1M1HA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group i222
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
182
structure length
182
Chain Sequence
QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 40
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1hA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1hA01
2XHCA 4OBIA 1NPRA 1NPPA 1M1HA 1M1GA 2EXUA 4ZN1A 3QQCD 3EWGA 2OUGA 1NZ8A 4ESNA 4ZN3A 3LPEA 3LD7A 2K06A 3H7HB 2KPPA 3P8BB 2LQ8A
chains in the Genus database with same CATH superfamily
1U4BA 2VC0A 3BSOA 4KY3A 3K5PA 2BZ2A 4F25A 5C24A 4F3OA 4HTJA 5BYQA 3TUJC 1WELA 2P8IA 3I56S 3CD0A 3QGIA 4FYXB 3GU0A 2IM3A 2YKMB 1NDKA 1T9TA 1QAXA 4M5DB 3D68A 4L3NA 5ETPA 3HMJG 3JSMB 4A48A 2FJWA 4DR2F 3NS7B 5L39A 4P2XA 3IN5A 3R5BA 2CPIA 1XN9A 4KBIA 4WP3A 1N34J 4OZ2A 2WB4A 1FNOA 4Y2CA 3B4DA 3GILA 2RILA 1TQLA 1T9UA 2L3MA 1Q95G 2MKYA 2R4FA 3MPDA 3NWRA 2OPRB 4RNOA 2IMWP 1VRQC 1LQ9A 4NXMF 2HHWA 2WK4A 2JVRA 3IO1A 2F40A 5LL6d 3MR2A 1U49A 4UOFA 4JI6F 1OY9A 2M9KA 3CW2C 1GFWB 1XNQJ 1FI4A 3R7SB 1S4FA 5EGYA 2DNQA 3IRXA 3UCZP 1K1QA 2VJVA 4F2RA 3KDOA 2CJ9A 2MJUA 1TL1A 5CYMB 4A46A 4KR0B 4NLQA 4DFPA 1NK6A 1BQXA 3KHRA 4U9RA 3T5JA 4GVBB 1U45A 5HROA 4E0DA 4ZA1A 3RGIA 4IRDA 1MG7A 3L9ZA 3DXSX 2HQFA 3BBFA 3HJVA 4B3MF 1W25A 4LQ9A 4NLDA 2J9DA 1HBOA 1YBAA 3B8HA 3G8SA 2AX1A 3PIOQ 4LF6J 3K5NA 2H1YA 4KGMA 1RDRA 4A8OA 2WW4A 1CQNA 4YFUA 3BN7A 3CDEA 3OL8A 1O0PA 2VPXB 4IH7A 4HH1A 4ZP7A 2ZHOA 3FQLA 4NMXA 1HQUA 2F8HA 4CLYA 1WSVA 1GNKA 3DDKA 4RUAA 2XQCA 2ZH2A 3M32A 1L3SA 1HYSB 2VD3A 1QY7A 3FFIA 5D78A 3AT1B 1FT8A 2ZKUA 3MWBA 5IT4A 3VQSA 3GV8B 2YNGA 3KLFB 3NRBA 2Z2LA 4Y2MA 2YBVA 1WACA 4DV0J 4LF7J 1HLWA 3C6UA 3R7BB 1XMBA 3NCRA 4CIOA 4OLOA 4DS5A 3RB0A 2QO3A 3ZZZA 3U27A 2Z8QA 4JV0A 3DLGA 1N32J 1N5YA 2HLUA 4ES2A 4DPUA 2R7RA 2OSQA 3UO0A 3AD8C 3CTRA 3MZIA 4USTA 3Q22A 1FD8A 5L1KA 4DQIA 1FESA 3FC9A 3SMZA 4TU7A 3MM8B 3GIJA 1XBWA 2ROEA 1YDLA 3RRKA 3TX0A 4NLGA 1UJ4A 3AXMA 4DX7A 2CWXA 5EX3A 1IKVB 3H0PA 3OXLA 3JTPA 3VAFA 4TY9A 4DL3A 5L8RC 4F36A 4BS2A 5DDQC 1KLMB 3RW7A 5H9FJ 2CG8A 4CRJA 5EWFA 3KMSA 4F4ZA 