1NPRA

Crystal structure of aquifex aeolicus nusg in c222(1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
b'QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title A Spring-Loaded State of NusG in Its Functional Cycle Is Suggested by X-ray Crystallography and Supported by Site-Directed Mutants
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nprA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1nprA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nprA01
3CCQT 1M1KC 2L3RA 2LVMA 3LGLA 5IAYA 3CPWS 2MI6A 1X6OA 1VQ5A 3CCLA 1N8RU 1Q86C 1KHIA 1VQPT 1RL2A 1YJNT 1VQOA 1VQ8A 5IT9E 1KD1C 2OUGA 2JVVA 2MWOA 2E6ZA 4QQDA 3CCLT 3OYYA 1VQ5T 1K73C 1VQOT 3DB3A 1K9MC 5FLXE 1Q81C 1QVGA 3DB4A 2IG0A 4YTLA 1VQ8T 3CCEA 1KC8U 3QQCD 3CPFA 1QVGS 3TREA 3G4SA 3KBGA 1VQKA 1S72A 2JOYA 4ESNA 1NJIC 3J81E 1W2BS 1XTDA 1YJ9A 3CCET 2CKKA 4ZN1A 2QEXA 3LD7A 2QA4T 3G4ST 2MWPA 1VQNA 1VQKT 3J7AF 1S72T 3ER0A 3J80E 4OBIA 1YJ9T 3HKSA 2JUFA 5DLQE 2G3RA 1N8RC 1YJWA 3LGFA 2QEXT 3I56A 1KQSA 1VQNT 1VQLA 1Q7YU 1NZ8A 5A2QE 3CCJA 1VQ9A 3H7HB 1KQSS 3EWGA 3A5ZB 1M1HA 1UEBA 1YJWT 1YBYA 1W2BA 3I56T 1BKBA 3CMEA 1VQLT 3JAME 3CCJT 1YHQA 1NJIU 1VQ9T 1VQMA 3LPEA 2JNGA 3CCMA 1KC8C 2XHCA 1SSFA 4X34A 2OTJA 1Q82U 1M90U 2LQ8A 3PIOA 3I55A 3CMET 5HY6A 1VQ4A 1YHQT 3CCVA 1VQMT 2DO3A 2LCLA 3CCMT 2KDSA 3P8BB 1K8AU 2KVQG 1YIJA 4TVRA 3CC4A 2OTJT 1NZ9A 3I55T 2E70A 1VQ4T 1VQ7A 1M1KU 3CMAA 3CCVT 1XNIA 1VQ6A 3CCUA 1JJ2S 1M1GA 1Q86U 3PIPA 2OTLA 3CC2A 5J3BA 3CC4T 1YIJT 1Q7YC 1QVFA 4CRIA 3G71A 3G6EA 1YI2A 1VQ7T 3LH0A 3CCSA 1NPPA 3CMAT 1VQ6T 1QVFS 3CCUT 1KD1U 2KPPA 3CXCA 1YITA 1EIFA 3CC2T 2OTLT 1K73U 2EIFA 3CCRA 3CXCS 3G71T 5J26A 3G6ET 3CC7A 1YI2T 1Q81U 3CCST 1K9MU 4RG2A 3DLLA 2EXUA 5DM7R 1NPRA 2K06A 3OW2A 1YITT 1Q82C 1M90C 3CD6A 1IZ6A 3CCQA 1JJ2A 4ZN3A 3CCRT 3CC7T 3OW2S 1K8AC 5LL6S 2QA4A 1VQPA 1YJNA 3CPWA 3CD6T
chains in the Genus database with same CATH superfamily
1B7FA 4PL6A 3G96A 4OV6A 5KT7A 5I42B 2FHOB 2C3UA 5AXLA 1FESA 3OTOJ 1DQ8A 5HK4A 2KI7A 2KNBB 3GPLA 1KQGB 1FEEA 1I5LA 5B7WA 1Z2LA 1VOMA 1ZUUA 2LMJA 2P4RA 3TAQA 3DRSA 3M9OB 5HANA 1VQKQ 2BKOA 4K8RA 1FRHA 1KFDA 3VS3A 4OV1A 4XAXB 1LW0A 2RILA 2KE9A 3QG1A 2GO8A 3EM1A 2K3IA 3VAHA 1F5BA 5LM7E 4KIAA 1W2BA 2YY3A 4PWWA 4E8UA 3AJ2A 2BM0A 1C6VX 4EO6A 1ZAWA 5L46A 3A8LB 3TJ8A 5GAGU 2RH2A 3R8YA 3GV8B 1BWVA 1D8ZA 1WXUA 3VS5A 4Q43A 2DVIA 1Q95G 1VQ4T 1RUSA 2LTOA 3LX7A 1SPKA 4DX7A 1ZLMA 5GMKe 2OSRA 3CCSA 1UVLA 5HLFA 2D69A 3MM6A 1AWJA 3GILA 2ZE2A 2QGGA 4FNIA 1P1TA 3BZQA 1QTMA 2QFJA 3AD8C 2W01A 3LGHA 3H4BA 3L2UA 4ID5B 3HZGA 1LOJA 4DLEA 1ICEB 2FB7A 4LJMA 2MKKA 1AWWA 5EGYA 3G82A 5CYMA 3IC1A 2A28A 1U1NA 4K4ZA 1U45A 3HTRA 4TLRA 2V9KA 3GSIA 3N6MA 4OVAA 2JOYA 4F4XA 3MR5A 4KHRA 1X4DA 4JI0F 2XEXA 3H40A 1RT7B 2JVOA 4O3QA 3IBWA 1SJ1A 4A46A 2MPXC 3Q86A 2UUBJ 5B0BA 2HFZA 2DTIA 2DPJA 2X35A 1TK8A 2NQPA 1SIZA 4KQZA 1C0UB 4CC2A 2LA6A 2DXEA 2E1MC 4J9RA 4ZDNA 4KFBB 4NL5A 1WUUA 2E1AA 1NJWA 4Z7YA 2PN6A 5A0YA 2CPHA 2YKMA 2GQCA 5D6WA 3M58A 4EZ9A 2HAFA 1OPZA 3IWXA 1H2TZ 3G6XA 4CYUB 2AX1A 3OT9A 4TY9A 1MMAA 5LJ5f 4ER8A 5C6SA 4JJDA 1FE0A 1SBRA 1NHKL 1TFWA 1K0XA 4LRBA 1YITT 5DO2A 4RW4B 2C3OA 2OTJQ 4URGA 4M77F 4PJJA 4ZP8A 3PFEA 3RUXA 4F2SA 5IOLA 2VC8A 1N5SA 2EKNA 2V0NA 1Y71A 1SJ4P 5T7LA 5DY9A 1Q8BA 4DL5A 1BI0A 2AHJB 1RT5B 3FBFA 4OX9J 3NS7B 3VVTA 3V4MA 3QZ8A 2LZ6B 2GJFA 2AJFE 3NGKA 4F67A 1UMJA 3MGJA 2CQ4A 2DHSA 4I4BA 2LXIA 2MQMA 2J0XA 1PD1A 1JLBA 2PO4A 5D0GA 2KXNB 2V4RA 2FHJA 4OI6A 4HYKA 2XMMA 1M1KT 1GXIE 3K17A 2BDPA 5KFXA 3ENAA 4M75C 5C5JA 4LF8F 2NZCA 2KHDA 2G9OA 3O3LA 1W4SA 4A48A 3VZHA 3SYZA 2D74B 4DV6F 3W2VB 5EWFA 4M7DC 3TVYA 3BN7A 4M95A 2ZJRQ 3JCMW 3Q1JA 3TEEA 3QGPA 3OVBA 3MM8B 1TV6B 4EEYA 5FWCA 4FF1A 4ICLA 1BBZA 5MLCV 2CJAA 1NH7A 3BSAA 4KRTA 2DZCA 1XQHA 3ILIA 4ZPVR 3UW1A 3VF0B 3ZZPA 5FLXU 4FW1A 5DZ6A 5IXUA 1YJNS 3KJFB 2UUAJ 3OXFA 2APOA 4JV5J 3NGPA 3UR0A 1BQNB 1N48A 2KFZA 3KJNB 4X66J 1W2BR 1CC8A 1BE4A 2BOPA 5KG3A 2V69A 4O6JA 2ZOMA 3DB4A 1KP6A 4DR4J 3S8SA 3QSIA 1UWBA 3GCXP 2K8GA 3EJMA 4ZNXA 2HL5C 2AD9A 2VGNA 1FK9B 2QA4Q 2QT7A 5A76A 4RCBA 4LF2A 5JVGQ 4LF6J 2D3OR 2QEXT 3PV8A 4YUDA 4A54A 4GO5X 2IVMA 4J9DA 3DOKB 4ME7A 2QSFA 3VYHB 4Y28E 2CP7A 3MCMA 3HJVA 5K14B 4DV1J 3CMET 1OWXA 1MGQA 3B8HA 3H0PA 3TJ9A 5E5NA 4HCZA 3I0SB 4IH6A 1JJ2S 2MJUA 3UPFA 1H7WA 1VRUA 1TAUA 3SB2A 1T3OA 1WSVA 4FU6A 3W5YA 3CMAQ 1VR6A 5AT1B 3KLFA 3CCRA 1EETA 1TU0B 2HZVA 3CBMA 2BW7A 1Q16B 1X4BA 5DG8A 4FXDA 1Q82C 2NCKL 2EFNA 5LJ3h 1VQYA 4Y2IA 4QVDA 4ECWA 3MO8A 3J7Z5 1S6QB 2C2MB 4PJOE 3HP6A 4V1Ak 3FLGA 3JQKA 5KYNA 1RHKB 2MDAA 1N6QB 2O2OA 3R7SB 1JKHA 3LYIA 8RUCA 2UXBF 2AGPA 1X9WA 2XY6A 4RTUA 2X1AA 1X69A 1H6KX 4MMLA 3R27A 4ZJLA 1U0HB 2JT4A 4QIGA 4ENOA 4GLMA 2BJ8A 2VHGA 3HI9A 1KHCA 3OPKA 4ZLPA 2K4YA 3V6DB 2J5AA 3VQSA 2HRUA 2CG4A 2GVDB 2ZH2A 2LC4A 1HWJA 4RUBA 4I6WA 4ELZC 2KGTA 1YJWQ 4BC7A 2MCNA 4EMDA 2DNLA 5IN1A 1VQ9T 1Q53A 3W63A 4KE5A 4ANEA 4PWDB 3QRQA 2P0QA 4YMEA 3JYTA 1R0AB 1S12A 2JNJA 2ZH4A 4R56A 3SHWA 3VV0A 2VKZG 4DQSA 3PKYA 2VOOA 1Y4ZB 2KYBA 1TUGB 2DGXA 3KLIA 1VQ7T 4IDKB 2DIVA 1FRXA 4ECQA 3LH5A 4JI7F 