOA 5DQIA 1NHKL 4YOEA 4JPBW 2E1RA 2ZM6F 2D1XA 4JI4J 5KT5A 3CEYA 2J0SD 3G82A 3OYEA 3DU5A 3H0IA 5D6GA 3UCZP 1TUDA 4RZRA 2HZVA 1UGVA 2GX8A 1T9TA 2LYVA 1R6VA 4L72B 4NYPA 4RG2A 1OI1A 2BJ8A 2CQ3A 2UVRA 2NXNA 4D8KA 2W10A 1IBLJ 2YKMA 4F0KA 2VVKA 1T8EA 3L7PA 2DBKA 2B43A 3OA6A 1TK8A 4PEOA 1TMJA 4PJOA 3V81B 3C19A 4H4OA 1HR0F 3C4SA 3X28B 2KEAA 5E7OB 1VQOQ 1K73T 1IBKJ 3R7NB 4RUBA 3J7YI 1H641 1FMKA 3ZTSA 3I4PA 5L39A 4CYUA 1EX4A 1V76A 4ELUA 3K7RA 4ZVPB 2ZM6J 2KU7A 1WQ7A 2B8PA 4XIUA 1BHNA 4C8QB 2BTTA 2DZCA 5KFJA 5LSLA 5KYWB 3MEDB 1REGX 1D0EA 2YUOA 2YWWA 3CJ5A 3I55T 4RNOA 1SG5A 1IR0A 2C3MA 3DMJB 2YWEA 3A5ZB 3PDNA 1PHTA 1FNXH 1WI7A 4NOHA 3CC2Q 3ZNJ1 2AIRB 2X3GA 3I6PA 2Q3PA 2VFSA 2NWMA 1UPPA 2QLXA 5I42B 5CAIA 4QQGA 3UPUA 2QL5B 1GFDA 1LPLA 4PG7A 2F3JA 2O01E 4HCCA 1NE8A 2RK1A 1HL6A 1FWLA 3NNCA 1JK9B 2DAQA 5IV4A 3BJYA 2GVZB 4ED2A 3CC4T 1JX4A 2CNOB 5GMEA 3J81j 5LMNJ 4LSLB 4AD6A 3T3FA 2DHXA 1O75A 1VMBA 1Z9QA 3TVYA 2LQNA 1T3LA 5KFAA 3D66A 4USJC 1FF2A 2QMWA 4LQ9A 3JXOA 3SCJE 4QPXA 2XKOC 4YDDB 1K8AU 2QL9B 4HLBA 1WHGA 5A8WA 2M4MA 3SWNA 1VHFA 2ZNYA 5GMKi 3PYFA 1LFPA 3FKBA 2BUDA 5DGBA 4HCKA 2JWNA 2GW8A 1FFSB 3NGTA 2DRKA 3ME9A 1S9GA 2VKZG 4DHVA 3CE8A 5KAKA 2EFQA 1FJGJ 2CS7A 2V6AA 4LN2A 4DV1F 4QOTA 3BR8A 5CABA 3L2ZA 1Q0NA 4ES1A 2RK2A 4CQ1A 3PFSA 3BZQA 4M77D 1Q7LB 2R7UA 1KS2A 3GJQB 2K8GA 3HD1A 3VS6A 4HCBA 1SHFA 3DC2A 1UVNA 2HBRB 1HPZB 3HSDA 4Y6IA 1G1XA 5KFCA 4ZVFA 4HI2A 3KG4A 2D7SA 4A4EA 3K8VA 2DYAA 3LW5C 4P73A 1HXDA 4J91A 3I0SB 3RRHA 1TUGB 3KLIA 4BHQA 3H0PA 1FTRA 4ED0A 3TX8A 3LW5E 4X64F 5LJ5e 4U8VA 1M3CA 3QXEB 1UJYA 3QT7A 1W26A 1U1TA 3KLFA 4WBFA 4FCYA 1A9NB 3PMIA 3UVJB 3M8YA 2HQEA 1NZAA 3QT6A 4RW4B 4WP3A 4WXWA 4DV1J 3CCLA 1U1MA 2AZ3A 2DXTA 1FE4A 4LRDA 1R3NA 5C6SA 3GV5B 1S9FA 2HL5C 5IT9E 4ECSA 2RU9A 4F50A 2ILYA 1YIJQ 1GCQC 2DR9A 3QWXX 4N47A 1TK0A 2AZVA 2CDTA 2EJGA 1S6QA 2W2OP 3X20B 4G1QB 3V6DB 2EK1A 1Q82T 2DNHA 4TY8A 5MLCV 2A6OA 4LF8F 5K8PA 2Y1IA 2QYGA 3MP1A 5IAYA 3M8QB 4X64J 4CH1A 3TQ1A 2DZ9A 1U0HB 1ZM9A 3FBBA 4PL6A 1F3VA 4F3QA 2KB2A 1SKUB 2ZE2B 3GZ7A 3HF5A 1VISA 4AQYJ 2MWOA 1C4CA 3BBCA 3TO8A 2KFNA 2FG0A 1HNZJ 4HKQA 1VQPT 4JB8B 2WW4A 1X31C 2XMKA 5KOXA 5A76A 5BXIA 1C1CB 1UL3A 3HX9A 2JX2A 3CMEA 3A8HB 2K3BA 4BY6C 2OTLQ 4CLZA 4EUVA 2R8KA 2E5QA 4BE0A 4A4KA 3NS5A 1OJ4A 3IRXB 3WC2A 4OMFB 2XMJA 3LTOA 3M9NB 1Y71A 1D9DA 2JW4A 2CQBA 4LF8J 3OYIA 1OPZA 3MP6A 4R8UB 1Q82C 4MJKA 2RSQA 2V1QA 2P5VA 5IQQA 2BW2A 3QPHA 2W8LA 1AZSB 5D0HA 5KFZA 2ZFHA 1WHKA 3M32A 2B7CB 4ESRA 4DUZJ 2FZKB 1U1PA 2RS8A 1JJ4A 2D0NA 1HW8A 4II1A 1DJ0A 4MKBA 3G4SQ 1UVIA 4YHHJ 4CO1A 1IKVB 3TAQA 3UDCA 3M5AA 1MWQA 1NM7A 4M75B 4BCAA 5CYMA 3VS2A 1PYOB 3JB9G 5CD4A 3ISND 3VUZA 2BE9B 1PSEA 3I5SA 3O44A 2J7KA 2DR6A 2V8DA 2JVOA 2P9GA 3R6OA 4Q5WA 3AHUA 1FYNA 2D9TA 4ED6A 2Z57B 1BI3A 3PGGA 5KYUB 4C8QC 1SV5A 2EG2A 2AJ4A 1E6HA 2CG8A 2X4XA 2XCAA 4LIWA 4C8QE 2A10A 3BH7B 1QAJA 3PYEA 3IBCB 3LALA 4LF5J 1Y00A 3CJQA 1FMVA 