2V9WA 1QSLA 3R2CJ 5E2QA 2LVWA 4DR3J 3OUYA 1FVQA 2BJ3A 3K7RA 3M2UB 5KFFA 3A13A 1N33J 5CYJA 1LOUA 2HSEB 2LMIA 2YNFB 3UDLA 2JEIA 2DRDA 3HHLA 1S77D 2RSQA 2C2ZB 2HHPA 1R0BG 2BW7A 1S6QB 4L72B 5BYSA 2YKAA 2W9CB 2HVDA 4I4BA 1SPBP 4RJVA 3HFKA 2IAJA 2LEPA 3CIZA 2QLWA 5JJBA 1F2GA 4KGVB 2VZ9A 4LBPA 1RACB 1XR6A 1RWPB 5HMYA 2HRYA 1XK8A 2B56A 4OX9J 5KAKA 4YY3J 2GO9A 3C16B 1KOOA 1KKHA 2MXYA 2AW0A 3M2RA 2G0CA 1FJGJ 1T9XA 2UXDF 1RT5B 3CJ5A 1V3SA 4I6YA 2R8IA 1UVJA 2X3DA 2NXJA 2CJYB 3I31A 4NLWA 1NHUA 5T41A 4ZCMA 2W7OA 4WPAA 5CAAA 4ED6A 1D9FA 4JI7F 4PXCA 2DH9A 1APSA 4IH6A 2WONA 3ZZUA 4AD6A 3W2VA 1C1CA 3BSNA 2VG5A 3GYGA 3PJWA 1RT3B 7FDRA 1F9HA 1Q8IA 2DCUB 5DRKA 1T7PA 4CO0A 2DPIA 4C8MA 4URQU 4OJGA 4I2QB 2FLLA 4C48A 2E7XA 1KONA 4OZNA 4W98A 2HQDA 3N5BA 4B08A 3H5YA 4DS4A 1BD6A 4M5LA 4ED7A 3NG8A 5KTQA 3T9NA 3NNHA 4KGXB 2B4OA 1YVFA 3HVRA 1RWKB 4DV3F 3UVJB 1U48A 2EG1A 2A1BA 2GW8A 2IBOA 5KOXA 5LMUF 2J9DE 1DFDA 2IA6A 1FJ7A 1JKHB 1JNZB 4Q44A 3JSBA 3PR5B 3SV4A 3AOCA 3DRYA 2GHWA 2V4JA 4DHVA 5HVGA 3THPA 4MYTA 4Y2AA 2KVQE 2EFOA 3ETMA 2B3TB 3NXZA 4ID5B 1GT8A 3EVWA 3P96A 1AB8A 5EWGA 3PO5A 1QAYA 4ZVQB 3J7ZT 2YKQA 2GGPA 4P2FA 2RQCA 2J9CA 2IA0A 1B3TA 2HNDB 5EHHA 2DR9A 1RTJB 5HAOA 4F4WA 2HFVA 3EPIA 3PW4A 5KFAA 4RUCA 1F9FA 1FEEA 2OELA 3BZQA 4KO0A 4DL2A 4BDPA 1MN7A 2ALYB 2BX6A 2CQ2A 3VVUA 3CDBA 5IQ6A 1XMOJ 1NK8A 4I6AA 1AZSA 4TY8A 4OI1A 3WHIA 2E7WA 3BGRB 2ERRA 2FVQA 3U1LA 4OV6A 3QBCA 5KG0A 2B9XA 2J8SA 1CC8A 5J2NA 4OYPA 1NJIT 4OX8A 2FY1A 1HWIA 3NGSA 2ACMA 3H2UB 1LW0B 3M1VB 1ZM4A 5F8GA 3O1LA 1RT6B 2MZQA 4MKYA 4EI2A 1S0OA 1SQEA 1XIQA 3C2PA 1CJUA 1HR0J 2WVDA 2QL5B 3BGUA 5I3QA 1RAOA 2HIQA 2R3VA 4CWBA 2E1RA 5FJ4A 4WTOB 2EC0A 4AT1B 3EPGA 1YGYA 3K5MA 2PI4A 4MFBB 3SZ2A 1JLEA 1NZ8A 3GV5B 4ESNA 1LWEB 1X9WA 3KOAA 1UETA 1UCNA 5D15A 4B3RF 2W4CA 2J7WA 2EC2A 3TWZA 3DU5A 3HFZB 1EB0A 4YMEA 1XMQJ 4NA1A 2EKNA 3TEGA 2PT0A 4N7TA 3I6PA 3G6ES 4P52A 5IV3A 2K7JA 3TJ9A 3RB4A 5KFSA 3OFGA 5K14A 4HLBA 2J0QD 2AYGA 1B7YB 2LU2A 4F4YA 2V34A 3R27A 1H98A 1MN9A 4FVMA 4Q2MA 1EETB 5CH7B 1K0VA 4EU0A 1TMJA 4O4RA 5HJXA 3MUVP 1M5VC 1VQSA 2MZRA 3NY0A 