4IUVA 2EGCA 1S0NA 1HQEA 2HHXA 2KQWA 1BQXA 3OL8A 2D9TA 4CO2A 5C42A 3TUPA 1HBMA 4M78C 2DZ9A 4XO0A 1GNKA 4ZMMA 2E1HA 3CC4Q 2PI5A 2MY8A 1GRIA 4R25A 2M70A 2YWKA 2DETA 2CDQA 1RYRA 5H9FJ 1HYSA 3DI6A 2VU5A 2D3ZA 4UW2A 3L42A 4JV1A 5J1EA 2LU1A 1JQGA 4LBPA 4NRTA 4RKUC 1S1TA 2L8DA 2K57A 4Q0BA 2J7KA 1WXBA 2HSEB 3HULA 1TOVA 3A8KA 3HD1A 4GKKJ 3HRTA 4L5GA 2ZDPA 3LO3A 2DKGA 5LMNJ 4DEYA 2DBKA 3EICA 2V4JA 2NLWA 4G65A 3SCJE 1YWOA 4DOWA 3X3UA 1B70B 5KE2A 4FBUA 2G0JA 4J9PA 3FK4A 3UN2A 1YRXA 2JC0A 2RJEA 4LSZB 4YP3A 3AT1B 4GY5A 5GAN8 2HHTA 3CB4A 3RR8A 1RYSA 4RNOA 4B3OA 2GCXA 1PCXA 1SRMA 2B51A 4QR1A 4DG1A 1VIEA 1F0XA 3R2DJ 3UNYA 2E7XA 3KHRA 2UVVA 1V6HA 4O3PA 2PA8D 2VBWA 3TSWA 2JJ9A 2V2KA 3AOCA 3TAMB 3GLJA 3C12A 3O1LA 1ZOTA 1WFWA 4CP5A 1JIHA 4ED4A 4PYDA 1GH8A 5GAHI 2GNCA 3P96A 1ZYQA 1YZ7A 4YFUA 3K89A 1JLFA 4PQAA 4P6QA 3MMAA 3LP2A 4KKOA 4C6AA 3JCMc 1YDLA 1M8MA 5B0AA 1FDBA 4MZTA 3I56A 2B8AA 2QDLA 1W7WA 1C2PA 5D0HA 4TU7A 3RR7A 2IDLA 2H51B 2M2BA 1UFKA 1LV5A 1OMSA 4ZP7A 1HJDA 4HVZA 1IBMF 2JOQA 4A4FA 2VFRA 4I6AA 1I5OB 3CCMS 3I55A 1AEYA 2EWHA 1OPKA 1WXTA 2MOXA 4NLDA 3OS5A 2DERA 4KO0A 1RGVA 4J9EA 4OYPA 1HHSA 4FYXB 1OYXA 4NI2A 1M1KU 1QSLA 5CD4H 3Q22A 1BWEA 1E6YA 1VK3A 1JLQB 2VH7A 4QJVA 3PHTA 1CPZA 2W10A 3G6ET 2CJQA 3BF4A 1ZSZA 1WNLA 1O75A 4PLIA 1K44A 1N27A 5E3AA 1D8YA 2C1EB 1SVDA 4KV8A 4ZIWA 2AYBA 3AB2B 3CPWA 5GMKh 3CD6T 4M7AE 1OI1A 2MAMA 5GAN6 3ZXWA 5HQLA 1PYOB 1VQKS 1RB0A 4W4MA 3ZNJ1 2DXBA 4MYTA 2HEQA 3KHLA 3V5RA 3UN3A 1OOTA 5F8NA 1EKSA 3W8PA 3MKDA 5KFTA 2NYSA 1RT1A 1WG5A 2DNZA 2B8QA 1WGSA 2EGEA 4C8QD 1KLMA 2AHOB 2GMJA 4MFBB 4JI1J 3J81E 3MCAB 4NZ6A 1C4CA 3CTRA 2GX8A 3DKDA 4JUVA 3OR1A 2L3SA 4OZ2A 1PBUA 5FU7B 2EAYA 1XNRF 2RB7A 1HYOA 4PJOF 5KOWA 2MYSA 3OJSA 4M5MA 3DXBA 1CULB 4CLPA 2AWZA 4DV3J 4L74A 2KFYA 2YNGA 3M30B 3BREA 1SJQA 3KJQB 3TI0A 3UDEA 1R6YA 4JYAJ 2VJVA 3SFUA 5FW9A 4DSLA 4J9OA 2GGPB 3QAUA 5KAKA 1CSKA 4TVRA 2FZKB 1XIQA 1BCMA 2GVZA 4CLWA 2LEPA 5J3BA 3R6NA 2QLBB 4F17A 2BQUA 3NTKA 2YLCA 5DZ7A 3BGOP 3CC2Q 3PIPQ 5GAOp 4ZTFA 2HNIA 4DSIA 3G71T 2DY1A 2WRMA 4ECSA 4TYAA 1FX7A 1H7XA 3QIIA 5FRMA 1FNOA 4Z88A 4B3MF 4C0DB 2A08A 1K8AR 1YBTA 1HNWF 3HHLD 1SXLA 3FIFA 3HJFA 2MZSA 1UVJA 1YRTA 4HHJA 5KFNA 4F16A 2WONB 2FPHX 2MMPA 2NUPB 2RE1A 5GAOq 2EJ9A 3AAWB 3URGA 2QGFB 2OUGA 2ATLA 3CCLT 4JI6J 1K4US 4C8QB 4JUZA 4K4SA 2ZHBA 2OLWA 2FY1A 4BS2A 4B3SF 2GQQA 3CMQA 3W1YC 2E1PA 1DTTB 3MM9A 3VAKA 2E5HA 1OU8A 3QIDA 1R8BA 5J2NB 4MMKA 5C2CA 1WDDA 2X1BA 2DXFA 3ULRB 1TTHB 5DDOC 3MAHA 4DPWA 3UDCA 3EGNA 4LDWA 1HK9A 2AKWB 2WACA 1BI2A 3RBEA 2HHHF 4PFOA 3JCMb 2OTJS 4DUYF 1KTVA 2RQCA 1XJWB 4C4WA 2QX0A 4IFVB 3PX0A 4DCOB 2VG5A 3TX0A 4JI8J 3QIPB 3AHPA 5A8KB 2FJVA 1U1QA 2VASA 4X62J 4N0AA 2ZC4A 2LQ5A 3QATA 2K2MA 1T03B 1SJ3P 1N5TA 3OYBA 2PEHA 4QQ6A 1CSJA 2CYYA 2WW4A 3HHLB 2EC2A 3OTOF 1AB8A 2WHOA 2M0OA 2JN0A 2WSEC 1RLCL 1L3SA 2MYFA 4M75A 1RT4A 2MTLA 4KGKA 4X4PA 2ZM6J 3GYNA 4N5SA 1X4CA 4M77D 1HNVB 1Z4UA 1RWPB 2G2OA 1AOJA 2DXDA 4EIKA 4M7DA 3MPVA 4W90B 2GHPA 3JTPA 1K9MC 2COYA 2CPFA 1OPLA 2LCCA 2QMXA 2BJEA 2IHR1 2IAJB 4PPZA 1QJHA 2HK2A 3FRYA 3VAIA 2ALZA 5HMYA 5KYXB 2VKRA 3WBZA 4GVLA 1N0UA 4WTYA 1CBKA 2ED0A 1KFZA 5EX0A 3TUZC 2A0FB 3SXLA 2SRCA 1PNJA 3RERA 4I1TA 2CUDA 2RKIA 3EGDA 1UL3A 2ZBQA 1JJ2P 4PJNA 1X31C 2YQ3A 3P3DA 1WF0A 4NASA 3PE0A 1JBMA 2WVCA 3D0GE 1XNIA 1S9FA 1N6AA 4LQ3A 1X4GA 1CLFA 4ZHRB 1ZA2B 4TLQA 4B9UA 2XI9A 3N9UC 3BJYA 4ATNA 4IH7A 5B0CA 2LMIA 4ES1A 3QUIA 5FLXY 1FERA 4CO4A 4PJMA 1A0OB 1HI0P 4HACB 2ZPFB 3HDSA 3CC7Q 2HNYB 2IVFB 4AD6A 4M77B 1TFYA 2EQMA 1G8XA 2YWEA 2QA4S 1R6VA 2RK1A 4ATOA 3FRZA 2MQQA 3EXCX 2KH9A 1FXXA 4BDYA 1L5UA 3DHXA 2MHEA 3O5ZA 3GPAA 4IO1A 4NLGA 3KNGA 3BFMA 3G4SA 2QV6A 3I96A 3G87A 1I6JA 1HBUB 4AFZC 2QLWA 2HD0A 2RQWA 1YBAA 3R97A 4EMKA 4M7AF 3UDVA 4F4WA 3NGTA 1XNQJ 1F5AA 3ZNUA 4OI4A 1WC6A 3BW1A 1H72C 1UG1A 3TQEA 3KLHA 3CMAS 1D9FA 2RSQA 3OD2A 4F02A 3VS7A 4NLYA 4UOHA 1FDAA 2K3YA 3META 5F41A 4LUDA 4DV2J 1B3QA 1N4LA 2LKZA 1SQGA 3P8BB 1K0SA 1NK5A 2V9WA 5IHNA 1QQJA 1S1WB 3SCLE 1S7IA 3S3OA 1IXKA 2ZGWA 2NYHA 2VXEA 3CW2C 2XLJA 3GJSB 3DXSX 3UR3C 3IGVA 3RESA 1QAYA 4O0IA 1MU2B 1NLOC 3OW2R 4USVA 1YI2S 1M30A 1RU1A 3ET6A 2DMOA 4I68A 4ZVPB 3UT1A 1N8RT 3ENVA 2PVDB 1IM6A 2XZWA 2AYEA 2V2ZA 1BYMA 1X43A 1B0VA 4OX9F 1SKRA 1YJNA 5I42A 2BQ3A 4Y92A 3CCQT 4KR0B 1JJ4A 1TL5A 1IB8A 2CJ9A 1Q79A 2RQUA 3NGSA 5G4DA 2CH4A 3T1AA 5DQGA 5GAMj 2DNPA 1I94F 2CG8A 4ECTA 1NLPC 3ELHA 1NM2A 4TYBA 5C2GA 1N33F 2C06A 3DLLQ 2KM8B 2M51A 3CJ3A 5KG4A 1JRIA 3NBPA 3CCEQ 1G4CA 4KY3A 2HHQA 4JI4J 2ZD1B 4M78A 1YJVA 5I2MA 1FFSB 2BJ7A 2I38A 2HL3A 3QRRA 2DE0X 1YJ7A 3DLEA 2J6TA 2AEFA 4A8WA 4OI1A 5BYQA 2JNGA 2A6OA 1RTDA 2W9CB 3AQPA 2DXTA 3EPIA 4IOAQ 3WC2A 2YTCA 3P5BP 4A4EA 1HKAA 3CDWA 3CC4S 3HP9A 4FW2A 4Y00A 2COLA 3MMCB 1YIJT 4A8SA 1WZOA 3Q2SC 3PKMA 1BIAA 1NPPA 1IREB 4OMMA 3K5PA 1VLYA 2Y8YA 5CAIA 2YX7A 2FZCB 1HLWA 5FU7C 4C92D 3DYAB 4X66F 2P0PA 4LRAA 4OMLA 4QT7A 2VB6A 3KXTA 1GFDA 1Y9OA 4WP9A 3PFOA 3OYFA 1N52B 2XSJB 4DR2J 1AZSA 1U8WA 3IG1A 1VIOA 3DOMB 3EZ5A 2H4WB 2EJFA 4J7IA 2LVMA 1MUZA 1CQNA 3LGLA 2MY7A 4IUUA 1MN7A 2AJ0A 4CQ1A 4K0KJ 