1EETA 4O3RA 1H92A 3MMBA 2QYZA 5K8NA 4C4WA 4DX6A 2R3VA 3BFMA 2Y0BB 5AJ3J 4HTJA 1CQMA 1VQNQ 1OX9A 2N4CA 4RUHA 4DQQA 1VQ9T 4IRCA 1NLPC 2HIQA 4M78B 1KTVA 1CJUA 1MV3A 4WU3A 3E01B 1DHMA 2A37A 3CCUQ 2YUQA 3IN5A 4K4YA 2BE2B 2BV3A 4DMZA 2EFPA 3IR6B 5HVFA 3HHDA 3OMCA 1EP4A 4H4MA 1OY8A 1BXNA 3H90A 2E9RX 2IJRA 2XG8D 4JUVA 3AH6A 4OB0B 2AEFA 2GIQA 3MEWA 3CJ2A 3CD0A 4ECTA 3M55A 3J81E 3PO5A 1PSFA 1GXIE 1RWXB 5HQMA 2WBRA 1TKZB 3AOCA 5LJ5h 1VQMA 4ZJQA 3LGHA 2Z0GA 2J6TA 4RW7A 3M59A 5HP1B 2I2LA 3QSUA 3IQLA 1U25A 3KXDA 2QAZA 5M2PA 1JKHB 3TOQA 2DJQA 4KO0B 3JCMg 1Q86U 5KFNA 1FXLA 2LEAA 2J6UA 3RAXA 4IR1A 1HHSA 3NBPA 1XNRF 5B0AA 3MFIA 2ZZMA 5D6XA 2EPIA 1LWFA 2H4YB 3CCSS 5ETRA 4Q2LA 3AFGA 4WU2A 4CO5A 4B9UA 3FSXA 4I6WA 5F0UA 3QG1A 1C0TA 4XQ3A 2VKNA 2H3EB 4H4KA 3VAHA 3QAUA 4DCOB 3CCES 3OYLA 5JUMA 2E5KA 2MGZA 2DGTA 5HMWA 2M9KA 4LFBJ 1NK8A 4DL4A 4C92F 3H59A 2YX7A 2XU8A 3IWLA 1TL3B 2CDQA 4M63A 3MTJA 1M90C 5IWAF 4TXSA 3QBYA 1NK7A 3VAIA 1TELA 1XNRJ 3ZEHA 2X4JA 1S1VB 3M0UA 2B86A 3TEHB 2R7XA 3UA6A 4XAXB 5CYJA 4P72A 4LF1A 4GKJJ 3EYZA 3LGNA 5LSOA 2ALYB 5M9OA 2CRLA 2B9YA 4DOWA 1RSCA 1FA0A 1UE9A 2XB2D 2YNFA 1I5LA 5F9NA 3A8EA 2GGPB 4DV3F 2ZH4A 1PCAA 1X6BA 1U0SA 3A1PA 2VPYB 1CJTB 1DLOB 5CVIA 3MM7A 5L9XA 3FFIB 2YT6A 1M3AA 2V34A 5DDPC 1IHWA 1PG5B 1UW4A 7FDRA 5LJ3d 1A7GE 3W9IA 3PM9A 2K5FA 2L8DA 1VQ5S 4HT7A 5ETSA 4ZPCA 4JS5A 1KJWA 3MWBA 4N4IA 1ZSGA 2MQ8A 2IJNA 5KG2A 1NJIU 1KLMB 3F41A 3M4XA 5KFDA 2DM1A 4X66J 3MMAA 1M1KR 4KH1B 3AA8A 5A0GA 4R55A 4EYIB 4N7TA 3NL0A 2FB7A 2DGQA 2WOMA 5KH6A 2Z56B 1FK9B 2FZCB 2FLNA 3L2WA 5HMXA 1RI7A 2V8PA 2C2KB 4K2XA 2J0QD 2ZH5A 5H9EJ 2QV6A 1QY7A 4NLOA 2G9OA 4YDXA 3M8WA 1RKJA 2UXBF 1VA7A 2CPHA 3W3SA 2CKKA 4B9LA 4M75C 4LF9F 4WFBQ 2C2RA 1EQ0A 3LGLA 3A12A 2ZH1A 2DPIA 2MI6A 3EGDB 3A8OB 4M75E 4URGA 2BA9A 5KG0A 2ROEA 4C0HA 3GCWP 3D6HB 4YP3A 3K8WA 1HWJA 2ZPEB 3P96A 3HSGA 3VS7A 3R6GB 3IAS9 2KMTA 1IJEB 3MDFA 4I0WA 3PG9A 1YFNA 2DR5A 2C3PA 3MTKA 3RUBL 4Z8AA 3RMSA 4DBRA 1MN9A 3M0PA 3NGSA 3EG1A 1R0AB 3MEKA 2L9WA 3E2UA 1RT4B 2EFNA 3QYGB 4JI7J 2GAGC 3M0SA 3J80E 1RT1B 1L3UA 3I35A 1TG0A 1UEKA 3RW7A 3ZC4A 2U1AA 2XQCA 1ZUYA 1QD1A 4TQRA 4EZ6A 5F9LA 4X62F 1UFWA 3HSZA 3DOLB 4BWJA 4U6PA 2CP3A 5CO7A 3PACA 2WONB 4K4ZA 3JCMb 2DNRA 1IGQA 2NLUA 1M0SA 4ERDA 2VG6A 1FTCA 2HHUA 2W7AA 4M78C 1VHIA 1RWPB 3QLHB 2Y1RI 2DO4A 1EQMA 3CD6T 3ISZA 2NLWA 2ED1A 2ZZDA 3I5AA 3SIPB 4M78E 2RNAA 3MEGA 4URQU 1XR5A 3CQTA 1D0ZA 1BI1A 5GANg 3OR2B 2B0GA 3C15B 3OYCA 4ZVRB 2IG0A 2KR3A 3AJDA 3GLXA 3CCRS 4FPRA 1OY6A 1ZUKA 4RTUA 1IB8A 4FN5A 1S0VA 4C9DA 1T95A 4CCHA 2ILZA 5B7WA 2BANB 2UUAF 2MAMA 3FNNA 1QWFA 4J37A 5GAN7 3VZIA 4ZPBA 1RLPC 4U67Q 4F16A 1L3SA 2YXLA 2ROTA 1NG2A 3AHPA 3GNFB 4KKOB 2HYIB 4EMKB 1FDAA 3D4JA 2EIFA 5ITHA 3NMRA 3NFCA 3NGPA 1NK6A 3HZGA 4DR3J 4OMMA 1FRHA 3MMCB 2F2WA 1WHYA 1NAQA 4GC6A 2VDIA 4XTWA 2R57A 4ATNA 4YUDA 1O9SA 2CVIA 5GMKj 2H3JA 3P6YC 3OYFA 4WIQA 5D4LA 2AF6A 5F3ZA 4LBIA 