8ATCB 4Q2LA 3PW2A 1YLXA 1HNZF 2DRAA 1AFJA 1S1TB 3ZTRA 2KT2A 1JK9B 4MH8A 4B3TJ 2BRKA 1T0TV 1YJ7A 5HQMA 1KQFB 2GS8A 3MXHP 4A8XA 4TQSA 1VBYA 2OEJA 4H4OA 3MMJA 4AXIA 5DG8A 1WF0A 1Y5NB 6AT1B 4HTIA 2N7CA 1ZS6A 2HYIB 3ZTOA 1B64A 3DRPB 1JWWA 1KOHA 4ZPDA 1D09B 2XWYA 2EVZA 1FX2A 4LF4J 1XNRJ 4Q43A 3QSIA 1U1KA 5HMZA 5GAEU 3LF0A 1NH7A 1ROFA 2OGUA 3I96A 2NYHA 3UFCX 2VFVA 2J8AA 2KM8C 2GZOA 4J9RA 2ZJPQ 2MZTA 1U24A 3W9HA 3OL6A 1VOMA 4NLSA 4WTYA 5LM7E 3TAMB 4OJHA 4FPRA 4JI3J 4DDFA 4ZIWA 4KKOB 1RYSA 1SJ1A 3QO9A 1EIYB 1IVZA 1LWXA 3PFOA 2QGFB 2WSEC 1P9YA 5LJ3Y 5DM7Q 2OPSA 1R0AB 1HQEB 3C6UB 3ZZRA 3KUHA 2G13A 4ID8A 4ZS6A 2V8HA 4ENOA 3JYTB 1HL6A 2XO7A 2CQIA 4KHPF 2VPYB 3ISZA 1N52B 3AA8A 2ABYA 3LUYA 3N01A 4RWXA 5HBMA 3KK1A 1MMLA 4DV6J 1T05B 5K8PA 4JI4F 4E2FB 4PEOA 4C3KA 4R5PB 1HYSA 1RAEB 1X4DA 2H51B 5KG1A 4QBUA 3PG9A 4MIAA 3AJ1A 2RT3A 2KH9A 1YX2A 4I2PA 1S0VA 3P5BP 4FBTA 1IQTA 4JV2A 2HQCA 3BGFA 2YXLA 1N5TA 5AXMA 1HWJA 4DEZA 2ZH5A 2XYHB 3TA1A 2N4DA 4B17A 3I0SB 2KJWA 2BE7D 4B9SA 1PBAA 4P72A 5F0WA 1TVRA 5KFGA 1S7IA 4CYUB 5F9LA 4P10A 1RT3A 4ANDA 4DV5J 4DFMA 1PJ7A 2L08A 2BE9B 3OUYB 2CQ0A 3MPYA 4O4GB 3KK1B 1ZTTA 3ITHB 1W26A 2CFXA 1PYTA 2CAJA 3IRXB 4K2JA 3DM2B 3PFEA 4UZCA 1FWLA 1TL3A 1WKLA 2OEKA 3BB5A 3FCWA 2G9OA 4NEZA 3W66A 2FVRA 2RQKA 3T1HF 4DLGA 1HQ2A 1FJGF 1DHMA 4JP8A 3QIDA 4NLOA 2FGOA 1RTHA 3SIPB 5LMUJ 3N6NA 2F4FA 3K89A 3CDAA 1VQ8S 2W8LA 1ZAWA 1Y3KA 3IXQA 1KEKA 4LREA 3H25A 2HBQB 1R8AA 2HFNA 4M5JA 1T9YA 4HT5A 2RQMA 3MM5B 5IV4A 1MU2A 2V94A 4GC7A 1X0PA 5B0GA 3AD9C 2CPEA 3DRSA 1WC4A 2UXBJ 2FHKA 2OPQB 3IBCB 1FNXH 3C46A 3LO3A 2P9EA 3MAAA 2EK6A 2DGOA 5KT2A 5ETSA 2CQDA 1HFEL 3QZ8A 4JI7J 1SC6A 5C5JA 3KTQA 3LAMA 4FBUA 2YWGA 3V6DA 1FNMA 1YZ6A 2C2MB 3V6KA 3HKWA 2FLOA 3A8EA 1I6JA 2GHPA 4LMZA 3P5TL 2DNMA 2OPSB 4DV7J 3OFHA 2C2OB 2GVDB 2IM1A 2VV5A 4EO8A 3TZYA 3KK3B 5E33A 2KI2A 1S1WB 1A6LA 2CPHA 1SIWB 1FKPA 2QLJB 2DCLA 4LFCF 3OD2A 2WW8A 3DMJB 3D2WA 2FD2A 3G71S 2LQ9A 1U1MA 4RO0A 3G86A 1S6PA 1MU2B 2I0XA 5DS7A 3CJKA 1LK5A 4RBUA 2APOA 4MTPA 3EX7B 4DV5F 1RWWB 3BEGB 5C7PA 2KU7A 2CQPA 2OUGA 4EFAC 1PILA 2CWKA 4OI6A 