4D6WA 3B6BA 1UHFA 2CQGA 4QR2A 2EKYA 2IRYA 4U9RA 2VPZB 4LF6F 2J9EA 4QWBA 1H8KA 3AJ1A 2E5KA 1TQLA 3D6HB 5I3UB 2C28A 1I1GA 4EMGA 5EWEA 3M32A 1U26A 4NA3A 4FF2A 1FWZA 4FS1A 3ZL7C 1QWEA 2AU0A 3I5AA 4RU9A 1K0VA 3DLJA 4OMNA 1C0UA 2L0AA 1FNMA 4USJC 3V81B 3JSMB 3RKXA 3H20A 4NWBA 4C0DC 4OZ1A 2H5IB 2Z57B 4AFUC 3VRZA 2IBKA 1YHQS 1RWUA 4OMFG 1G3TA 4RW6A 4GVBB 5HVGA 3A8HB 4DX8H 3H2VE 3PDNA 1WF2A 4B9WA 4CYUA 4G1QA 1DZ5A 4J5OA 3BGRA 5GAHU 4MDXA 1OZ2A 2FHKA 3T5KA 4C92B 2KPPA 2D7SA 1UPMB 3D0HE 4RW4A 4XPCA 1XR5A 1QVGP 3CMEQ 5J2QA 1M5SA 4PXCA 2HBRB 3HVAA 2B4UA 1Y07A 2GS8A 3D6MB 2JM8A 1Q82R 4KSEB 4NLQA 3MR2A 1MWZA 2HFSA 3SSSA 4ZLNA 3MM5B 3OR2B 1SEMA 2JDJA 2Y0BB 4EZ6A 4J9IA 4PUOA 1UP1A 3UD5A 5L39A 2CVIA 1UEVA 2ZKUA 3TJAA 1WG4A 4DR3J 4HH1A 4J9LA 2B4PA 3CJKA 1Y0HA 1YCSB 1Q82T 1GXTA 1IKWB 3H9NA 2F8EX 1IR1A 5IWAJ 1KFSA 1WHMA 4PJLA 1Z2ZA 3HFVA 2HVEA 4XPEA 3OBWA 3L7UA 1UZHA 1R8AA 4IIMA 2H9ZA 3MAQA 1U8RA 4OX8A 4U7UK 1O0PA 5C24A 2IIHA 1IGQA 1YJ9S 1Q8KA 2CWKA 4OMFB 1FRLA 2JUFA 2QXFA 1F2HA 3X28B 2CDTA 3O5TB 4JI3J 1QY7A 3NHNA 3S6EA 4NXNF 3I5BA 4M75E 2N7CA 5GMDA 2FRYA 2QE5A 1YJTA 1RDRA 2JTEA 1KS2A 1GL5A 4QIVA 1I81A 2W4PA 5GAMe 4LF5J 3RAXA 3JB9G 2KAFA 4GMKA 4M7DE 2XSFA 2PD1A 4FSXA 4HTIA 4NXMF 4I0WA 1Y5IB 2ZVSA 4L6V3 5D4PA 2XHWA 1HHQA 3MM8A 1TV6A 2FLPA 2QLJB 4I64A 4RW9A 5KFSA 1VBXA 1VQ9Q 1FRJA 2ZFHA 2F40A 3A8IA 4ZLJA 4M5DA 2O4XB 3FC9A 2YH1A 1U25A 3V4IB 3X25B 3M1VA 3GV7B 2EQIA 4LF4F 3EG2A 3THKA 3FDSA 2DNUA 3C16B 2B6AB 2COZA 4OB0B 1NZAA 1VK8A 1NE8A 4O44A 5FROA 3R1LA 4NLPA 2FHDA 1CJUB 2VA3A 2XTJP 2BUDA 4WFXA 3T1HJ 2BTTA 1RWOB 2GJ2A 1EZZB 2ZBPA 2B9XA 3EG9A 1N5QA 1U09A 4GKKF 3KBGA 1DTQB 5EC7A 3LAKA 5LMNF 1ZX6A 5CR2A 2GW8A 2DAQA 2B5JB 3HZEA 2RAQA 2C22A 2DR8A 5GJVB 3CULA 2P4TA 3DOKA 4TQRA 1PJ5A 4JRKA 4B9XA 2XYHB 4NX9A 2KZMA 3MEEB 3QWXX 3CF5Q 4GC7A 1OYEA 4IUTA 5KFEA 2LJ0A 3ZTQA 4M77C 3JAME 5ETKA 1NJYA 3CCMA 1PCAA 4DFKA 4PJOG 1XMQJ 3GIRA 2OELA 4AFSC 2KHCA 3IAM9 4DS4A 3TZYA 3A8EA 1T9XA 2EPDA 1D9DA 2H3JA 4B08A 2XI3A 4QW8A 3CCUS 4I2QB 2E5LJ 1RI0A 2HCKA 5HL7Q 1N9SA 1IBKF 2DYBA 3LAMA 4Y2MA 1S6QA 1FDDA 1OEBA 3S3NA 2HKEA 2LDMA 1IZ6A 1PC4A 4WCEQ 5LXYA 4AXJA 2C2RA 3F44A 1U1PA 2Y0SD 5G0RB 1S0VA 2L3RA 2Q66A 3REBB 3GE9A 1N8RU 2K1RB 1TVRB 3FJPA 3MTKA 1X9MA 1LCKA 2UUWA 4E2FB 2QL9B 1S97A 2IJRA 2MB0B 2AT1B 2OPPB 2BXJA 4PG8A 1VQOT 2MQOA 3C66A 4G6VB 1N32F 3QO9A 4OJHA 2LEAA 2C0TA 4H4MB 2CKKA 2EFIA 1I4K1 1B64A 4HA8A 2ROLA 2EK6A 3GIKA 5MAOA 3Q0AA 2ZZDA 4X1VA 3T1YF 3ZTOA 1J5EJ 2KY9A 3CJTA 1WI7A 1WDTA 1KQSS 1M1HA 1PBAA 4II1A 2V5HG 2E7WA 2ASDA 2ASJA 1SHGA 4X34A 4LBIA 1GBRA 1OULA 5LJ3d 1K73T 4P9SA 1Y7PA 2RB6A 4BI8B 1MROA 1N34F 1ROFA 5D77A 2KXDA 2I5JA 5HP1A 4M5JA 3R5JB 2L5QA 2FPFA 5GAMf 2KM8C 2J8SA 3ZZRA 2RRBA 3SMZA 3J7AN 1FD2A 2Y90A 5HK3A 4HHUA 4LSLA 1U1TA 4IR1A 3KK3B 2HGLA 4M78E 1B34A 1OYDA 5D7UA 1NK8A 2E9ZA 3MECA 4I7FB 4ED5A 1UFFA 3GP9A 1HPZA 2XMAA 2GFUA 5KG5A 1REVA 1UW4A 2XLIA 1JLAB 1B0TA 3QXEB 4A8YA 1RLPC 4KGMA 2EFVA 2JWNA 4NOYA 1AUSL 5KG1A 1T9VA 2E3IA 1KJWA 2ZZNA 2KKHA 2MKCA 4RKUE 1VQ8T 3FDRA 3AA8A 4ID8A 1Q7YT 5A2QU 3CDAA 2L41A 3M53A 4DV3F 2YUOA 2IDEA 2R2RA 2KT8A 1RTHA 1QP3A 2ZBRA 1S72T 3LQVA 5IQQA 4DF8A 3OLBA 3THTA 2Q43A 4JYAF 2DNHA 4OMPA 2PVOB 1JU5C 4CLUA 4CH7A 4B9VA 2B9EA 1P9QC 3CCJT 4DV5F 3BKUA 2CPEA 5H9EJ 2Y4XA 2XHCA 4OYAA 2SEMA 2OTJA 1X5PA 1LWEB 2JZ2A 2OPSA 2G2ZA 3RB6A 1ZM3A 1IO6A 3CC7S 3VS0A 4ILMA 1SHFA 2UXCJ 3DOLA 1S6PB 2OP5A 5JUMA 3RBXA 5DLOA 1OZ3A 4YB6A 2DL5A 5GAN2 3OS0A 5CXTA 1H3HA 1KK7A 3EGZA 1VHIA 3E2UA 2XMKA 2E3HA 2LCSA 2XZTB 4X4NA 3PX6A 5J1PA 2YSQA 4J7FA 3PVLA 4W92B 4KH0B 3INZA 1WJRA 4X2BA 2ZZMA 3JAMU 1LOUA 2BX6A 3VS6A 2G2YA 1EP4B 2ATCB 4FT2A 4DEZA 4H54A 3MEGA 1R77A 2XO7A 2E5QA 1PJ6A 2X9HA 5KH6A 2XO6A 2WSFC 1X2QA 2H4YB 3AH6A 3CO0P 1EQMA 2U2FA 2HPUA 1N5YA 1LEOA 5GMEA 1T9WA 1NJIT 3HCXA 1GMWA 1FJCA 2E12A 4WE1B 3FJ2A 4UZCA 5AE3A 3TP2A 2YT6A 5D6GA 2J05A 2QC3A 4DZDA 2YNHB 3HD2A 4BE0A 4J9FA 2XDDA 1REGX 1TKXB 2BABA 1BHNA 4JI8F 2E65A 4OQJA 5CYQA 1BY9A 1RJJA 3M0TA 4M7AG 4M1KA 1SG5A 1F3VA 2ZNZA 2ZUAA 3FB9A 5AXKA 5HBMB 1VBKA 3H90A 4ZOSA 4PEOA 2M1HA 4FDFA 5AE1A 3HHDA 2J6SA 1QCFA 2R7SA 3NWRA 4N8NA 4Q5WA 3TA0A 2ZM6F 1RKJA 2ZPGB 3G8QA 2GGRA 3M4GA 1SUQB 3PR4A 2I0XA 1YITS 2YRDA 3DDKA 2AEMA 2OX7A 2CRLA 1CEZA 2QSWA 2QA4A 3ZO7A 1SC4B 2CP3A 4LFBJ 2Z2LA 5HKCA 3MEWA 5KYYA 4KYZA 1B7TA 3QNWB 2DGWA 2QYZA 1P27B 3IWNC 4Z7CA 2RQRA 1O8BA 4MFBA 3QKJA 3FFIA 5IHKA 2IVWA 1K9MR 1X01A 1X4FA 1NUEA 1IBLJ 1UGVA 3M0SA 4LRFA 1ARKA 5F9LA 3OYGA 2BE9B 2FHMA 5ETMA 3MWBA 3CEYA 3L2WA 3RGIA 3OYDA 2U1AA 2KRRA 1WC3A 3CIZA 3TNVA 1UEBA 2A2CA 3I56Q 4LD6A 2XYGB 2GGPA 1FKOB 1WI6A 2ZPBB 2MZJA 4O4GB 2CJBA 3AB4B 1NNDA 5IFMA 2ASLA 3BDPA 1T9UA 4ZCIA 2HHVA 3NGDA 1X6BA 3I55Q 5HMZA 2PQWA 4BD3A 1JX4A 1YX2A 3OSSC 3VQTA 2FVPA 5H9EK 1CJVB 1YI2A 3KNAA 4RCCA 2X1GA 2DGQA 2HIQA 3SIPB 3M57A 3OYCA 3HLUA 3EFSA 5A0LA 2V94A 1N9RA 1WKKA 5DLGA 4HLBA 2DNMA 3UWNA 1EARA 3N4WA 1YNZA 2EW3A 1NSKL 4Y2KA 2KROA 1K76A 3M8PB 2QQBA 2HQEA 1RXOB 4JP8A 1T8EA 1JK9B 3T5JA 1D3BB 3B82A 4J91A 2CSIA 3PVXA 1UVKA 1W2BS 4C8OA 3KLEB 4CM2A 2J7UA 4IOBA 1A6LA 2RHXA 