2W7OA 1QUVA 1T9UA 1K76A 4B02A 1U1LA 2EK6A 1K44A 2XSJA 4UOCA 4P5NA 5GAN3 1TVRB 1VLYA 4V19J 3M4GA 4J8OA 1MW7A 2NZ4A 5CCLA 2YWHA 2DNUA 1UHCA 2XMFA 2E70A 4XTUA 3P8BB 1ZSZB 4CLKA 4M77A 3B6BA 1UPMB 2YQ3A 3CJTA 4DL3A 2OI3A 1B07A 1H2UX 4OMQA 2HLTA 2E5IA 2EFOA 1Q7YC 4EGLA 2M0GB 3PY8A 4PFPA 3OYBA 1XMOF 4KGVB 3LWHA 5KFIA 2D74B 2JLFA 2FUG9 2BABA 1C1BB 2JSXA 1S76D 1Q81T 1M30A 2M02A 4NEYA 2XYHB 4C0ZA 1YJ9T 3CC4Q 2F69A 2A08A 3O3LA 4I1TA 5EGYA 4IOCQ 1HBUB 2N82B 5A0DA 2DXUA 4JV0A 1RQ0A 1SPBP 5LL6S 4W4MA 3NHNA 1YRTA 5CCMA 5HBMA 2HGMA 1V5VA 1FD8A 4L59A 3GJTB 2RQRA 3TJ8A 2ENMA 3VALA 1G4CA 4PLIA 1R8OB 1GX6A 2DNLA 3OTOJ 3IP0A 3TNVA 2QL7B 2GQIA 1K73R 4B08A 2HKQB 3ZBDA 3G6ET 1RYSA 1TL1B 2FRYA 4XAKA 1JLQB 2FD2A 2F4FA 5ETPA 4MKVA 3L42A 1HWLA 2WB4A 3JSCA 5E41A 2YH1A 2L89A 4TKTA 4NZ7A 1UGRB 1N36F 3TAMB 3ETOA 1Q81C 3R27A 1FKPB 4NLQA 5GANf 1XMBA 4KH0B 1RUSA 5HQ8A 3AD7C 3BQ2A 2ASJA 3OYNA 4N4HA 3LP0A 2FTRA 3POTA 3M8RA 1AZEA 4C5HA 3RERA 4USKA 2IM2A 4N76A 2YRCA 3HKSA 4J9OA 1SL2A 1JLEB 4OJ1A 3KLEB 2GVDA 2GMJA 2RQWA 3SBMA 3KHHA 4MIWA 3AOBA 4C11A 2MKSA 3M53A 3C6UB 2H51B 4XTYA 1B7YB 1VC6A 4EEYA 3CCEA 4JDSA 2VICA 9ATCB 4LBPA 3VYHB 1RBLA 1J3TA 1N36J 3BKUA 1RT5A 1XNIA 4CLFA 2YKOA 2MQQA 2CQCA 2DX1A 3DOMB 2ZAEA 1CG2A 3W60A 1CULA 3W7BA 3CCTA 1T0HA 4Y65A 3N9UC 3RDVA 2BZXA 4BS2A 4DX8H 3PJWA 4BI4A 1WG1A 4DSKA 2DY1A 4DV2J 2DR8A 4JI8F 3WQPA 1P1TA 4ZGEB 4ECUA 3KG1A 1S0OA 2COYA 1NSQA 1M5PC 2FVRA 3M8ZA 3BYPA 3RRGA 2CFXA 2NREA 2QFJA 2WSEC 1QVFS 5BR8J 2GCXA 3X3UA 1Y7XA 2RQCA 1K9MT 1NEGA 3UT1A 4YQWA 2C28A 1SJQA 2OHDA 3PHEA 2FHDA 1VQPQ 4ZN1A 2DGUA 2WSEE 2MY7A 3ENWA 1VQKA 4M7AG 3U27A 3ULHA 4BUGA 1WPYA 3ONQA 2OTLS 4NLSA 5KFQA 2OPRA 2Y1JA 4B3RF 4I69A 1AWOA 4M5HA 1HHQA 2DL8A 1VQ5A 1XQIA 4F4AA 2QO3A 4NCGB 4DV6J 4FYWB 2L08A 1TUVA 3NGDA 4A0TA 2CSQA 2POKA 3B54A 1YBYA 1GMVA 1K0VA 3SB2A 2V4JB 2KG0A 4NLYA 2AHJB 2KM8B 2HQFA 2XNQA 3H5YA 2EJFA 1Q82R 2L9DA 4VUBA 3EX7B 3W64A 1D0YA 1K9MC 1GFWB 3VKIA 3G4SS 4NMLA 1QVGR 4AFUC 1OWXA 3M8PA 2PC6A 2CKWA 3PVXA 5GAN5 3JTOA 3H2LA 2JMAA 4B3RJ 2C2NA 5DG9A 1FJ7A 1E7OA 2JRSA 4WXOA 1R8PA 3TUZC 5GAOm 1Q8LA 3MZIA 1HI0P 2XG8A 1ACMB 4RW6A 1CJVB 3LLRA 4KSEB 1IJFB 1NJWA 1IKYB 4P2XA 2RMOA 2EYXA 1B64A 4QIGA 3PVQA 4WWSA 5A0LA 3AD8C 2GJFA 1OULA 5CAAA 1DAXA 2FB0A 3OL9A 4U7UK 1D9AA 4PXBA 1JMTA 2E1CA 4OI3A 2ZC3A 5D78A 1JB0C 1VQYA 4YFUA 4A8FA 3AODA 1ZSZC 3RR6A 3TJ9A 1SBRA 3KK3B 1RT3B 4E8UA 3HVWA 2JM8A 1JB0E 3UATA 2HNZB 4N0AC 2HFZA 3TI0A 1M1GA 3M2VB 4C8OA 4D3HA 1FHTA 2QC3A 2W2NP 2IBOA 4IFYA 3R2DJ 1WEXA 1B34B 2HQDA 3FJPA 5LMUJ 4DPYA 2OPSB 4DJBA 2DKGA 2BBEA 4DN0A 4OHWA 3CCUS 1I3OB 1G2EA 4NL3A 3VJPA 4EIKA 1GQEA 1OSCA 2QMXA 3JSMB 3FK4A 5DZ7A 2LVMA 1TFWA 1JWWA 3DOKA 2K7AA 3W1YC 2WTFA 4AL7A 2XS2A 3VZHA 3W2WA 2XZDB 2HPUA 3Q23A 3BQ1A 3KXTA 1S6PA 3MAQA 2LTOA 3N6NA 5KYYA 4FBTA 3ER0A 1I4K1 5AYFA 4BWMA 1K0XA 2C2EA 4C5IA 3D2WA 4OIXA 2HHVA 3CCRA 5DG7A 2D9OA 1NJXA 4F7UG 1S6OA 2FHKA 