4X64J 1WJ9A 2BJ8A 1RT4A 5IT0A 3CCQS 2QT7A 3CJSA 4C0HA 1SJFA 2UUAJ 3BS9A 4R8UB 1F1BB 1FDDA 3D0HE 2WBRA 4QYRA 1WF1A 4R0EA 5ETVA 5B0FA 4CP5A 4C11A 2MEWA 2K1RA 3MEEB 4KTQA 2HW3A 2HZCA 1UW9A 1VRUB 4DBQA 1KD1T 3AOAA 2WRMA 2B9EA 2P6SA 4DV6F 3D4JA 3NLCA 4B02A 5LMNF 2MY7A 3HJFA 2OPPB 3BM7A 2H4YB 3M8PB 4O0IA 3VAJA 1LFPA 4DR5J 4IQXA 1E6VA 1MROA 2WOMB 1NUEA 3A4TA 1S1XB 4QWCA 4C8KA 4ZIVA 1YBTA 1U1PA 1N5SA 3UN2A 1H74A 1NPKA 1YSJA 2A18A 1QVFR 3SFGA 4GC6A 3EUNA 4LRCA 2GMHA 4G6VB 5DETA 5G0RB 3C15A 1OPZA 4EYIB 1NK9A 1H3DA 4H54A 4DQQA 3M2VA 1ZM9A 3CC7S 2DHSA 2Y8WA 3W2WA 5B0EA 3RTVA 4KE5A 3I4HX 2UUBJ 1WORA 1Q78A 1YJUA 4G1IA 3EE3A 4MFBA 5DDOC 4ZVTB 1VI7A 2UUAF 5DDRC 3DOMB 3QT6A 2V2QA 3KUGA 5D4OA 5AE3A 3KLHA 1XNRF 4QWDA 2XHCA 4ICLB 3LGMA 4AQYJ 3KLGA 3BKTA 1FHTA 2NREA 3SDEA 5KFBA 2OFGX 5LSOA 4DSKA 3M4XA 5B0AA 2MYFA 3ZFVA 3MM9B 3WBZA 2HK2A 3LANA 4GKJF 1WG4A 3H5SA 1FWPA 4LT6A 4ZVPB 3VF0B 3R6LB 1HNZJ 2V2ZA 3EZUA 2BBEA 3KKFA 5M2UA 4LF9F 1FRMA 3E8OA 1IQZA 2L9WA 5ETNA 3D28A 4YQWA 1TUGB 3DKDA 4QR1A 5ETQA 4QWBA 3IRWP 5CHCB 4PG6A 3MM7B 4WYWA 2V4QA 4KYZA 3Q8UA 3DLEA 3KNGA 2KKHA 3I32A 3L7PA 4X66J 3IAM9 2JC1A 4FZVA 4P74A 5F41A 4X4TA 2AJFE 4M5GA 2PIIA 3AQPA 1JLQB 2KG0A 1SBRA 1AYEA 2G2YA 3LTOA 4ZVFA 3X3UA 2E44A 2C1EB 3UCGA 2RJZA 5KT7A 2EKYA 1FRLA 3LP0A 4RW8A 2C42A 2MDAA 2W4PA 2ZE2B 5HQ8A 3M9MB 1BMQB 1MMDA 4K4YA 2CJBA 3T3FA 2XMKA 3KLHB 2JVOA 4DL5A 1TL5A 2MTLA 4J9UE 3OXGA 5D6GA 1N4LA 1S1TA 4DR2J 2RUGA 1X5OA 2MQQA 1MMNA 2HKEA 2IC3B 3HHDA 4QYZJ 2QV6A 3DRRB 2XMUA 4OYAA 3S1TA 4K5SA 2IAJB 2YX1A 3GFZA 3W62A 3J80Y 3OW2R 5HO4A 4TN2A 2W9CA 4ER8A 2ASLA 2IC3A 4M5HA 4PG4A 1D9DA 2UXCF 3IWNC 5DGAA 3BBCA 2W7AA 2WBMA 3ZZOA 4XO0A 1G3OA 2K3KA 4QOTA 3T1HJ 3HVWA 1UA0A 1YWXA 3ILJA 4K0KJ 5DQGA 4CTAB 4ZLJA 2HMIA 1XTZA 4OHXA 3M8RA 3NMRA 1KFDA 2N3LA 4RW8B 1Y00A 4FPIA 4KPYA 1IJEB 1DAXA 2EFNA 4O23A 3G9CA 4QWEA 2AJ0A 3KJQB 1NJXA 1YKWA 3G8QA 2DXFA 3ZNUA 5GMDA 1RTZA 3AD7C 5J2PA 4UY85 1RAHB 4Q0BA 2AF6A 3MEEA 3JTOA 3TVZA 3J81j 2W9AA 1NSKL 2QMWA 4AL7A 1HNWF 3E2EA 3ILOA 1G2EA 2B5JA 3MEDB 3CCTA 4HACB 4K4WA 3DC2A 2NPFA 2XLKA 1NHKL 3O3LA 