4K7QA 4H4OB 1VQNA 2CNLB 2X4WA 2QEXS 4Y28C 2K79A 2BACA 4DFJA 3OHAA 2DK3A 4LF7J 3WXMB 3IM9A 2K7JA 2O31A 4PQUA 2RDDA 3BQ0A 2R3VA 2UU9J 3SDZA 2NUTA 1JXLA 3LWMA 3CMES 4FYDA 4A4KA 3VTIA 4YR0A 2A1BA 1WD6A 4HDGA 5K20B 1VQMT 4JOUA 3CC4A 3UCZP 1JEGA 3SWNB 3OUYA 1FRMA 4FP9A 4YB5A 5KFJA 2XMUA 3H5UA 4LXCA 3M8YA 2WW8A 1C1BB 3GOXA 3F70A 3VAMA 4B9NA 5GAMh 1WEYA 3L2QA 2ZZTA 3M4YA 4BY6C 2PTKA 1K73U 4EI2A 1X0FA 2PT0A 4PJOC 4UOGA 2HNZB 4QYZJ 2F5GA 4DQIA 2K7AA 1ZM9A 1LW2B 1M1KC 4LFAF 2DIGA 3ZZ0A 2CQBA 1X6OA 1WYXA 3ETMA 3BDUA 4JI4F 4NLOA 2Z2YB 3DLKB 3A1YG 4ZS6A 1CJTB 2DR7A 4J83A 3PY8A 2RQMA 1DQ9A 3CCQQ 4CTAB 3E01A 1T7PA 4QKUA 1X27A 4ZPAA 3T9ZA 4TQSA 4N47A 2QZ8A 4J7CA 4F04B 3I4PA 1NB2A 2WB4A 1Q7YU 3VAGA 3OTCA 2Q79A 3IS9B 1UEKA 4Y3CA 1VQ9S 1E6GA 1MN9A 3QJLA 5D4LA 3TAPA 1YHQA 2C3MA 3T41A 3H4DA 4PG4A 1UFWA 3BY7A 1FFGB 1M4ZA 1BCOA 1ZHIA 1LFPA 2L3MA 1NPKA 2WK4A 3AA9A 2CJXB 5GANe 1BB9A 3VWSA 1PO6A 2WVBA 1VQ7S 4DR2F 5A8RB 3PRBA 3ITHB 5GAGI 2EQKA 1LK5A 2OAUA 1ELOA 1QCOA 3L7OA 2ZH7A 3RAQA 5KT3A 4RW7B 2ZNYA 2GQ2A 3GONA 2KB2A 2IC3B 3HHKA 1WHWA 5E3CA 3POTA 3SBMA 3PYFA 3JQMA 2FYKA 2M8DB 4ZKAA 1YN8A 1HQUB 2MI6A 2W7PA 1HD1A 2PFDA 2F2WA 3OVAA 4LVNP 4I6YA 1PHTA 5F8GA 3T19A 4VUBA 1RHUB 2MWOA 3AXKA 2J9CA 3H2LA 3EGXB 3I4HX 5IXFA 4R0JA 3QWYA 2K2VA 3CT9A 3BGFA 5DDRC 4J37A 5ADZA 3C14B 1U8SA 2FJDB 1YJ9A 3OBYA 3DM2A 1S59A 1WELA 4MAKA 1KQSP 2A3JA 4J9GA 4IQXA 2UUTA 4E7ZA 2HS4A 3NS6A 1WHLA 2ZH5A 5FDLB 1VYTA 2XG8D 2B4OA 2G1DA 3CWJA 3QYYA 4FKYA 1NJIU 2GHWA 1NB7A 2WBRA 2FD2A 4RBUA 1FJGJ 3IBCB 3I32A 1ZH5A 4NA1A 3M8QB 4XQ3A 3AD7C 2XDPA 3ZEHA 2W2PP 5DETA 1Q81T 2DTHA 3BKFA 4NCAA 5FJ4A 3NNCA 4TY8A 4KHPJ 3ZBDA 2KZZA 4KGVB 2DB1A 3M9MB 1G3WA 4IG3B 2XGQA 2CUBA 4F4AA 2ZC3A 1I07A 3ISNC 1GMUA 2ADCA 4OMQA 1G2BA 3MPDA 4YR2A 2F9DA 5CCLA 3C6UB 3W2WB 4JPBW 2H48B 4QIWD 2DEQA 2VC0A 1ZAXA 1VQPT 3IFEA 3TCJA 4QYZK 3GIBA 2X1FA 2DITA 3M0UA 3M2RB 3MAAA 4LDYA 1V29B 5I22A 1SQFA 4RNNA 4USMA 4NMLA 2R7WA 1QLNA 1KSWA 1WC5A 3VGVA 2HBQB 2IYIA 2R7TA 3CJ4A 4UY85 2HBYB 2AJ1A 5FIIA 3HX9A 3E2EA 8AT1B 2HZYA 3VRYA 3G4SQ 4LF5F 5LSOA 5KT6A 4OYMA 2MQPA 1TG0A 4IUPA 3BSNA 5F0WA 4DDFA 4R8UA 1UJ4A 2Y9HA 4HH0A 1D3WA 1BKBA 2ESWA 2D3O1 1R3NA 1NXIA 1IJEB 3M6UA 3KK2A 4J9HA 4OZ5A 4ZPBA 1H3ZA 4K4WA 4J6WA 4UY8T 3WVDB 2XMJA 4NEZA 2M0YA 2N7YA 4DPOA 3CQTA 4N4IA 3SV4A 1I1JA 3CCUA 5KFKA 3VUBA 3PTWA 2PVGB 2YX4A 1GTHA 1M5KC 3TX8A 3G6ES 3NGRA 2B9YA 4M7AC 5J26A 5AXMA 1T0HA 5GANf 2HEKA 2AW0A 3PNIA 4FVCA 4DUTA 1F9HA 2EFQA 5F3ZA 4GKJJ 5CKHA 5DGBA 3PW4A 1YLXA 1FMWA 4JRPA 4ELTA 5IAYA 1VQ5A 1WKJA 5BXIA 1LWCB 4B3TF 5A2QY 1KQ2A 4DLGA 2V8VA 1D0ZA 2ZJPQ 4P7VA 2LQWA 3AOAA 3G8TA 4AMCA 2KRNA 2VQEJ 3HVTA 3OTBA 5K9FA 2QN6B 1TL1B 1TUCA 3MMBB 4FCYA 4Q8FA 1OQKA 1JLEB 1Y96B 5D3GB 1S1UA 1XMQF 1AFIA 3D6FB 4PKDB 2RRAA 1KQSA 5KYWA 1WI8A 1KQKA 1RU2A 3OSVA 3SV3A 3K7RA 3CXCP 3DMJA 3NCPA 5A8WB 3BYRA 3TA2A 2YKPA 3GIMA 4X65J 4C8QE 2NXUA 2PUOB 2ZJQQ 4ED1A 2QAZA 2NREA 2GFAA 2GIRA 1FI4A 4FYVB 2EI5A 4R55A 2P6TA 4ZVFA 2BW2A 1RA6A 2HRYA 2EEYA 4B3RJ 4NL3A 1VQ6T 4MIBA 1HNXF 3G71S 4OFZA 1I0CA 4LUBA 3BE3A 2XCAA 3CIMA 4L73A 3C6TA 3GG0A 4NRUA 2LEBA 2HFNA 4NLVA 1NYFA 4D3GA 2HWHA 1OPIA 1X6GA 1TSFA 2MKJA 2OEJA 2RF2A 1VYVA 5CKDA 1ULRA 4ZPDA 4QVCA 1QE1B 4XAKA 2XMWA 3CCLS 1TKZB 3QBYA 4DV0J 1R0CB 4OIXA 2XULA 2YNFA 2JJ4D 5B08A 3RRHA 3OV7A 3W66A 5KFCA 1J5EF 3SWNC 4QWEA 2W7OA 4OJGA 4QU7A 2BRLA 4ECVA 5I3QA 3UA6A 2EQUA 3EE3A 1FYNA 4DJBA 1XEZA 4JRIA 3DLGB 3KUHA 2FJXA 1MLAA 2G3RA 1NEBA 4XTVA 3M2VB 4JLIA 2MKIA 3RW7A 3ZZZA 4KTQA 2WOMA 3VHQA 4YY3F 1QLYA 1FKAF 4V2SA 4XTYA 2QL7B 2VBYA 1HA1A 4C11B 3HKWA 2RN8A 3S6WA 3I0RA 5AXNA 5T41A 3U23A 4E98A 1VQ4A 1B0PA 3NY0A 1VA7A 4PR6A 3C8YA 2YRCA 2YQ0A 2OKQA 2E70A 3RB0A 2KRSA 2KMTA 2NXCA 4NCGB 5HJYA 4FBTA 4Y34A 3MPWA 4DMZA 3C15B 3D6TB 2F7VA 4FXVA 1T05B 4X4SA 2XS5A 2LQ9A 1HL6A 4RW8B 3LOUA 2FC8A 3LA0A 1C1CB 2B6AA 2E66A 1MV3A 1V5VA 3BO2A 1OY8A 2F8HA 4OX6A 4K4TA 4Z89A 2B9WA 2QTWA 2XGPA 1YSJA 2IIMA 2FPDA 4KB7A 4ED3A 2ROPA 1OO0B 2VL1A 3I9V9 2M0GB 4EO8A 3R7BB 1NKCA 1W2BP 5AJ3J 4BBYA 4QYRA 2LRQA 2MHNA 5DG7A 2YNIA 1VRTB 4URQU 5J2PA 1X5SA 4O5VA 1X9SA 3P6YC 3UFCX 2QQSA 3MR3A 1AROP 3ILLA 3LP1B 1MW7A 1KHWA 1UW9A 4MKYA 1CS4B 2M8HA 2Z0GA 4M77E 1S5ZA 3QT5A 1HARA 3EDQB 4J6XA 2CQIA 2RJCA 4WP3A 1YG0A 2AYGA 3L4BC 2UXCF 2O9SA 3A5ZB 4OL8A 2R57A 1RABB 2W0ZA 2RK2A 5GMKm 5DJBA 4M8LA 2ZPEB 1VJQA 1V3SA 2A2DA 4NPOA 1MMGA 2UVRA 2FVUA 2GA7A 1IQZA 1RAIB 4FNHA 4M4ZA 3KG4A 4J8OA 3RB3A 4N76A 3PJWA 5LJ3g 1YITA 3CEDA 2OTLT 3H5YA 3V7CA 1Q81U 3DLLA 5I2SA 1SL0A 4USWA 2C2KB 3RBBB 9ATCB 5G0RA 5IT9U 2H8HA 3M0QA 3OL6A 2V2QA 2K1RA 2AMCB 2B43A 1D1AA 1U0SA 3M4XA 2DVJA 3H2UB 4FKXA 4WF2A 4KBIA 2CIMA 3W9JA 3HVWA 5EHHA 4WFAQ 3M2UB 2NS1B 4YTLA 1R0BG 1M5PC 2XCPA 4PJOA 5M2PA 5J2MB 3H98A 4ZN1A 5LJ5e 3KMQA 2GIFA 2W2MP 4A8XA 4NLXA 4AFFA 2HMIB 2V8IA 4OBIA 3RMSA 1GX5A 4A0TA 3HVRA 2CJYB 2YPZA 3LGFA 5KFYA 3QO3A 3E19A 2V1RA 1NK6A 3KTQA 2GMLA 1VFJA 3MEVA 4QQGA 4B9SA 1RTIA 4LF9F 1I3OB 2N3OA 1MMNA 4NCBA 2RVJA 1P1LA 3R5DA 3QPIA 4QIFA 1NEEA 3CCMQ 3DRSB 3BH7B 2PI4A 3S7RA 2QA1A 1DQAA 2KL8A 2PEBA 2J7WA 2ZH8A 4HXJA 3DDNA 