1I5OB 4C3LA 3C16A 5J3BA 4OV1A 2E66A 5IT0A 3RESA 3J7Z5 2K3KA 1NJZA 5LSRA 4RTTA 1CSJA 2E7WA 4E98A 4NLDA 4X9CA 2XYPB 2P0KA 3A1YG 4PUOB 3NAHA 1IR1A 1VYTA 5DZ6A 4LIRA 2MQNA 3ZFJA 1U49A 3TEGA 3IBWA 2C0TA 4NLRA 1C0UA 4PWDA 2IVYA 3UD4P 3DXSX 4USVA 6AT1B 2HHHF 1GEHA 2E5JA 2DIVA 2EJ9A 1NSKL 2X4YA 4C8QG 4XK8C 1Q79A 3H4BA 1RTZA 3KUHA 1I1JA 3ZL7C 1P92A 1S0NA 5J26A 2QK0A 3FMBA 1VQOA 2UXCJ 4XK8E 1X5PA 2VPWB 2YKMB 2E3IA 3CBMA 5KFPA 2GS8A 3GP8A 2LCSA 4R25A 2RQVA 2YLBA 1PAEX 4X4OA 4P52A 3KMQA 4IFVA 4K11A 4QYZJ 4IR9A 4OL8A 3LWIA 3PR4A 3CC2A 3SSRA 2H5JB 2DR7A 4ETXA 2E5LF 1RAEB 5DY9A 1APSA 1VC0A 2FO0A 3BN7A 1H3HA 2UUCF 4ZVQB 5EN1A 2OD6A 2HHHJ 3TEEA 1G3YA 2LQWA 2ACYA 4CO3A 1U02A 3OL7A 2DETA 3W62A 2AQ4A 4CLSA 2WCXA 4IG0A 5D77A 3THTA 4USWA 1EZZB 1R43A 3THKA 2HEQA 5EWGA 4N8OA 1KQSP 2VFUA 1FRKA 1CS4A 3PR5B 4OZLA 2K7JA 2YNGA 1SCJB 4ILMA 5D4NA 1AW0A 2AD9A 2DL7A 5CZXA 3TVZA 2DIGA 1RACB 3LO3A 5B08A 4WYWA 5J2NA 2PU9B 2EC0A 5A8RA 2QLFB 2RI3A 4K4XA 1M5KC 4JS4A 1PYTA 2UUCJ 4R5PA 4M7DG 3CD7A 2R9LA 3P8HA 2I5JA 1RHQB 5KFLA 1T9VA 2W7PA 2J9DA 5A8WB 1UAWA 1DRZA 3SWNB 3A8GB 3T9NA 2UUBJ 3UE2A 4QQBA 2KM8C 2EXUA 3MFHA 2Y8YA 5CD4H 1YRXA 5HK3A 1BK2A 1PD0A 3SDZA 4D6WA 3EVWA 3D1HA 1DTQB 4M7AD 4QIVA 1N5VA 5D4PA 1QAYA 1U2FA 2IRUA 5L9NA 2KDOA 2WSCC 2MQLA 3EGZA 1S0MA 2ZPBB 2C1EB 4J9QA 4C8ZA 4NLWA 2YLCA 2VB6A 2DXEA 2H54B 2UXDF 3L3CA 1T94A 2WSCE 4USMA 3FSYA 2DNPA 4QKUA 3LH0A 1FNMA 3RU0A 1HYSA 1PKTA 1SSHA 2RU3A 2QTWA 3ILIA 4ICLA 4ECWA 4RW8A 1HNIA 3NCPA 1FJEB 3EAEA 2W4DA 4J7CA 2RM4A 4CC2A 2QGFB 3QYYA 4NYZA 4RWWA 3ITHB 4K5SA 3MMJA 1SQGA 3MD1A 3DU6A 3RB6A 1U6FA 4LFAF 5GAMd 2KYZA 3KLFB 1YIJA 1L3KA 4O6JA 2JLGA 4A48A 2KE9A 1PAUB 1M1KU 2GMHA 3ZTOA 1YGYA 1S4EA 3CCST 2AX1A 2HDAA 2LQ8A 3SI8A 1TUCA 4KPCA 4B3OA 1QP3A 2DERA 3NS6A 4PQUA 1LNXA 2K2MA 1FI4A 4DF8A 1HNWF 2RHXA 2JEGA 2P4RA 2RKIB 2UU9J 2W2MP 5HLFA 1WI6A 5KG5A 3OL6A 2GIRA 3BDLA 2HQHA 1AWJA 2P2CB 1VUBA 1WKLA 4RWXA 3UO0A 1FRLA 2MHEA 4TY8B 3HVTA 3HFVA 4DDFA 2XULA 2KXCA 4KY3A 2OPQA 3OW2R 2GFAA 3OTEA 1VCTA 2OTLA 2YQ1A 4OB3B 2EI5A 2FVCA 3CPWR 4A8SA 2DVJA 4PJOG 1OX8A 3PIOQ 1TZ0A 1F5AA 4MMKA 4DCJB 2C0OA 3FC3A 3QT8A 3HPOA 1CLFA 2VASA 1KR4A 2FYXA 1IWGA 1N8RT 4PRFA 5IT9Y 4F14A 1KD1C 1BCMA 2DT9A 3QIDA 2AKWB 1N54B 1PC5A 2CPFA 4M4ZA 1FWZA 1WOOA 2PI5A 3QBCA 4M5MA 4DEXA 3KLGA 1NBEB 4K4VA 4TN2A 3OYAA 2M7SA 3G7ZA 4DV0F 3T5HA 4HVZA 4JJCA 1Q95G 3W8PA 3G4SA 2AYMA 1D8YA 4DWIA 1H2TZ 1M4ZA 4DV4J 3RB0A 3EGXA 1RK8A 1T7PA 4BB7A 5IS2A 4Q0BA 3SMZA 4X4SA 1NDKA 1NH7A 5KFVA 2PFDA 1G3WA 4M5IA 2KRNA 4DBHA 3JCMd 1ZM3A 2CPXA 1X43A 2F1FA 1MGQA 4OGEA 1U45A 2ZH9A 2MSTA 1H2VZ 2WACA 2YNHA 4EWTA 1TKXA 3EPGA 2FDNA 5CYMB 5AXLA 3OFEA 3OW2P 3I55S 3D1OA 2CH4W 5HROA 4J9HA 3JB9F 4NLGA 2VWFA 1OYXA 3VUBA 2J05A 1AD5A 1R0BG 4JBCA 3VGSA 3AY0A 4KTQA 3L09A 3HDSA 4ZCMA 2RI2A 1S72T 4QVDA 2CJAA 3X25B 2Y1LB 3UCGA 1NK0A 2DH7A 1ZQ1A 2ZEJA 4C8QD 2KXFA 3MOZA 1OZ3A 2C3UA 1SV5B 1RUWA 1MLAA 3ZZPA 