3I87A 2DNKA 2QLXA 3C14B 1L3UA 3ENWA 3TAQA 2DJWA 2V0NA 4YB7A 4PPDA 5CYQA 1IM6A 3TYTA 4JI4J 4QIFA 2DR8A 2JFKA 2CQ1A 3D3BJ 3VGSA 1X5TA 3WIVA 4ZVRB 1LNQA 1NSAA 1SUQA 4J9KA 4DPTA 2LKZA 2E9RX 1RHUB 1Z1ZA 2NXCA 3OTEA 3QRRA 3KWMA 1VQ9S 2W24A 3F44A 4W92B 1FKOB 4PKDB 1ZM2A 3D1QA 1FXLA 4ZCKA 2MMYA 3QATA 1FTRA 4Y28C 4OX6A 2QIFA 5KFMA 1TKDA 3R5GA 4QWAA 2F5GA 4J5OA 1WKKA 3G8TA 1T8EA 3RBDA 4I64A 4DR4F 2XS2A 4KT0C 4X66F 3T5LA 2R42A 1N32F 1RAIB 3OHBA 3BDPA 4WIIA 4NX9A 5CYMA 5E5NA 4L76A 1SJ3P 3N6LA 4Z7YA 3X1LB 1CLFA 4NA3A 1DBDA 4U8YA 2VBWA 3EM1A 3CO0P 1XR5A 3RUBL 2HFUA 3ZC4A 5IWAF 4R5PA 3J81Y 1VQNS 5ADZA 3DLEB 1B70B 2UUWA 4B9VA 2IJNA 4UQTA 4X4PA 5CXTA 3FZBA 4DU7A 5KT4A 4PQUA 1S12A 2RD5C 4PZVA 4GKJJ 1IBLF 3GJTB 1RBLA 2DHGA 3EXYA 5KFNA 3J7YU 4OHVA 1IKYB 1N33F 3QIPA 1VC6A 2U2FA 3VV2B 1N8RT 2R8HA 1U1LA 2M7SA 2XSFA 3CJQA 1BLUA 2LQJA 3W9JA 4KKOA 1TUWA 2ZM6F 4MT1A 3HM9A 1XMQF 4WF9Q 1OS5A 2MZ1A 2KG1A 4QR0A 3JSRA 4WE1B 4WP8A 2CJQA 2FQQB 1C0TB 5I3UB 1VRTA 3W7BA 4CLLA 2E29A 2UVRA 4N5SA 2VBYA 1T11A 1S6QA 2E1AA 5E41A 4G1PA 3NGDA 3BH6B 2NUHA 4QW9A 3HVAA 2KB2A 1VC5A 1F60B 1FCAA 4G65A 5AJ3F 3UDCA 2W2MP 4GO5X 3GG1A 5GMEA 5M2PA 5LMNJ 4NZ7A 3M6UA 1HNVB 1DTQA 3R5AA 5KT3A 4DV2J 4CO1A 1I1GA 4CH1A 4Y34A 5L9NA 4ZOSA 2ZVSA 3MFHA 4F50A 2AGPA 1RYRA 5JUMA 2YX7A 2WVCA 3CUNA 3IGNA 3N79A 4Q8FA 3OR2B 2ASDA 3US5A 1KQSR 2PGCA 2GO8A 1TK8A 2E66A 1REVA 2MKHA 2P9CA 5KT5A 1TP7A 2BE2B 2CDRB 1MWZA 5FIIA 5IFMA 4X4UA 3CCWA 3QWPA 4DWIA 4J9MA 3MTKA 5I42B 3MR5A 4C9DA 4RX6A 1NPPA 1NLKL 1AXQA 3IS9A 2ZUAA 4L75A 3VQTA 3O2IA 1Y5LB 2MKJA 3PR4A 1H2VZ 4CLWA 5LXRA 3T5KA 2AEFA 1V6HA 3W61A 4CLZA 2HNZB 2BXJA 1VDHA 1B7FA 2QYGA 5J1EA 2ZC3A 3O44A 4K4TA 5L1LA 4USMA 3Q8SB 3RRGA 4Z37A 4IO9Q 2VASA 3Q2SC 4OV1A 2XMJA 4P9SA 1V3RA 3Q24A 1MSWD 1FFWB 1UWBA 3EVOA 3AB2B 3ILIA 1NZAA 2ZOGA 3PEJA 3NNAA 1ELOA 1EARA 2GA7A 1WC5A 3TUZC 4X4RA 4OI4A 4CM0A 1CS4A 1RBAA 2EI5A 2CDQA 2NUUG 2X1BA 3V4MA 3ZZPA 1T03B 4ZLNA 1HW9A 1GTEA 3FRYA 4NLUA 4P6QA 2VQFF 1REGX 3M8YA 5D0HA 4UTGA 3VHQA 1TV6B 2IJRA 1JLGB 5GAGI 3FK4A 2DGTA 2FZKB 4UY8T 3N6MA 3D9BA 2V6AA 3MMBA 4LSNA 2DR7A 