4Y0FA 1LW0B 2VC1A 4LFBF 4Q2MA 2VIHA 4IRDA 4BI3A 2Y3YA 4MIWA 4U7UD 2OI2A 1R31A 4C8QF 5GANh 1OJ4A 3OW2S 2ROGA 2OPQA 1GQEA 2L9DA 5KE3A 3CCQS 3VR1A 2F65A 3IWLA 1HQ2A 3SFGA 3FEOA 2Z0WA 2AZSA 1IBLF 3SCIE 2ZWOA 1S0OA 4DV7J 1XTZA 3CGIA 4HTJA 1RWNB 2D8HA 1R8PA 2LVWA 2OMOA 3JCMe 5HLFB 4C5GA 2CSQA 3MM6B 5FLXE 4UZBA 2ZE2B 4ZVGA 1P9YA 2AV5A 2RT3A 2ZH9A 3TVKA 3QJJA 1S1XA 2VFTA 2QEXA 1GXUA 3GNFB 2E64A 3N6NA 3R5GA 4R5PA 1SB6A 2FG0A 4CLKA 1N54B 1RT3A 4ZGEB 3EVMA 3UATA 4MJKA 5CZXA 2RU9A 1M3BA 3D9BA 3NAHA 3CMEA 5GAEU 3G82B 5CYMB 1VQLT 1BC6A 2MK5A 1H3DA 1IKVA 4IFYA 2LQ8A 2FGOA 3LGMA 2WB1D 2MF2A 1M2OA 5CHCB 3KHGA 3DKMA 1V9OA 2FZGB 1FO1A 1TK5A 1DURA 2D41A 3FSXA 5ETPA 3SDEA 2NR0A 1G2EA 7FD1A 3D1QA 1TKDA 3NGUA 1NO8A 1YFNA 3MD3A 1RISA 2F9JA 2VFSA 3GWCA 2FHJD 5DM7R 1LWFA 2DJWA 5KFUA 3VUZA 2JTFA 4DN9A 3A8JA 4LMZA 1M3CA 5HROA 5A0YB 2FGCA 2YKMB 2VF3A 2W25A 2VYTA 5ETTA 1H98A 3UCGA 3UVJB 4LDVA 2WSFE 2D0QB 2BANA 2VQFJ 1IGUA 4XTZA 2F4FA 3A8OB 2QQ9A 2W9BA 1TH7A 4MDWA 1TKTA 2W2OP 1QAXA 1HXDA 4LF7F 1XMOJ 4YOEA 3WIVA 3RYLA 1KOOA 2CKWA 5KT4A 1OU9A 2VDIA 2UU9F 4CLZA 4F3MA 4MK9A 2F1LA 1VQKT 1Q86R 1HMVA 3G8SA 4MH8A 1WJQA 1N8RC 4B9TA 1VQ9A 2HW3A 1SH0A 3OTEA 4KHMA 1IWAA 3KUFA 4D3HA 4F7UF 1HW9A 4WFNQ 2HK3A 2I2YA 5T7LB 5EX3A 2IVYA 1Q86T 1SSFA 1AD5A 1LFWA 1Y57A 2X4XA 1EKRA 2VFUA 2H3EB 1VQ7A 2XMVA 2QFIA 4CCHA 2J6OA 3I9ZA 1JLBB 2GBQA 1UETA 5IM0A 4WFBQ 1FX4A 3FJ5A 4RG2A 3PNWC 1VQMQ 1U3OA 3P8HA 2HURA 1HR0F 1YBUA 3KFWX 4UOFA 2M5YA 4RLEA 1NSQA 4CWBA 4OJ3A 3K5MA 4U8VA 3G4SS 4AFQC 1M1KR 2ZH1A 1TL3A 2E9RX 4QQBA 2X4JA 5IH2A 3LTOA 1RTJA 4F3OA 3I5SA 2OIHA 5LJ3Y 4P74A 4M7AA 3RBDA 1QP2A 2HBWA 1PILA 3JCMf 2ILYA 4Z37A 3O2IA 3Q23A 2IPOB 4B17A 1SF9A 1NK4A 4NMXA 2VPWB 1QMCA 4N8OA 1F9FA 1FKOA 4BHQA 4AYBD 2UVWA 3T6BA 2ZH3A 4X84A 3MM7A 2DRAA 1M90U 2EG1A 2ZVIA 4WYWA 3GQCA 1M5OC 1FCAA 5K8NA 5FU6B 1V5IB 1UWBB 1WORA 4FN5A 1N0VC 3ZC4A 4JRQA 3S3MA 2V8KA 2DISA 5DG9A 1V3RA 1VHFA 2BQRA 1D0XA 2EIFA 2VBXA 1UCNA 3EXYA 3GTYX 4JV2A 2K5LA 3NS5A 1U06A 1LQ9A 3Q8RB 1U6ZA 3W61A 4C0GA 2FJEB 3QT7A 3D67A 4LE9A 3ZZYA 1L3VA 1VRUB 2LX9A 3DGPA 4FPRA 2BZ2A 2M9UA 4O3SA 2X51A 3DB3A 4X9CA 3KLFB 1EETB 3M6XA 1A9NB 4L72B 4JI5J 5GAN5 3IR6B 1UAWA 2DNYA 1S10A 5I3PA 2UUCJ 3HHTB 1M0SA 2HKNA 4DR7J 1MV0B 2FO0A 5T14A 1S1NA 1JKHB 1F6TA 3H7HB 2DHXA 2CQPA 2LT4A 4DL0C 3FBEA 2JEGA 2E29A 3MEUA 3R5AA 1LWXA 2GO9A 5GAOm 3BN4A 4OZJA 1NCLA 2VPXB 5KOXA 4CI0B 2I8EA 2EYWA 3SWNA 2CNKB 2K5FA 4AQYJ 3UA7A 1KIKA 2QIFA 5D6XA 1UKUA 3M59A 1HBOA 3G6EA 3NLCA 4LRDA 1S1VA 3HFOA 3PG9A 1U6BA 2YXYA 3BPDA 4DBQA 2CJKA 3C94A 1Z1ZA 5DRKA 1YI2Q 4X4TA 1IKXB 3D2WA 4UUWA 3CD6A 3DU5A 3FCHA 1RWWB 4KUIA 5BJRA 3JCMV 1NJZA 3JYTB 2NLUA 2E5GA 3BM7A 3WDOA 1M27C 2GIQA 4Y2AA 2DNOA 5F8JA 2OPRA 5D6YA 2QTXA 2W7AA 4OJ1A 4N41A 4IUFA 4Y2CA 2RF0A 1VC5A 4LF8J 1WEXA 5EG2A 1UECA 4C3MA 2LJ1A 1RKIA 3DU6A 5CK9A 1VS3A 2R8KA 4YS2A 4DV6J 2J9DE 4IQMA 3MFIA 3CJQA 1YQHA 1X2KA 1HQEB 2RRNA 7AT1B 2A10A 3GJRB 5A6PA 2ZH6A 4LFCJ 1TXQA 1KNZA 4MIAA 1RBLA 1SIWB 1YJUA 2HQIA 1WJSA 5C42B 1HBMB 4XDCA 2QA4T 3LWIA 1VQPQ 2C2ZB 1W2IA 2ZHOA 3UCUP 4EBDA 4F2RA 4OLOA 2L3QA 1F3FA 3D0IE 3E9FA 1VQNQ 3VGSA 4EYHB 4UOCA 4E7JA 5GAMd 1HSQA 4KT0E 4KRWA 2ABLA 3OFFA 2COWA 3DI6B 1VIFA 2JRSA 4C92F 1BK2A 3RMQA 2PE8A 5J1EB 4MKBA 3CPWP 1TUVA 2N3LA 3VS1A 1S1TB 3CCVT 4G1IA 2MJNA 4ZVHA 4O3OA 4DQPA 4Q0BB 1BQMA 2M52A 4OZ3A 3B54A 4GKJF 3G71A 4JI2F 3CMAT 1HNIA 1KC8R 3KLGA 1VUBA 3N5BA 2DR5A 2CPJA 4DFPA 5CZVA 3D1OA 4Z8AA 4WIIA 4MZMA 3DDIA 2V4JB 1QCNA 5FD1A 4ETXA 4PLLA 1KC8T 3Q8UA 5HVFA 1S6UA 3DCAA 1H0HB 2OFGX 3CCLA 1O5JA 2IBOA 1WIEA 2K5IA 4LUEA 2HKQB 2Q6CA 2HHPA 3M8SA 2R7VA 4OYWA 1LNXA 3KG0A 1Y3KA 1AFJA 2HSPA 4OB2B 4HI1A 2G1HA 1ZPWX 4USKA 4U95A 1ABQA 2R8GA 4B3OB 2ZEJA 2QA2A 3LALA 1WACA 2A37A 3TZXA 4CH0S 3L9ZA 1CJKA 4DG1B 4UQGA 3TUIC 4X65F 2BKDN 5ITHA 2DR9A 2J8AA 4DBHA 2I6WA 4YQWA 5DLQE 2DH7A 3EFOA 1C0TA 4WJBA 2FUG9 2L9WA 4MKAA 3O8VA 3CCJS 1YJWT 5LJ3j 2UP1A 5LJ5h 4B3RF 2CVEA 2R5MA 4WCIA 3WVEB 2DHGA 3B4MA 2UXBJ 3VV2B 5A0GA 3L3CA 1YHQQ 2KJVA 2DFUA 5CAAA 2PA3A 3MMAB 3LP2B 3MXHP 1JLGA 4KKOB 4K4VA 1Q86U 4PG6A 3E9GA 3BH6B 3AFGA 5B09A 5KFQA 2FLOA 5IT9Y 3OW2P 4ANJA 5AE2A 4XU0A 1MWYA 1NPRA 1SV5A 3SQGA 3NKYA 1BI3A 2YPYA 3X24B 3EZOA 2J6KA 2O66A 4KO0B 5LL6d 1PWTA 1XN9A 3HPOA 4NI2B 2D0NA 2Z2MA 1VQ6Q 3VCDA 3W9IA 3QZ7A 1ZS6A 4K50A 1E6YB 3D28A 3TR5A 1C0MA 3OMGA 3OQ2A 3GJTB 2D6FA 5LMUF 1K73C 4DV4F 4RNMA 2O5DA 3KOAA 1T95A 1IKYB 3QFWA 1ZSZB 1AA1B 1D0YA 3PZPA 2AGOA 4NZ7A 4L3NA 4WFZA 4MK7A 1O6XA 3P49B 4JI7J 4KV8B 4RUHA 2P8IA 1FKPA 3JCMh 2X7IA 1YJ9Q 4QBUA 1RBOB 1TAQA 1RAGB 3FBBA 1BD6A 2HDAA 1JB0C 3PYDA 1J27A 2JEIA 4ZLLA 5KYUA 2YX1A 2GFFA 3QLHA 4LSNA 4QIEA 3PIOA 3K57A 1KLMB 3KG1A 1ZTWA 4P2SA 1ZBXA 4DSKA 1VC0A 3QYHB 3OR1B 3BKTA 4RTZA 3I9QA 3BS9A 2VG7A 4C0HA 1DJ7B 3HT3A 1ZPVA 1Q7YC 2PSZA 3Q8PB 3EX7B 3Q83A 4AT1B 3HMJG 2M9KA 1IQTA 1EIFA 1G3SA 2H1YA 4RO0A 1URNA 2VOPA 1JXOA 3DRPA 3IRXA 3MOZA 2PUKB 2GC8A 2BR0A 3IBFB 3JSRA 2FVRA 5B0DA 4RTTA 1QUVA 3FZBA 2IM3A 5FRNA 2PDAA 3CE8A 2BMBA 4RPFA 5D4OA 3R9LA 2GVZB 3PACA 4RTWA 5CH7B 1IN0A 1P8GA 3G6VA 2P0KA 5FU6C 4H4KC 