2CZ7B 4CWBA 1YJ9Q 3CJ0A 1VQNA 2DH9A 1PKSA 2MLZA 2HD0A 4DSFA 4OZ0A 3DHXA 4X9DA 4XO0A 2YUPA 2XTJP 4MYUA 2QGGA 4HI1A 3T41A 3CCUA 4IO9Q 4GO7X 1EETB 3GNGA 5DETA 3I32A 3FBEA 3MMBB 4JRKA 2X51A 2DGSA 3MR7A 4Y34A 2MOXA 2OEMA 2QLJB 3IM8A 2R8JA 4WZMA 2VZ9A 4P2FA 3ASKA 4AT1B 3MD3A 3SV4A 2CADA 3G6EQ 3BN4A 4NXNJ 1U2CA 2DK2A 4U7CA 3FEYB 3AT1B 4WTOB 3AJ2A 5CKDA 1OQ3A 2RNEA 2DYBA 3OLBA 4AFSC 2EFIA 4H4MB 4NPOA 4Z02A 3DRPA 3I87A 2R7QA 2BKPA 4K4TA 5KT4A 3SWNC 1X9MA 4FW2A 2F5GA 1ZETA 2YPYA 5FWCA 2FVUA 4RW7B 3DLEB 3GTYX 1XMQJ 4MIAA 2V9KA 4KIAA 1G6BA 1ZAXA 2F63A 3CJ3A 2R5AA 1Q81R 4I6AA 2ZHOA 1U2RA 1PIEA 3NXZA 1HW9A 2L3MA 2Y9HA 3TZWA 1AUSL 3CCJQ 2COLA 2QQ9A 2R7TA 1R7IA 3H98A 4M7DD 3NBPB 1KQKA 5CIUA 2DITA 3GR1A 3VS1A 3WZ0A 1WGSA 1YJWT 2B9EA 4FW1A 2LCLA 2Y3YA 4DUTA 1LWFB 1M8MA 4XTXA 2L48A 1R6YA 4M5DA 2QDLA 4ZCKA 3ENAA 1U5SA 4ECQA 4LRCA 2AU0A 3BGRB 3J81Y 4DV7F 4FIBA 1K73U 2J6OA 3FCVA 2EQJA 1NSPA 1JXMA 4ZLLA 4Z88A 2DGVA 3CVKA 3E3XA 2RIJA 2CREA 3E1SA 2WVCA 3Q8RB 2MZJA 4X65F 1QVGS 4C0GA 5GAMj 3Q8UA 2HRTA 4F25A 1IBMF 1KNZA 1GBRA 4DG1A 3T6BA 4ID5A 1N56A 3UA7A 1MMLA 3JV3A 4I68A 1VRTB 2JTFA 4M8LA 3KMSA 2C06A 3ZO7A 4USHA 4HT9A 3RR7A 1M5HA 3B4MA 2KXNB 1HBNB 4XU2A 6FD1A 2K3IA 2WB1D 5D8HB 5F8IA 2V8JA 3PTAA 3TQEA 2C3OA 1NDPA 3OR1B 2YNFB 2B56A 1QM9A 2PIIA 4DUYF 3DGPA 1TAQA 2IPOB 1EARA 3HT3A 5LOQA 2CP7A 5KFBA 2H8HA 1DTTA 1H3DA 3B8HA 1I94J 3H20A 1N4LA 1T9XA 4QYRA 1NNDA 1PD1A 3VRZA 3CMAT 2P0PA 1KLNA 1MHNA 5FU7B 2F4VF 3BBBA 3D0IE 3I82A 3ULRB 2X1GA 2NUTB 3BSAA 3G6XA 4X4TA 1N34F 4JI5J 3I0RA 4K4UA 4E7HA 2QQAA 1QW1A 4XDDA 1N32F 3DLGA 1NEBA 2RF2A 5DGAA 2ZC4A 2N3LA 1T9WA 3MMAB 1IO6A 2F7VA 3T1HJ 3TUJC 3DRSB 3CPFA 3HHKA 4PJOD 4R0JA 4FSSA 2XMMA 2WOMB 3RAMA 4DUYJ 3AQPA 3JSBA 2ZHAA 3EXCX 4JI2J 1K9MR 3AQOA 2CQGA 4M78F 4OMOA 1N88A 3VAKA 2OSRA 2NXCA 3CCQS 1IQZA 1S7HA 2W4PA 1X2KA 1IM4A 3NMZC 3VR1A 2VA3A 1UWAA 2BEFA 3NTKA 3Q83A 2P9CA 3GP9A 4JI1F 3TP2A 1NPRA 2OTJT 2CVEA 1N32J 1KFDA 2FHOB 1VDHA 1K4US 3Q0AA 1KK7A 2M8DB 1VRUA 4RNFA 5CK9A 3PFOA 3EH2A 2FJBB 3G2XA 2M88A 4RNHA 1JXLA 1H7WA 2QTVA 3CJKA 2DGXA 1VQ9S 3C6TA 4O3QA 2G6FX 3R6NA 2PTKA 1SJRA 2YKAA 1K0TA 4Y28C 1JLFA 4Y2CA 1WJSA 1UFLA 1Q82U 2VD3A 1JO8A 5HMZA 4Y28E 2ZPGB 5GANe 2HFOA 3GIIA 2HAXA 3KWMA 3TARA 3H2VE 1JLBA 4R0EA 1OMSA 2NXUA 4NI2A 4JI1J 2KT1A 5GAOp 1VQSA 4KJIA 1BCOA 1JLGB 4F3MA 3G8TA 3M6XA 3NNAA 2KXHA 3PO4A 1RWUA 1IKWA 1BQMB 3PTWA 2JHEA 5KFYA 5LJ3g 3MECB 1OIAA 6FDRA 1C1AA 1IGUA 1VOMA 2HMIA 4DV5F 2DVEA 1UETA 1VBYA 3QWYA 1H8KA 3MEGB 3SDEB 4QQDA 4I2PB 4GMKA 3OTCA 2N7YA 5FRMA 2CUBA 2WVDA 4KE5A 4RX6A 1UB4A 1M5Q1 2XDBA 2AYBA 3RIRA 3HXMA 3VGVA 4U9RA 3G9CA 3DI6B 3GG1A 2UVWA 2QTXA 4ZS6A 4EMHA 4JLIA 3J80Y 2Z4PA 2O31A 2CP0A 2G4BA 2AP6A 1RWOB 2L2PA 5G4DA 4A4GA 1WHLA 4HDGA 2V4QA 1AT1B 5T7LA 2RHYA 1FXXA 4KULA 1DJ7B 2JC0A 2HL3A 2M0OA 4EDUA 5E3QA 5JMNA 4OX9J 3MAHA 3OUYB 3TA1A 2DL3A 3M1VA 2C22A 2M70A 4EK2A 2XI9A 2JTEA 3K5MA 3DB4A 2LX9A 