4V19J 3W60A 3NGRA 5GVQA 3E01B 2DHAA 2E5GA 3AXKA 4NI2B 4FYYB 1BQNB 1CJVB 2YKPA 2H9ZA 2BKPA 2O3DA 2VB6A 3GSIA 3PYGA 4H4KA 3SCIE 4CO2A 4X4QA 2W9BA 2LDIA 4OYZA 1EQ0A 1M5HA 4A8SA 2ZE2A 4ZN3A 1QLNA 2YY3A 4FXDA 1TL3B 3ENQA 2XZTB 1PJ5A 4I69A 3RBXA 5CYQB 5D77A 3ZZYA 2ZBRA 5DLGA 4F0MA 3KLEB 3OFFA 3OHAA 3A3PB 3VVTA 2LECA 1GXTA 4QYZK 3LPYA 4NYZA 3MCMA 4K2XA 4KAIA 4AUKA 2ZH3A 2VL1A 3DYAA 3CSKA 1EJ7L 5HATA 4UUWA 3OL9A 4LRBA 1H2TZ 2GQQA 3KJFB 4HHHA 4HT7A 4C3LA 1FERA 4C2MA 3NAHA 2ZHBA 4WKRA 4MAKA 1ULRA 2HRTA 2YKMA 2BJDA 2QJ3A 3BR8A 2GHVC 5A0YB 1FTCA 3VAGA 2YQ3A 3HT3A 3EGZA 2PFDA 3KLGB 5J2QB 1URRA 4PWUA 3VWSA 2EK1A 1CJKA 1VJQA 3UDEA 4U95A 2H5JB 1TUVA 3B54A 1WDDA 3TW0A 4PABA 5HP1A 3GYXB 1LW2B 2GMJA 2ZEJA 1R31A 2EEYA 4ZKAA 3NMAA 3UWTA 2VONA 4XK8C 2HAIA 2LYVA 4HDGA 3TA0A 2XMVA 1J5OB 3GIMA 3MDFA 1WEXA 3HT0A 1NB7A 1L3KA 2WCXA 4PCQA 2VOPA 4PG8A 2BYCA 4MIWA 4WKYA 2DGXA 2BJEA 1PJ6A 4DL0C 4A8FA 4ITSA 1M1GA 1NMEB 2CQ3A 4A47A 4U67Q 2M4MA 2Y1IA 3WC2A 2KHCA 3FBFA 1A0OB 2YPZA 2EFPA 3DLKB 3MPVA 2ZBPA 3LP2B 2W2NP 4IOBA 2QX0A 1NJYA 1PAEX 3UD3P 2BANA 2BRLA 1HMVA 1MWQA 3WZ0A 2HHHJ 5KFEA 3KHLA 4QW8A 2PFFB 4ECVA 5MLCV 1Q0NA 2AMCB 2ZM6J 4H4OB 2HNYB 4TU9A 3AOBA 4QCLA 1K1SA 2OHDA 2RDDA 1S7HA 2VG5B 4M8LA 4LF4F 1GH8A 4I67A 4EEYA 3MMCA 1UPPA 4RPFA 1D9AA 1FXDA 2QLFB 1JLBA 3W8GA 5KFPA 4WFBQ 4J9OA 4PR6A 1Y11A 3CDUA 1RU2A 1E6YB 4M95A 2BKOA 3HSDA 1Y0HA 2UZAA 2V50A 5DQHA 1M5KC 4B3OA 3SYZA 1VQ5S 4DZDA 2NCKL 2EXUA 2ZJRQ 1RA7A 4CM2A 3C16A 3MCSA 4IG3A 5F8MA 2UUCJ 3MM8A 1U6FA 3D66A 2UP1A 1WNEA 1UKUA 2J76E 1N6QB 3CCES 1VQLS 2Z0GA 3IWLA 4NASA 1WKJA 3KHGA 1U2CA 2CKWA 1T3OA 3VGUA 2KVIA 4IG0B 4U96A 2QN6B 5KFZA 2XO6A 2FVPA 4CNYA 4NCAA 5E3AA 4JI6J 5FDLA 4AQYF 1RZMA 3TUIC 4AYBD 4NOHA 3SQOP 3LA0A 1J5EJ 4NPOA 4OYMA 5B08A 1D0EA 3VZIA 3PEHA 3B78A 5KOWA 4ZLLA 2XEXA 5B09A 1SC4B 4M94A 4Q7AA 1O8BA 2MQPA 1PC4A 2XNRA 1BXNA 4WFZA 3CD6S 2J7UA 2JEFA 1D8YA 4PAAA 4X2BA 2G1DA 1Q82T 2V2KA 1ZM3A 5HMXA 2DIVA 2G4BA 2BW2A 3MHYA 1L3TA 4F4KA 1GMWA 2FJXA 4MJKA 1HR0F 2RE1A 2GQ2A 2WVFA 4BWJA 4J9PA 2FHJD 3C6TA 3UR0A 2M5YA 3CCMS 1RT1A 3KK2B 2GJ2A 1HNIB 