5BR8F 4C8QG 1E6VA 1A0NB 2HBPA 2LNVA 3L95X 1S9EA 4YN3B 3PYEA 2Y1LB 4CO0A 2EGAA 1JLEA 4V19X 1DFDA 4HT7A 2VG6A 3MEDA 3PW2A 4C0ZA 2JS2A 3ER0A 1L3KA 5E41A 1HI8A 4M75D 3W5XA 2IM1A 5H1SV 2V2VA 2B7BB 2OFHX 2DY9A 5JXSA 2CGHA 4HVVA 2DD5A 2HVDA 1PIEA 3JXOA 1U4BA 1WG1A 2GNKA 3JSYA 4M7DD 5M9OA 1NMEB 1N5ZA 3MDFA 3CJ0A 1QVFR 3M54A 3MM9B 6FD1A 2R58A 1GCQC 1S49A 2QRRA 3UQSA 3QRPA 3CCUQ 2R7UA 1Q1KA 4DUZF 5A0DA 5CD4A 1MSWD 1WHGA 1NJIC 5HQ8A 3JB9J 1WHVA 1H92A 3OW2A 2KK4A 3CCQA 4KPYA 3NRBA 1QE1A 1U02A 2FRWA 4X64J 4IG0A 1IBMJ 1PAUB 3ME9A 2HHSA 2CXEA 2CZ1B 1UJYA 2OTLQ 1HHTP 4HR2A 1Q78A 2W4DA 1VQ5Q 4A8FA 3NP5A 3VJPA 3GFXA 5D8HB 5L9XA 3LP0A 1GBQA 4ZVTB 5DQIA 2DLPA 2ZWPA 2G6FX 2ACYA 3OXGA 4OI2A 1FMKA 3JTNA 3SD4A 4M75B 1RT4B 2SXLA 4ES3A 2F8MA 2W4CA 2D8JA 3T6JA 1SQEA 2JX2A 1RT6A 5KCHA 4WK3A 3EDRB 2DIQA 3VZIA 4M7DB 3W9HA 5L8RC 1M2VA 1QSSA 2KFNA 2KXFA 2CZVC 5GMKj 4GRSA 1VQMS 2PGCA 2BVZA 2NZ4A 2DRKA 1NHUA 1CQMA 1YIJA 2FC9A 1IRXA 2E4HA 2A6MA 4F7UG 1KN6A 2NUHA 2OAWA 4KPCA 4OP0A 2ADBA 3JCMX 3MUTP 4PFPA 1KD1U 3BEGB 3CC2T 1XNRJ 2QK0A 4DV7F 2RHQB 3WQPA 1RSCA 1U2FA 5KFRA 2RKIB 2RH3A 5THWA 1R27B 3EGDB 4OHYA 3R5CA 4M77G 4OYZA 2BUNA 4XDDA 2RDJA 4DEXA 2CQHA 4MMOA 2D1CA 4DX5A 1YKWA 3QWUA 2KVQE 1HNZJ 2HYIB 2P9EA 2O88A 2GF7A 2Z2ZA 2GMHA 2DNRA 4Q44A 1RWMB 1IJFB 2FYXA 3MPUB 3LUYA 5L1LA 2VXFA 1DAXA 1KC8U 3IRWP 4WXOA 4K2XA 4ESNA 1CS4A 1RAJA 2DXCA 2PU9B 5IZHA 4A4HA 5F8IA 3KK1A 1SPBP 1JJHA 5CQGA 4F7UB 2YKAA 4F0MA 4C98A 1UGRB 4LQ9A 3MUMP 4YDXA 2RU3A 1WQWA 5KT5A 3G1JA 4FF4A 5C25A 1T3LA 1PJ7A 3LANA 2IMWP 1NZ9A 2ECZA 1VQ4Q 4TKTA 4EMKB 1TMJA 4B3SJ 1AWXA 3FVYA 1QKWA 5LSRA 1B99A 1VQLQ 4M78D 1LPLA 3KLHB 2VQFF 4HT9A 2B7CB 4FIBA 2IM0A 1NHVA 2UUBF 2V8PA 1HD3A 4K59A 5ETVA 1RQ0A 1J3TA 4ANCA 1RT2A 2UZAA 3GSDA 2VA2A 1XMOF 1VJWA 1H641 2YQ2A 3MPYA 3H5SA 3FSYA 1HFEL 2GAGC 2GTJA 2YKOA 2HHHJ 4CLTA 4E7IA 4DUYJ 2KEAA 4C5IA 1CVJA 4YB7A 5LJ3f 2HNDA 3MD1A 4QPXA 1IM4A 3ET6B 4U67Q 2W8LA 1EX4A 4ILRA 1B3TA 3KJVA 2MGZB 4JZ4A 2EG2A 3V8KA 4U6PA 2H5EA 1PRLC 2VODA 2C2DA 1TL7B 1RHJB 5DM7Q 2RS2A 2EW9A 4N77A 5IV3A 1WDXA 1N8RR 3UPUA 3ZTRA 1QTNB 1G1XA 2KT3A 3WC0A 3OFGA 3W60A 1HBNA 1JLCA 1JJCB 2WAQD 3Q8SB 1J5OA 2VJUA 4QOTA 3ZTPA 5KFVA 2PMZD 2RHZA 2RHIA 3QFHA 1OQ3A 3I5CA 2RM4A 3NBPB 2YUNA 2CPYA 5CIUA 3OFHA 3OL7A 1NAQA 4M78B 1ZSZC 2QJ3A 1U49A 2CPXA 2JS0A 3K5LA 2E1RA 3C0CA 2CP5A 1OSDA 2OEKA 3DLEB 4QPTA 1UB4A 3C4SA 3R7NB 5GADU 4LVOP 3LPYA 2JZ5A 3GP8A 1YITQ 1RTDB 1YGYA 3TYTA 3CC7T 2EFPA 1KKHA 3OS1A 3DC2A 2HAXA 2CZ4A 1D1BA 1VQPS 4ELVA 2XBPA 3JRZA 1KHIA 3H5XA 3HFZB 1VYAA 1YK9A 5EDWA 1EB0A 3ZZOA 2OGUA 1V1CA 1VQNS 4E7SA 5JVHQ 4CNYA 3OLAA 3GF5A 4NZ0A 3GFYA 4A0UA 3V6KA 4PNOA 4OYBA 2O9VA 3TREA 4ILLA 2RI3A 3WHIA 5D4NA 2IRUA 4JJCA 1AZSB 1AZEA 1X4HA 3IG1B 4TU9A 2DD4A 1PKUA 4PG7A 3V6HA 5E2QA 3ETOA 1W1FA 4RNHA 3ZFVA 1QWFA 3L7PA 1A7GE 1QKXA 2BM1A 1PD0A 2HVIA 1NBEB 1EQ0A 1J2VA 2DNKA 2LDYA 4DXLA 2UUAF 4JV5F 4WZMA 2LCWA 5HY6A 1NRKA 3EH1A 5HCKA 5GANd 1HWKA 4BDZA 4ID5A 1NG2A 3M32B 2LXFA 3C3LA 3CXCR 3A1PA 3M7VA 4Q45A 4JV0A 1D9AA 2N4CA 4DR4F 1S76D 4C92G 4WKRA 5I4MA 5KG2A 2CQ0A 4E7KA 1BLUA 3QAEA 2H54B 2H5JB 1VMBA 4P2FA 3M8RA 4DBFA 2HQDA 5KFPA 2DL4A 3Q8VA 3UVJA 2LQBA 1RT7A 3J7A1 4RW6B 3OYHA 1RP5A 2M88A 2X4YA 3IA0A 4EGLA 3P5TL 4JI5F 4G1QB 2DL3A 5F8MA 2DEUA 3MZIA 1VQOA 4K4YA 4KGXB 4DV1F 3BGRB 3PW7A 2VVKA 3U1MA 2UUCF 1BU1A 2MZ1A 4F14A 5HQMA 2CZ7B 3J80U 5F8LA 4DR7F 1Q81C 2AX0A 5D0EA 1R8OB 9RUBA 4KFBA 2EYQA 5J2QB 3GLXA 3M5AA 3NOGA 2WVFA 3CCET 2VICA 4Q2LA 1KDNA 2QG9B 3RAMA 4B9MA 3CBOA 1FTCA 1MHNA 2VPYB 4PUOB 2CZ0B 4AQYF 2QEXQ 4M5NA 4C8QC 2P9CA 3FEZA 4LIWA 3HL8A 3RKYA 3CJKB 3HRUA 2HLUA 5K8OA 2I2LA 2LFVA 1CKBA 2DNQA 2BZXA 3WZ0A 3MUVP 1OX9A 4XU2A 2ZCFB 1KG1A 3KWMA 4XTXA 1I94J 2LCLA 3TOQA 3OYJA 3NNAA 2AP6A 2DH8A 5L23A 5C24B 4N0AC 3EZUA 2RNEA 2W8KA 4ZPCA 2OMLA 2XY5A 1N33J 1MNEA 4ZPTR 1VQ6S 3OMCA 2YVSA 3OHBA 4P73A 1SCJB 1K1QA 1RT5A 2F63A 1Y5NB 1ZUYA 2IMOA 2EBEA 4WP8A 4A8QA 2RUSA 2AZVA 2VKNA 3FNNA 3A8MB 2GAHC 1TR0A 4LDUA 4LFCF 2DL7A 4NYPA 1RK8A 1VQ8A 4QQDA 4RW9B 2XKOC 4TVAB 3HHLC 5HMWA 2QYCA 4M5DB 2O01C 1AZGB 1S72A 4X4VA 3M1VB 3NEKA 2BBEA 4DPUA 3W2VA 1WPYA 3BV8A 1AXQA 4Y91A 1FRKA 4NLUA 3KLVA 4KGZB 5A2QE 3CCJA 4O44B 4X4QA 1H38A 4PPDA 3BO4A 3M9QA 2XZDB 4EK2A 2DIUA 4H4KA 4A63B 2CWXA 2QLXA 1BMQB 4DSEA 3EG9B 2E44A 1FJ7A 2C2OB 4YHHJ 2RO0A 2K2PA 2W1BA 2YH0A 4HT8A 3SFMA 2FVCA 1FE4A 1BQNA 3I5RA 1DY3A 1RWXB 1AYEA 2Q3PA 1I8FA 4FXWA 1KQFB 1VQ7Q 2JTMA 3RRKA 3A4TA 3QGHA 4M5IA 4BWJA 4CLLA 4Y65A 2MLYA 4RTYA 3CCST 1PKTA 5BYSA 2XS2A 3KUGA 2R7OA 4CLFA 2DR6A 5LL6S 3CCVQ 1FK9A 4QW2A 2K3KA 3W7BA 5EUHA 4OGCA 3R3TA 5GMKa 3OJUA 3PW0A 1VBZA 4L75A 4DR6J 3ILOA 2HIYA 2C0OA 3BSOA 2OO4A 1GCQA 3L2VA 2R42A 3KKFA 2JVVA 4P2MA 4P5NA 1UWAA 5C0MA 1UPPA 3GB0A 4N4GA 5B0GA 3GZ7A 5K14A 1UGQB 3B78A 4CT9A 4EMKC 4JB8B 3DFEA 5KFZA 2XY7A 1KBRA 4FSSA 1FVSA 4C8NA 3QZ9B 3I0SA 1FWPA 5IT4A 1X5OA 1QAJA 5HMXA 1LNQA 4RX6A 3TRGA 3DRRB 4E0DA 1P92A 2HQGA 4C8MA 3IO1A 1IVZA 4ED2A 4FL6A 3NMRA 4P2XA 4GBQA 1NDPA 3HPWA 5J1NA 2QO3A 3MJXA 3QO9B 3F41A 3J7ZT 2UV8G 1UHCA 3NXZA 2CT3A 5IC6B 2FJWA 4TNOA 5GAMg 2YUPA 