1ICEB 3KK2B 2ZPHB 2KSSA 1RU1A 2RQ4A 3E2EA 2DILA 1PRMC 3URGA 3I55A 1NDCA 3V2UC 1X4CA 4FF4A 1RT7A 1X4BA 3J81U 4J9MA 4WIIA 3MAAA 4M7AA 3RMQA 2DCUB 3D6FB 2KYBA 3HP9A 1QQJA 4HT8A 4A0UA 1FRXA 4PZVA 4FDFA 3G8SA 2DY9A 2HNYA 1QSLA 3CCZA 1NMEB 5IHNA 4KQZA 1PYSB 1QCOA 1YJRA 1B7FA 4JLGA 3CC4A 4EMDA 5GMKl 1SH3A 4J83A 1EIFA 2V8HA 5L38A 2M5YA 2CPIA 2FJXA 4E0DA 1UW9A 2KROA 1RAFB 2HZYA 4PKCC 4C0FA 3QAEA 3JCMP 3OS2A 4RLEA 4Z2XA 5DDOC 2MLXA 1D3BB 4G1IA 1EIYB 2ZBPA 3UNYA 1CEZA 4JV1A 2PI4A 1WNLA 8AT1B 4ZP8A 2F40A 3MR2A 2DF6A 2DB1A 4LE9A 1G3SA 1LW2A 1B99A 3W63A 1F6TA 1X4GA 3TRGA 2KG1A 2B8QA 2YX1A 4X1VA 2R2UA 4J9GA 3QJPA 3GMGA 2YQ2A 2GTOA 1YJNT 2DD5A 3UCUP 2QMUB 2HVDA 5FU7C 3UF4A 1M2OA 4HT5A 1GCPA 1UZHA 3M58A 1FT8A 2PE8A 1HQUA 3M7VA 5DLGA 2FJDB 1ZAWA 3CDWA 2C2DA 4UZCA 2OD4A 2ZZNA 1YZ6A 3NG8A 2DH8A 1GCQA 2QA2A 2DIUA 2Z2YB 1H98A 1FXDA 2COZA 3BE3A 1YX2A 1M90U 4DR4J 5LJ3f 5EWEA 3C8YA 2DRBA 4O4RA 3EZOA 3MEAA 2YNIA 3P49B 2VG7A 4ZJLA 1U09A 3KHGA 1BY9A 1FDNA 4E7IA 4DPTA 4YR3A 1NSAA 3CPWS 3OVAA 1KN6A 1TTHB 1B4SA 2IJFA 3R8YA 4USTA 3K5NA 2AZ1A 4OI2A 1Y11A 4ZVTB 5CYQA 1WFWA 2GVDB 1FO1A 2YDLA 2O67A 1W2BR 2K6DA 2XLJA 1GNKA 3C46A 4C11B 1WHWA 1GTHA 3OBWA 1JRIA 2PDAA 3WC0A 4K4SA 1Z2ZA 2FLOA 3CCSQ 2KQWA 4MDWA 3HMJG 3TZYA 4OHYA 1IKXA 4X4VA 1RT5B 1RTHA 1QVGA 4ZP9A 2VKRA 2XDPA 3SYZA 4BLGA 1D1BA 1CULB 3CCEQ 3FQLA 1OS5A 2LMJA 3UWTA 2PNIA 4DU8A 1N0VC 1SH0A 2DRAA 3I9V9 4QZVB 1G7CB 4F7UA 1QE1B 4LFCF 3CD6S 2JTMA 3L2VA 2ZKUA 2X3XD 2PGCA 5BJRA 4PFZA 4C0DB 1UVKA 2C2ZB 1RTJB 3LOUA 3H42A 4QT7A 2GO8A 2NXJA 4FS2A 2F5TX 3KYLA 2ZH7A 2FPHX 1VQPA 5GAHU 4L5GA 1AHJB 1CJKB 1WEZA 3ETMA 3HJVA 4DR1J 2XNRA 2RRAA 2XZTB 3MPYA 3RBBB 1B3QA 1VK3A 4UQTA 4QCLA 2LCCA 2QXFA 1YHQT 1ZBXA 4FYXB 1TV6A 1Y3JA 2BR0A 3PCOB 4GLMA 4IUPA 3JTPA 3KKFA 2IDEA 5F8HA 2JC1A 1ULRA 4C8QA 3T19A 1AOJA 3OS1A 4LF4J 5KYWA 1AZGB 2MMYA 4C6AA 5T14A 2NSCA 1GAOA 3OD2A 3V4MA 1YITT 4KT0C 5D3GB 1X6OA 2VC8A 2GHPA 1WF2A 4J9IA 3TQ7P 1PKUA 1S79A 4KT0E 4DI6A 3PNIA 3B78A 2ZHBA 5I42A 1GMUA 2FHJD 5CXTA 4M1KA 2C0IA 1XWLA 2F65A 2H5IB 3JCMX 1F9EB 2FY8A 3BDEA 2FGCA 1EKSA 2V26A 5IHIA 4WP8A 2GVZA 2KHDA 2QA1A 2Z2MA 2H65B 1I8FA 4J9DA 3FZBA 2AEJA 1NHUA 3CSKA 4IRKA 2XWYA 3M8PB 8RUCA 1NRKA 1X01A 3M05A 1KBRA 1T11A 1YTYA 2K4YA 3NWGA 2FRWA 2YXYA 4K0KJ 4M94A 2P6SA 2M8HA 4RW6B 3TCJA 3BO2A 4B3SF 3EGUA 1S72Q 4DBFA 3AXKA 2V1RA 3R5BA 2RHSB 4KR0B 3HSBA 3N5BA 1N8RR 2DJWA 2KYXA 3EH1A 2I38A 3JCMV 3GIMA 5B0BA 2OEJA 3K58A 2LLZA 1S10A 4ZPWR 3HM9A 1VQ9A 4CM0A 3FQKA 5LXYA 2K06A 3DRRA 2CXEA 1BGXT 1M1HA 1AEYA 4AYBD 3MPUB 1ABOA 4M7DA 3KTQA 2B6AA 3G71T 4ITSA 3GG0A 3I31A 2M16A 1RT6B 5C42A 3K17A 2R2TA 2P8IA 2E9ZA 4M77E 2PA3A 2L3RA 1NM2A 2G0IA 3JB9H 2AYEA 1T02A 2PVGB 1O5JA 2XMTA 3BM7A 1UVMA 1Z9ZA 3I0SA 5D6WA 1I51B 2G1DA 3DRYA 3ZTPA 3FIFA 5CQXA 2CZ6B 3G6ES 2HFSA 3SV3A 3H6ZA 2VQEF 2KFZA 2YY3A 1RYRA 3RKWA 1Q8BA 3UVJA 3X26B 1UEUA 1E6VA 3HHLD 3OXLA 3W2WB 2GNKA 1W4SA 1NJIC 