3Q2TC 2HWTA 1RLCL 5DJBA 4PXEA 5HANA 1IXKA 2J7KA 2JLFA 2N4CA 4KGZB 1UFKA 5C2CA 3POTA 2UVWA 2WSFC 3HVTB 1Q53A 5F8HA 3G96A 1DQ9A 2A2DA 3W8PA 1F9EB 3I55S 4ZHRB 2OAUA 1T95A 1YJNS 2VG6A 1JLFB 3G82A 2QFIA 4NLYA 3M05A 2FUG9 2B9WA 1RT5A 3MUMP 3M2VB 2UUTA 5EX0A 4B9MA 4P7TA 2MLZA 3DGPA 5KFIA 2W9BB 3PACA 3L4BC 2KZMA 4DFJA 1JJCB 1U1RA 4Z7CA 1ZZNA 2E1MC 3THTA 2NZCA 1FVSA 1BUXA 1HBNB 3MMBB 1N36F 1LWCA 3DGPB 4RW4A 2K3IA 4LQ3A 4LFCJ 3GB0A 3S7RA 4DL7A 2BEFA 1Y9OA 1SB6A 3I9ZA 3SSRA 2B7CB 4DPYA 4L6V3 4ES1A 1QVGR 2XZDB 2JEGA 2AJ1A 3P49B 1X4GA 1R8HA 1S6UA 4DSFA 3CMAS 3P4UB 5B0DA 4OI0A 4RW9B 2UXCJ 1Q8KA 4ID5A 3V6DB 2LA4A 1Q5VA 3EJMA 3EDRB 3R7NB 2UUBF 1QUPA 3TI0A 1S1UB 3M9OB 1HW8A 3DRSB 4HDHA 2JEJA 1IKXA 1ICEB 2DD8S 1URNA 2POKA 1EP4B 5AJ3J 2VFUA 1FJCA 1N0VC 3CT9A 3M2RB 3KUEA 5F3TA 3SQGB 3TR5A 4NRTA 3TJAA 4DX8H 1SL2A 2FY8A 2NS1B 4TY8B 4ILLA 2QL7B 3CNQP 1NNDA 2O67A 1RB0A 2DTJA 3AY0A 4ICLA 4OHZA 2BV3A 5CCMA 1YBUA 1OQ3A 3GJQB 3CULA 2ATCB 4C3MA 1UZDA 3KG4A 3EXCX 3TEHB 1FK9A 1JJHA 1UJ5A 4ED2A 3CB4A 3IR6B 5B0BA 4YR3A 4CLFA 3SSSA 2VA2A 2MGZB 2B9YA 2CNLB 1M1KT 4RR5A 2UU9J 1X7VA 1S1UA 5IXUA 2JC0A 5L1JA 3KNAA 2IJFA 1RADB 1TU0B 4IG0A 2EG2A 3MCNA 4O44A 2P6TA 4YN3B 5DZ6A 3W5YA 1QSYA 4OL8A 3KFWX 2R7SA 3H4BA 2M8DB 5HVHA 4K4ZA 5HL7Q 4DF4A 3CMES 4ZN1A 3SBMA 3PTWA 1LEOA 1XC9A 2AJQA 3V4IB 4F04B 1NKBA 2LDYA 5CCLA 2BJ1A 5BXIA 1C0TA 2HS4A 3MPUB 2CPJA 2K06A 2PMHA 2WAQD 3LP1A 1JQGA 3QRPA 2FPHX 2KFYA 4KSEB 3MR6A 3W2VB 2LQ8A 2IPOB 2XG8A 2OFHX 2Z4PA 4WFYA 1UA1A 4R8UA 3FGVA 2GX8A 4ZVSB 4YDXA 5K5MA 4JV5F 2C3UA 3V2UC 1ACMB 2LXUA 3JYTA 4H4MB 2ZDPA 5CZXA 2VODA 3AODA 4O3SA 4USKA 4JUZA 4TNOA 3BGLA 1RK8A 2XY6A 3QFHA 2E5LF 1VQYA 3LP1B 1QUVA 5A6WA 2XI3A 1B0TA 2FDNA 1KTQA 3QGPA 1UVLA 1HHSA 4O3NA 1Z2ZA 4U7UK 1TAQA 2YWWA 4LVOP 2VUGA 3HPOA 1RSCA 1UTAA 5CZVA 4DX5A 3UI3A 4JI8J 1EQMA 2R2RA 1JLAA 4A0TA 3BKUA 1W7WA 1F0XA 4DR1J 2NPIA 2XI2A 2IY5B 2XULA 3MF5A 3DLBA 1OYEA 4DZ6A 4IFYB 2DGVA 3R2DJ 2LQBA 2YVSA 5J2QA 4M1KA 4IDKA 2C2NA 4DSIA 3AH6A 1AROP 2FJEB 2R7TA 3Q8PB 1ZA2B 2ZC4A 2ZD1A 1HNWJ 1JNRB 2W8KA 3WC0A 1R0AA 4B3TF 4HKQA 5C42A 