4FF3A 3GFZA 1N6QA 4MKVA 4CO3A 1O9SA 3DLBA 1GEHA 3BO3A 2C3YA 2V8JA 2OTLS 1IKXA 2YWHA 1VQ5S 1B07A 1U0HA 4ZJOA 4QWDA 1WQ7A 1M5HA 1IR0A 2K06A 3BGLA 2BJDA 4NXNJ 2ENMA 4IYQA 3V6DA 5KFGA 1T11A 1MROB 2B8PA 2DBMA 2GCFA 2X3WD 2GVDA 2I5JB 5HP1B 3PJ9A 4X9DA 4YDDB 2CT4A 1NKEA 4C8YA 3NPFA 4NXMJ 4LSLB 1K73R 2M3DA 4PWDA 1B34B 1JNZB 2Z8QA 3MECB 3NCRA 3VU3C 3OYNA 2CYZB 2G4BA 2W2NP 1R0AA 3U27A 4P75A 3LW5C 1HPZB 4TXSA 4V19J 1IUJA 1REVB 1RAAB 2RS8A 4EMHA 5FWBA 1U1LA 5LSLA 4EWTA 4IDKA 4LF4J 3RB4A 5ECAA 1VLOA 1KTQA 3HT0A 3RZAA 4ECRA 4OHXA 5LT5A 1LXNA 5IV4A 4ZK7M 1NSPA 3F73A 1MMLA 1RTHB 1N88A 2LX7A 3AODA 1KOHA 1FFWB 4LNPA 3M8ZA 2Y1RI 3ZFJA 1L3TA 1GMWD 2EYYA 4OMOA 1Q7YR 4JI1F 3M05A 4CO1A 3M56A 1TS9A 3U1NA 3MEKA 3G6EQ 5GAOn 1M90C 3CNQP 3A13A 2V6AA 1DJ0A 2OPSB 4CC4B 1WSRA 2VONA 5E3PA 3CD6Q 3SI8A 2RI5A 2WSCE 3DOLB 3DLMA 1RL2A 4BC9A 2XYPB 3MURP 2CZ9A 1PG5B 1UZDA 2R2UA 3U1LA 1D1UA 4LDXA 4K5RA 2HQXA 4EBEA 3L09A 4Q7AA 1GCPA 3HHNB 2P6SA 3CPFA 2Z4PA 2P9GA 3HRSA 4J9MA 1XTDA 2VZ9A 2IFXA 1IBKJ 3EPGA 2LDIA 4WTOB 1EFNA 1QW1A 1VQ4S 1XK8A 2KJWA 5CCMA 2NXNA 2JFKA 3MEGB 3M6WA 1VQLS 3IN5A 3CJSA 5CKBA 1UVNA 1VQMA 3Q89A 1KWMA 2HFUA 2QA4G 3E3XA 1RI9A 4U8YA 2CH4W 3Q2TC 5KG7A 1PM3A 3JB9F 3K5NA 4JI6F 1N5YB 3MF5A 1N32J 3UNGC 3TAMA 2ILZA 1WC4A 2XC9A 2Q6BA 4X64F 1BGXT 2MLXA 4KUDK 2YDLA 4CC3A 3JCMJ 4QWCA 3G71Q 1NJIR 3T1YJ 1EJ7L 2Z58B 5CYQB 3A3NB 5F0UA 1G83A 3CCRT 4J9QA 1VCTA 5KFAA 2FB0A 2VBZA 3K8WA 3BPSP 4C92C 4OYIA 3N28A 2KYXA 4J9KA 4ZITA 4UTGA 1IKYA 1Z9ZA 4NE9C 4MYUA 1N34J 3CCLQ 4NYZA 4IRCA 2VDHA 3D1HA 3W64A 4QZVB 1HWLA 4ZA1A 1TL4A 2DK2A 1SL2A 5LJ5d 1QVGS 4C0OC 3IAS9 3U02A 2R2TA 4X62F 5L9NA 1JB0E 1ZM2A 5KG0A 4LIRA 4O0NA 2DJQA 4DOZA 5KYYB 3VGUA 1AUDA 1JLQA 4PAAA 2KRBA 5GMKi 2FL7A 2AJQA 2XMFA 2MQ8A 5IQ6A 3FFIB 4F7VA 3NL0A 3R6OA 1RHRB 3JSBA 4IKFA 4PWUA 5H9FK 3K5OA 2BKNA 2BZ8A 1OV3A 3QJPA 2ALYB 3UDLA 1KLNA 2G0CA 3TANA 2BJ1A 2MEWA 1QAIA 2YWWA 3KDOA 4BB7A 3OY9A 1WF1A 2D9PA 1Z9QA 1PSFA 1WNEA 1HNZF 3PRVA 4Z02A 4XK8C 3DN9A 1E6HA 2RQTA 3Q8YA 4P72A 2DILA 2CPIA 2C2NA 2L9NA 3CCWA 5KFHA 1RI7A 4DV5J 3HSBA 1PGZA 3SZ2A 1NK0A 3JCMd 5IXBA 1CULA 2XMTA 3PHEA 1HWIA 4IR9A 1FWLA 1FWKA 3S1TA 3M30A 4A8KA 1RLQC 2HQFA 2ACMA 4DL2A 1T02A 4P7TA 3EVOA 1WOOA 3EG1A 3OSPA 3FZ2A 2JLFA 1WHKA 2DNNA 1F9EB 2XM3A 4RU2A 1F60B 1RE1B 4WYLA 3HKSA 2DCLA 1OY9A 2EFOA 3AD9C 5ETRA 1NDKA 2JMCA 4ZVSB 2ZOFA 1K8AT 2ROEA 2DO0A 2RD5C 1VIXA 2A36A 4DX6A 1N36J 2NSBA 3VGTA 2FY8A 5KFFA 4I2PB 3SCKE 4FS2A 2WZ1A 1VRQC 3GFHA 2V63A 1GT8A 5K8MA 1S9GB 3CDEA 3M0PA 4ERDA 1QUPA 3PIOQ 1DLOB 2AZ3A 4M63A 1YTYA 2WONA 2NUPA 3MP6A 2BE7D 2J0WA 1PAEX 3A98A 3LGNA 2KSSA 4C8QA 2QLFB 3M9NB 2DA9A 2K7KA 4PQUB 4PKCC 6AT1B 2EQJA 2NUTB 1HD0A 4FVMA 1M5VC 1DTTA 2F4VJ 1XNQF 2VV5A 1S6OA 1VQPA 2HVZA 5M2UA 4CNZA 2DT9A 5J2NA 2XQCA 3NMAA 3V6JA 3J80Y 3OUYB 1Q86C 1KONA 4OI3A 4DV2F 2DGSA 4KAIA 1K9AA 2MMYA 4BE1A 3KDNA 3D3BJ 2IJNA 4YEAA 4I56A 4CT8A 4Z2XA 1HW8A 2CPZA 2VUGA 5GVQA 2ABYA 2V67A 4KC5A 1UTIA 1Y3JA 4XTUA 2FLLA 3JCMQ 2GV1A 2RPNA 2KXHA 4IFVA 4Q8EA 1NDCA 5L8RE 3QIPA 5A8KA 3P45B 3QDRB 5CCAA 2V26A 3ONQA 5HVHA 3I56T 1T03A 4ZCMA 3PO4A 4RR5A 4J5YA 1AWOA 3H25A 2JFDA 1KRPA 3HHLA 4NA2A 2J06A 3PRDA 1DBDA 2KVQG 1T9YA 3E01B 3D5MA 3I55T 4F4KA 1FXDA 3RW6A 1HNVA 2AJ2A 4F0KA 1IHWA 1M1GA 2P2CB 1GMVA 3ADAC 5HAOA 3ASKA 3JQJA 5CKFA 2XB2D 3OL9A 3PX4A 3VVUA 1Q4RA 2DVEA 3EH2A 2J0SD 2K3BA 4USTA 2EVRA 1AHJB 3W3SA 3CPWR 1SC1B 3H59A 1NJXA 2IAJA 3CD5A 2XWYA 3A3OB 2JL9A 1FRIA 5KYXA 1VGYA 3UE2A 4KBMB 4AG1C 1PYSB 3F56A 2DTJA 3KHHA 2D3UA 4HCKA 3PJXA 3J81U 2R4FA 2AIRB 2NSCA 4ECXA 1F1BB 8ATCB 2HQCA 4ED0A 2YWFA 3GR1A 4JBCA 3C95A 3EAEA 3T5LA 2F69A 2CQ1A 2C42A 1G6BA 3POTB 3OTDA 4F7UA 4JS4A 3C2PA 4KT0C 5KFBA 3BR8A 2D9OA 4D8DA 4ZHRA 1Y5LB 3OYEA 4DL7A 2HWTA 1WHHA 1Y10A 4EFAC 2BJ3A 4HACA 1ACMB 3HO1A 2B3TB 1QM9A 3CD0A 2HNYA 2RDIA 2CP2A 4M77A 4K0KF 3DM2B 3EYZA 3CCVS 2DCUB 1ZZFA 4CDIA 1BXNA 1ITPA 1VQ6A 2CNNB 5GAEI 1RCXB 1YIJQ 3OFEA 3TZZA 2GZOA 3PCOB 5CA5A 1NKBA 3LF0A 1C4AA 1HBUA 2KO1A 4N56A 3QJYA 3LLRA 2XI2A 4ANDA 3TQ7P 3SEOA 3NMZC 1XC9A 4TY8B 5AYFA 1TP7A 4RZRA 3QT8A 1WHJA 5KT2A 2GHVC 3OYYA 2BA9A 2DHAA 3QYGB 2MGZA 4OHWA 1Q81R 2O3DA 1UJ6A 1TL7A 1ZA1B 4U7CA 3N0VA 4OI0A 1UGSB 1S1WA 2CFXA 3KYLA 4N7TA 3TWZA 2JEJA 2MKHA 4F8RA 3BDLA 3OYLA 4F0HA 2RJDA 2L48A 1F5CA 2J7IA 2M7SA 4WWSA 4M5GA 1MU2A 1QDUB 5I11A 1YJWS 4X4RA 1SKUB 4ITSA 2OEMA 5A6WA 4J9CA 1ZBTA 3MAAB 4F50A 3PMIA 4LFAJ 2CP6A 2HQ3A 4XU3A 4EBCA 1K1ZA 2X3DA 3TW0A 4OZNA 4IUQA 2NUUG 4ZCKA 4DR3F 2HZCA 4QWAA 4O4RA 2DO3A 3F0NA 4NS5A 1RAHB 5HJXA 5SZTA 2DGTA 4UC4A 5IWAF 2HFOA 2C3PA 4QVZA 4ZP6A 4DPTA 1SJRA 4R8UB 2HQHA 5GANg 1FMVA 1WX6A 2R7RA 1BIBA 2MXYA 4IIOA 4GO7X 2KVIA 1XBWA 4CO5A 3BR9A 1JJ2A 3KK2B 4JI3F 2CPDA 3MCNA 2ZD1A 2ZITA 1URRA 3AY0A 1UDLA 1U1OA 3WIUA 3EFRA 4ALZA 1K0TA 2YUQA 2R5AA 3RRGA 4DPXA 2ERRA 1KD1C 5K8PA 1R89A 4RNFA 4URSA 1TZ0A 4FM4B 3G86A 3X20B 4WKYA 2W9CA 3HM9A 2CADA 1HIYA 2F5TX 4QR0A 3HXMA 3CVKA 2CAJA 3WX8A 2A7YA 2A18A 3MMCA 1W70A 1M1FA 4YHHF 3T3FA 2CQCA 1GK8A 2MLZA 1Y11A 2FTRA 3DYAA 1KC8C 5CQXA 3GBQA 2XSJA 3HVTB 1WTBA 2FJBB 1K8AU 3TVTA 2MQLA 