4DR7F 2I6WA 2RB6A 1HI8A 1S6PB 3B82A 1R8CA 2H4WB 1U48A 5KYYB 3S7RA 1VQ6T 3NTIA 2QQRA 1EHWA 3OSSC 4HHUA 3U02A 2Y8WA 2X35A 2HW3A 5LJ5g 3UWNA 3GR0A 4ELTA 3L9ZA 1BQNB 3C16B 4JYAJ 2ROGA 5DJBA 1KP6A 3BKFA 3K0JA 4KRWA 4D3GA 1CSKA 1SJFA 3AB2B 1N5YA 3HRUA 1YG0A 1QDUB 1S49A 2RMLA 2BRKA 3M8QA 2XY7A 1KG1A 1Q7YU 3H5SA 1YJWQ 3PYDA 4YN3B 1XR6A 2KRBA 2VC0A 2KPPA 5JVHQ 5J2QB 1WACA 1VQ8S 2AKKA 2ZUGA 2ZE2A 4OGCA 1FEEA 4C5GA 1KTQA 4HH0A 3T1YF 3Q8PB 4PWDB 1N33J 2XY5A 2ALZA 1BI2A 2DCLA 3F56A 4O5VA 1C1CA 2KJWA 4E6RA 2A2DA 4DX5A 2VQFF 2IA0A 3S6WA 2LDYA 3R97A 4C8KA 4OZJA 1FERA 3QRQA 2UP1A 3P5BP 1EAYC 1XJWB 2FLLA 5J2PA 3T9ZA 1JNZB 2OUGA 4GKKJ 2V2VA 1U8WA 1OQ6A 2E5HA 3BGOP 4X4UA 4M5JA 7AT1B 5LJ3Y 3LPEA 3EG2A 5DLFA 5KYXA 3KLVA 4BDPA 1GT8A 3UW1A 3EVMA 1SC4B 3VQSA 4IFVB 1Y5IB 4E7LA 1SKSA 5KFRA 1ZHIA 2L3PA 5GMKa 3UN2A 4GVBB 3REBB 3K89A 5C25B 1FESA 2Z2ZA 4C0DC 1T0TV 3BGUA 3T1YJ 1Q81U 4CIOA 2DNYA 2E12A 5AXKA 5D0GA 4M95A 1D1CA 1AROP 2LA6A 2YKNB 2VQFJ 4M75A 3FRNA 1H72C 3JTNA 2KYMA 1A6LA 4A63B 1D0XA 2LQ9A 1WC3A 4IG0B 2WSFC 3FUYA 3SCKE 2AZSA 3ISNC 1VK8A 2O01C 1UJ4A 3M2RA 4IKAA 4QU6A 1CS4B 3CMAQ 3V6HA 3ILJA 1SC6A 4OFZA 2WSFE 1X5TA 2YWKA 4RU9A 2W1BA 3NOCA 2CT3A 4OMPA 5HMYA 3EG9B 1HR0J 5I3PA 5KYUA 1SRLA 2Q66A 2SXLA 2EYZA 3P5TL 1K9AA 2L3SA 5J2NB 1AXQA 1Y0HA 5A8RB 2CZVC 5J2MA 3SQGB 3JCMc 3T1AA 2ZJPQ 1RA7A 1HNXF 2DXBA 4R5PB 4JI0F 3TR5A 1C2PA 2UV8A 3HSJA 3OTDA 4RCBA 3FEZA 2DVIA 3QDFA 3OW2A 2NUZA 3E01A 2CPJA 2LFVA 1BD6A 4ZNXA 1QAXA 4LUDA 3CPWA 2RD5C 4N4GA 3PMTA 1HLWA 2BJ1A 2LZ6B 1SSFA 5KFTA 4XPCA 4ANJA 3PX0A 1UMJA 5IN1A 2LJ1A 3GV7B 1SI9A 4KGMA 1XK8A 3Q89A 2WBMA 3VVUA 2MIOA 5B0EA 2F2VA 1J5EF 2XHWA 2OTJQ 4BI8B 4FL6A 4LRBA 1RZMA 1NUEA 4Z7YA 3CCMS 3D3BJ 2KNBB 3MUVP 2YKPA 2H48B 1TKZA 4LDYA 2PVDB 5B0DA 1YBUA 4FP9A 2CZ1B 4ICLB 3MCMA 3UI3A 1WWHA 3KNAA 1TAUA 1N27A 1JKHA 2J6FA 4PJJA 3NGUA 2HWHA 4IOBA 3KDOA 3T5LA 2DYIA 3CEDA 2HQXA 4KO0A 4EYHB 3MR3A 2MF2A 2WZ1A 2JDJA 1HK9A 2RDDA 5E2QA 5I2SA 1UTIA 5K8OA 3EGWB 2R8HA 3EG0A 2ZBIA 1DZ5A 2DMOA 1QWEA 3D67A 2HQIA 1U1RA 4E7ZA 1HQEB 4JUZA 1AVZC 2HVEA 4UW2A 4AL5A 4DEZA 1RHUB 2K2VA 2ROLA 2EC2A 2HWIA 1K9MU 1UVJA 3UR3C 4RKUE 2HAFA 2AJQA 5HLFB 4JV2A 2HVHA 2B5JA 2R42A 3GFHA 3PIOA 4JV5F 3J7AF 1ROFA 4C92G 1U8SA 1D1UA 3GB0A 2Y90A 3GCXP 4TQSA 1ZA2B 2IBKA 2OPQB 3BSCA 1TL3A 1HBOB 4YR0A 2YKQA 2BKDN 1NYGA 4ZVUB 3BSOA 4MZMA 2ASLA 2WHOA 4PJOF 1S1VA 1TL7A 3QWUA 1X60A 2J0WA 1VQOT 3OL8A 3UFCX 2OLWA 2IM1A 5KCOA 3E19A 1Y3KA 4P74A 3M0RA 2GA7A 3CDUA 1BLUA 4YB6A 1OQKA 4A4HA 1ZPVA 1UWBA 1AYEA 1B0VA 3PKYA 3JSRA 3KLGB 3N01A 2GGPA 4JV5J 3CC2T 1YN8A 1T0JA 2MXYA 1TU0B 1CJTA 4ZIVA 1KC8T 2LU2A 3RZAA 2AGOA 2HRYA 5GAGU 4AE5A 3P8DA 2A18A 2IFXA 3N79A 2GHVC 1B7TA 3DDIA 4NRUA 5GVQA 1Y96A 3Q2SC 1BBZA 3V8JA 4DL0C 1RCOB 4WPAA 3MR5A 3PXGa 4FZVA 5KFWA 2YNHB 1KLMA 3ZFVA 2EFVA 2KDSA 1HJDA 1TKXB 5HCKA 5GAMg 4EO8A 3SHWA 4UTGA 4EBCA 1JJ2R 1RHKB 3V4IA 4N5SA 1QVFR 2VC1A 2YUNA 5HROB 1LVKA 1YJ9A 1BIBA 2LQJA 1FXRA 1VYUA 3CCQT 4CH7A 4X2BA 3KUGA 4RR5A 1KC8C 1S1UA 3VYGA 2HBZB 2AT1B 3QRPA 2J9CA 2B9WA 2BVZA 5FROA 4OVAA 2Q6CA 2JS2A 1W2BS 2GHWA 5GAOq 3DRXA 4OI4A 2VH7A 2HFUA 3EGDA 3IAM9 2IRXA 3J7A1 3G6EA 2VGNA 1VJQA 3BKTA 1YJNQ 3CXCS 4ZVSB 4WFZA 4WFYA 5DG8A 2ZJQQ 3PIPQ 3GYNA 4YEAA 1LQ9A 4I6YA 3MM6B 2EW9A 2G2YA 2GNCA 5I21A 2MQOA 4JRQA 4PXEA 2FQQB 1OSDA 3TA2A 1WHMA 2K1RA 1RTIA 1SQFA 2KRMA 2OAUA 2FPEA 1MROA 4J9CA 1RT1A 1YZ7A 4J6XA 4I64A 1QJHA 4FBUA 3QDRB 2YVSA 3DRPB 2Y4YA 2BM1A 2DFUA 4OJHA 3DOLA 3FBCA 2WONA 2LDIA 1RWVB 1SH2A 3BO4A 1KFZA 4ZLPA 3MXHP 1FKOB 2OFHX 4JI3F 2MZTA 3CCJA 4QU7A 4LR7A 2VGMA 2J9DE 3OTBA 1GBQA 2ZOGA 3D0HE 3W2VA 4HDHA 1O8BA 1MN7A 4ZHRB 2HKNA 1HD3A 1M90T 3FLGA 1BC6A 4IIMA 1VQ4T 2R2SA 4B9MA 1WKJA 4B9WA 3H8ZA 4CH0S 3ET6A 1TK5A 3C15A 4RCCA 5GJWB 4Q7AA 2DD8S 3PYGA 5F8GA 4OJGA 2R7WA 4ZKAA 4LNPA 3RR8A 1LWEA 4J9KA 1SIZA 4CNYA 4IG3B 4M5DB 2BANA 3LH2S 5L1IA 1NYFA 4Q2MA 2FHJA 1OYDA 1K47A 4JI3J 4HHJA 2UUWA 3SEOA 4ELYC 3HTRA 4KKOA 4EMKA 2ZVIA 3KJVB 1AUDA 2JJ4D 4KC5A 1U24A 1TQLA 4HXJA 2Q79A 3MMCA 3G8QA 1RT2B 3MHYA 1U1SA 3LAKA 3M6WA 3QGPA 4ID8A 2MQMA 3CC7T 5DO2A 3RB4A 3CJSA 1WZOA 4PKDB 3V7CA 2NUUG 1NU4A 3FJ2A 1AB8A 3OXFA 4G6VB 2VA2A 5GAMf 4P6QA 2LNVA 3V8LA 1T3SA 1NDLA 1PJ5A 2BDPA 1VFJA 1M1FA 4DR5F 2E7XA 4IUFA 5DM6Q 2QEXT 2QSFA 3R5DA 4RTWA 1YHQQ 3BS9A 2F5KA 2K5LA 3I56T 1HIYA 3S3NA 2HRUA 3GIJA 2ZBQA 5KE3A 3RNJA 2YHTA 1VRQC 4IQMA 2LNHB 3ZZ0A 4NX9A 2HVZA 3SFUA 1YITQ 3MEUA 2A36A 2QFIA 5GAN2 3DGPB 1HBMA 4I2QB 1FWPA 3ZXWA 2K7KA 1SJ4P 2AGPA 5GMKe 5A8KB 2F8MA 1HMVA 4O44B 4N0AA 5IWAJ 3D3CJ 1P9YA 2MDAA 1XEZA 4C97A 3EG3A 2IC3B 2XI2A 3UN3A 1VQLT 1OZ2A 3F70A 1C1BA 2AJ0A 1SUQA 1SRMA 4DR5J 4USUA 2EW3A 4C92D 3I5RA 3AD9C 1WD6A 1LWXA 3DLGB 2RF2B 4FXDA 1HBUA 3D7SB 3H2UB 4D8DA 3BB5A 2BE7D 2N7CA 1WOSA 1KVIA 3W5XA 1WC6A 3C14A 1PWTA 3US5A 4NCBA 3HHLA 5IHKA 2RI5A 4JZ3A 1OEBA 3M9QA 2CJYB 1M2VB 4DV3J 2RDJA 2VXFA 2PN6A 2COWA 4X4NA 4MK8A 3FZ2A 2OIHA 3FB9A 1S72S 4DR6F 3OV7A 3SZ2A 1TL1A 1M9SA 2PUKB 3VAMA 2CP2A 5EG2A 4ZVEA 2BKNA 4UT4A 3UDVA 4NCAA 4BC7A 2IIHA 4QWBA 2BYCA 4HH1A 1YRUA 3PW0A 3HULA 2QASA 3JCMf 3AOAA 4L75A 1S5ZA 3G71Q 4I7FA 2CYYA 4WFAQ 2XMUA 1ITPA 2BJDA 1FD2A 2M9UA 4NMXA 2DLPA 3HCXA 2A3JA 4NL2A 1YI2T 4OI6A 3SXLA 4FYYB 5B09A 3CJKB 4F04B 1WX6A 3U7JA 4RW9B 3BPDA 2HLUA 1HWIA 2GFFA 5HVGA 1U7LA 5LJ3e 4C0OC 4RNMA 1DQ9A 1FRMA 2JNJA 2CQ1A 4Z37A 4WCEQ 2UXBJ 1DQAA 2EGEA 2XY6A 4QIEA 1S1TB 1BQXA 2AGQA 2XK0A 4LF9J 4Y91A 2J8SA 1JLBB 1Q16B 5FJ4A 2HK3A 4NI2B 3DB3A 2BIVA 5C2GA 1TWBA 2KO1A 4PG6A 3A3NB 1RTDA 4M5GA 4Q8EA 5C2CA 1VQ6Q 4DPXA 1FDDA 1IKWB 2AWZA 3A8KA 3BGFA 2ZOMA 3DOMA 1KFSA 2D8JA 4FYVB 2GCFA 1WXUA 2HMIB 2MZ1A 1HI1A 1YVFA 1BMQB 1N8RU 4N56A 3QIIA 3KHLA 2ASYA 1WHHA 1UDLA 3S3OA 4KHRA 1PJ6A 4DR2F 1F9FA 3L4BC 4QIWD 1UA1A 2B8AA 4LJMA 5CHCB 1MV0B 4IH5A 3RB3A 5K9FA 2R8IA 3FGVA 4F4XA 3Q1JA 3GILA 4ESNA 3R5JB 1YJWS 4X62J 3VVTA 4BDZA 3HRTA 5KG7A 1P6TA