3DOMA 3ENQA 3CD6S 3T1HF 4DCJB 1NEGA 2DGUA 2KG1A 1S1UB 2OTLA 1YZ6A 2UXDJ 1UVIA 5KYWB 4YR3A 4MT1A 5KG6A 3IGNA 1FX2A 1TELA 3DMJB 4DR6F 5L38A 3UN5A 1WC0A 5F3TA 3ISZA 4DL3A 3MR7A 1NM7A 3V8JA 5I3UA 2LP5A 3NNHA 3IM8A 2DKOB 1GAOA 3PM9A 1EX8A 5E0OA 1DRZA 2E5JA 1IHVA 7FDRA 4ZGJB 3NTIA 1UFLA 4ED6A 3PXGa 3KXDA 2CS7A 2EYZA 3V81A 3JSMA 2IM2A 5IT9E 5ETLA 1PSEA 3CCSQ 4RG8A 3H8ZA 4PZVA 4D8KA 2ZBCA 3VAFA 3FC3A 4K4UA 4RWXA 2DRMA 1LVKA 3C6TB 1S7HA 4B9LA 5IS2A 4GVBA 2KG0A 2E5LF 2DF6A 4OYOA 2YRVA 3G4ST 2BE2B 4ESRA 4FZVA 1JQQA 1WTFA 3HKZD 5KTQA 3BYPA 2RF2B 1U24A 2MSSA 3C19A 5C7PA 4C92A 3R2CJ 2YKQA 3SQOP 3OVSA 2R7QA 2YNFB 3G2XA 4ED7A 1V3ZA 4BWMA 1T9TA 2V8DA 4WXWA 2X3XD 2Z56B 3O8WA 2F3JA 3MM5A 3OR2A 3SSRA 2J76E 2NPFA 5GAN3 1Y0MA 2RIJA 3JB9D 4C3KA 4A8OA 3K59A 3I35A 2R8JA 1B7YB 2LT1A 3UF4A 1QVFS 1IKWA 1FT8A 2WOMB 2MZRA 4ZCLA 5JJBA 3UI3A 4A4GA 3EGWB 1IBCB 1ZM4A 2YKNB 4NOHA 3I0RB 2OI3A 2M16A 4LR9A 4ELUA 5HI7A 1TUWA 2MSTA 2XDBA 3QWPA 5DDQC 2YHTA 2HZAA 2A3LA 2EJGA 2LYVA 3NTHA 1YJNT 2RQ4A 1X5TA 2O01E 1ABOA 1IXDA 4OZ0A 2XNQA 1W6XA 5E3RA 1IWGA 1VQOQ 4RJVA 1VI7A 3R6GB 2RQVA 1JMTA 4K4XA 3PVQA 4LRCA 2DPPB 3LD7A 2HGMA 1KEKA 4FYYB 2NYIA 5ETOA 4JZ3A 1KQ1A 1WKLA 1T0TV 1VQLA 3MP1A 1W25A 2DX1A 4PABA 2QL5B 1T3SA 2IRXA 2O4XA 1N5VA 4PXEA 3LPEA 3V4IA 4DA4A 4G3IA 1APSA 4K11A 2YNIB 1JJ2R 4B3TJ 2E5IA 2CQ2A 4E7LA 5J2PB 4IOCQ 4GC6A 4PK4A 3NAIA 3SEMA 3C16A 2LQNA 4DWIA 4PJOD 4A53A 1RUWA 1G7CB 3K0JA 1CJUA 1NSAA 2DYAA 3CC2S 5IHIA 4F7UE 2N4DA 3QMQA 2MPUA 3HSZA 3QT6A 1DTQA 1M90R 4ZIVA 2NWMA 2KRMA 2B5JA 4M5LA 1S57A 3MEEA 4TN2A 3LWLA 2JEFA 2DEJA 3GCWP 2XWXA 3PFSA 2HFVA 1M90T 4XTWA 4P10A 4ECYA 2RMOA 1TMMA 2BKPA 3QSYB 4RUGA 1JXVA 3V7SA 1UJ5A 2QDYB 1YCYA 4S0MA 1QVGA 2DNGA 2IG0A 2DRBA 1VQ8Q 4HHHA 2AJ4A 3QQCD 2BV3A 1Q0NA 1VQKA 5D0RA 3PT9A 2FIUA 3BGUA 4USHA 3JV3A 5GAN4 3TSZA 3EMTA 3L2RA 1HNXJ 2KXCA 5KFLA 4FYWB 2GQVA 4RTXA 3CJ5A 1S72Q 3DRRA 3VAJA 3QJ6A 5I21A 4C3LA 4I2QA 3UD3P 1AT1B 2EK1A 3TZWA 2OHDA 1R8HA 1RACB 4DR1J 4HCCA 1S99A 3MHYA 4BCAA 3EGUA 3CCJQ 2V68A 3TA1A 5CQYA 3G6YA 4BY6B 5GAN7 3GYXB 4PJOB 3HF5A 2HBZB 2LJ3A 1TVRA 4C0BA 5F9NA 1LJOA 1ZBJA 4OHVA 1OQ6A 3CDBA 2OPPA 2HHUA 5ETSA 1WOSA 3IR7B 1O51A 1RTIB 2DPIA 1FD8A 5L1KA 4CZCA 3JSCA 4H4MA 3E1SA 1Q8IA 2CQ3A 1DHMA 3VS4A 1K1SA 4YY3J 2XD0A 3KUEA 4EU0A 4PRFA 2ASYA 2J6UA 1FF2A 2FQQB 1F2GA 1KR4A 1D09B 3G9CA 3OB9A 2F1FA 4CH1A 3LW5E 1PC0A 1RZMA 4F26A 3CCRQ 3NWGA 3NFCA 3QHSA 2UV8A 4TU8A 2B4VA 1FA0A 3MMJA 2OPQB 2DXUA 3OBIA 4RTVA 1PC5A 4C2MA 3L1AA 3MEAA 4DCPB 3OQ5A 1KVKA 4HCBA 3FBCA 2AKKA 2P5VA 1VYUA 4J9BA 1XERA 3QGIA 1UUEA 1VQSA 3BQ1A 2J9DA 2J6FA 3HHEA 3KK3A 5KFMA 1W26A 5F8HA 1U1MA 4I7FA 4IO9Q 4BE2A 4ECZA 4LT6A 2E9TA 1LXJA 3FEXB 2FJAB 2J0QD 1S77D 1JLAA 2G13A 1Y7XA 3ISND 2DGVA 1S1XB 1ZTTA 1XR7A 4DU8A 1M8VA 5KCOA 4R5PB 1QD1A 2EC0A 2RNAA 3H6ZA 1RT3B 4ZVRB 2EVZA 4XU1A 2NXEA 2RHSB 1P6TA 4DOVA 1D1CA 2GQIA 1U47A 4NLWA 5BYRA 3N01A 3J7YI 5HN0A 1IKVB 2XLKA 3OYKA 4IFYB 3J81Y 2IY5B 4WIQA 3RTVA 1OSCA 3EG3A 3VKIA 4NLTA 4M75F 1XR6A 3SDEB 4F36A 2R9LA 3T5HA 3MI7X 2KT5A 1K47A 3JS9A 4DL6A 3FCVA 1LWEA 1UA0A 4BUGA 1RHQB 1X0PA 1UGPB 3AHUA 4USIA 1X7VA 4M7DF 4RWWA 2OSQA 1LWFB 3KMSA 1N36F 5D15A 4K2JA 2XIDA 5HROB 2MWPA 1S6PA 4NL2A 1Q5VA 4OB1B 4C0FA 2BANB 1MWQA 1KVIA 3EGVA 1YIJS 5LJ5g 3H41A 4A4JA 2GTOA 2P84A 3JTOA 4DR5J 2W9BB 3ULHA 4J6YA 2L2PA 1TKTB 1ZQ1A 4C8ZA 1Y00A 3CCZA 5KFWA 1Q82U 3MFHA 3GR0A 2KYZA 3HFKA 3CCMT 1U1KA 3LWHA 4PYAA 1M3AA 4M7AD 2YXLA 3QSUA 3FGVA 1HMVB 2F4VF 1PYTA 3KFVA 1EP4A 2HMAA 4B6MA 2CP0A 2OJ3A 3PMTA 4HL9A 1UTAA 3PO5A 1QVGR 4MTPA 3M8WA 2AF6A 2F2VA 4QW9A 1T94A 3OS2A 3V7RA 3CXCS 1LK7A 1SH3A 2RI2A 4AL7A 1ZZNA 1RHMB 1JXEA 5CYJA 2C0IA 2R8HA 4C92E 2ZPHB 4ZN3A 2Y1IA 3TEGA 4LR8A 4LF9J 4DZ6A 1N56A 1WA7A 2WVEA 3O6QA 4HEA9 3FCWA 4WE1A 2DHHA 2ZUGA 4ES2A 2ED1A 4DFMA 3GU0A 2RA2A 4JJNK 2YNHA 2JSXA 2K6DA 1TKXA 3CO9A 5IM0B 4ZJQA 2OH2A 3H0HA 4ZTJA 2NPIA 2ZAEA 4ETZA 3CCES 1TK0A 3GYGA 3JCMg 1U2CA 5HBMA 2MKSA 3R5BA 2EKHA 2CDRB 1WOPA 2G0IA 3IP0A 3CDUA 3IXQA 4L59A 2H65B 1NZ8A 4AG2C 1TL3B 4J9NA 1EHWA 3D54A 2XU8A 3DHWC 1SUQA 2VUBA 1ZAVA 1G5VA 5GANj 1RLDA 2W2QP 1QVPA 1RTJB 2HLTA 4M7AB 3CCVA 2KDSA 3RBZA 4O3NA 1SRLA 3ENWA 1K9MT 3A8GB 1PSDA 3CMAA 3OYIA 2DRDA 2LXUA 4ZVUB 4F3QA 3X1LB 2HAIA 1AW0A 2JXBA 2CA9A 3DNCA 4XK8E 3OA6A 4R0EA 5E33A 1MG7A 2ZOGA 1SC3B 2KU7A 3TEHB 1LKZA 4AL6A 1YP5A 3MM7B 2GJIA 3L2ZA 4ICLB 4OX7A 3PW5A 4RUCA 3MR6A 2QQRA 4WF9Q 3RR6A 4WBFA 4WZQA 2KBTA 2VFVA 1U5SA 3BB5A 3O44A 2I1RA 4N4HA 3FQKA 1RTZA 4M94A 1L3UA 3MHXA 1OIAA 3UD4P 1VDHA 4O4GA 1R8CA 3HSJA 1PKSA 2YLBA 3CSKA 2R7XA 2D1XA 1CJVA 1YJWA 3BBCA 3HK2A 3I31A 2E7VA 5IC4B 2PIIA 4I2PA 1SI9A 3EWGA 2PFFB 4HKEA 4M78F 2QI2A 2VD3A 3DGPB 3TUJC 4JI0J 2YBVA 4DSJA 1VBYA 4Y6IA 5IT0A 2M4MA 2RJZA 1S9GA 3FUYA 3RU0A 4JDSA 3RNJA 1DLOA 3RKWA 3UO0A 3MP8A 2L3PA 2DD8S 2PNIA 2XNRA 2OTJT 1QVFP 2QASA 1OS5A 1WC1A 2BIVA 3AXMA 5LOQA 1U48A 3WX4A 4OHZA 3M8PA 2LP4A 2ZKTA 4MK8A 4HKQA 4DBRA 3CCTA 2RD1A 1D3BA 3CCSS 3GIJA 4A8MP 3FMBA 2DBBA 1V76A 3QPHA 3FRNA 4OB3B 1CG2A 1UVMA 2R2SA 4K5SA 3KLEA 3M6VA 1MNDA 4H4OA 3X26B 1WHXA 4A47A 3EHQA 2KYMA 2JLGA