1JXVA 1YZ7A 2E5HA 4IFVB 1FA0A 3DU6A 1XR7A 2DNHA 3POTB 3Q8RB 4RL1A 1J27A 1NXIA 1MW7A 1U2FA 3A1YG 4C0BA 2GFFA 2RVJA 5JVGQ 3JQKA 3PYFA 4DV7F 1I94J 2VBZA 3EDQB 1XNQF 4JYAJ 2ZH8A 1WTFA 2FJBB 1IBMF 3D0IE 2BACA 4DR4J 1N88A 4ANEA 2VOOA 1VLYA 1Y5IB 1ZAXA 1YK9A 3HSZA 2JJ4D 2QG9B 4U7CA 5GAHU 1KQKA 3HZEA 2XYGB 2DNPA 3CPWR 2DBBA 4FS1A 3QAEA 4USIA 8AT1B 2KTQA 3LGHA 4E98A 1YRUA 4IFYA 2R2UA 2IDLA 1U09A 5E3QA 1X4BA 4CZCA 2UV8G 3GE9A 1NSQA 4E8UA 4IR1A 4ZPTR 1H7WA 1RKIA 2G1HA 4RW6A 3GIIA 5H9EK 3KLIA 5L46A 4EZ6A 1OO0B 1C2PA 2HMIB 1F3FA 2J9EA 3THVA 1T03A 3NNCA 2K2PA 3K58A 2M70A 3HHLC 5DZ7A 5KFCA 4IG3B 4MKVA 4ZITA 4RU9A 1ZA1B 3S6EA 1PYOB 1RHJB 3GFHA 2F4VJ 3L09A 3QT7A 4ETXA 2ALZA 4RW7A 3RZAA 2HWIA 1RTJA 1XQIA 5IS2A 3R6GB 1BE4A 1RHKB 3UE2A 2A2CA 3H5XA 2VG6B 3G82B 1KVJA 2GNKA 1VBXA 5F8IA 3HHKA 2DGWA 3KXDA 1SV5B 1U2RA 2RKIA 4MK7A 3K59A 3M6VA 1R6YA 2X1FA 2V63A 3HULA 4KQZA 5D4LA 3GMGA 4NYPA 1FDBA 3CXCR 2B7BB 2WVEA 2B6AB 4FS2A 2VPWB 2Z56B 2CNOB 2ZKTA 2H48B 1S9FA 2ZH6A 2CQHA 3I5BA 1PSDA 3A8KA 5DGBA 4DR1F 2EFGA 3BREA 3SXLA 3DLKA 3IG1A 4D3GA 3HSGA 5AXKA 4JI8F 2X1AA 4LRAA 2DGQA 4ECUA 3HKZD 1Y4ZB 2CZ9A 3CIMA 1RT2A 1WC0A 5LT5A 2IVYA 4QIGA 3L3CA 3FEYB 4ZP6A 5BR8J 4DOZA 3CWJA 4A0UA 4C6AA 2C2EA 1BWEA 4FYVB 2DHXA 1PAUB 2H4WB 1B0VA 2JDJA 2PA3A 2Y1RI 3CJ4A 2HEKA 4MKBA 1EX8A 1F6TA 2YWHA 4NZ6A 3BKFA 4OYWA 4ETZA 4DL6A 4CLSA 5H9FK 4N56A 4DI6A 1NM2A 4URSA 5IC6B 3TUPA 4AFFA 3TO8A 4HH0A 2HAFA 3AQOA 5HLFA 4YOEA 2IM0A 2NXNA 3LPEA 4WFXA 2B4VA 1H2UX 1HARA 2VKRA 3OLBA 4OZLA 2DY1A 4HVZA 2AJ2A 2PEBA 2BMBA 3PM9A 3QMQA 1SH2A 4NI2A 2UXDJ 1GAOA 2UV8A 5A8KA 2I5JB 3TJ8A 1O51A 2FJVA 2NLWA 1HBUB 1HD0A 2V8DA 1VCTA 1R7IA 3G6VA 3O5TB 3OPKA 3M8ZA 3ENVA 4LFAJ 4EGLA 1GK8A 3KLIB 1J5OA 2FVSA 3QJJA 2I5JA 2M88A 4LUBA 3DOKA 1UL3A 2NR0A 3UN5A 4WFAQ 5GAEI 3PW0A 3K0JA 4XDDA 5IQQA 2CQBA 2HS0A 3FSXA 1T9VA 4RW9A 2C2RA 4RUHA 3RW6A 4DV4J 1KQGB 1TL1B 5HLFB 1ITPA 2A3JA 5IM0A 2O5DA 2JH3A 1ZYQA 1AFIA 4C8LA 4LRFA 1WEZA 3OL7A 4DR3F 4ZPVR 3W9IA 4J9QA 2YH1A 1U02A 2GMLA 3OQ2A 1OSCA 2D69A 2OKQA 2RU3A 2GAGC 4JOUA 2PEHA 4Y2KA 3SCLE 4J9NA 2VFTA 1QAJA 4USWA 3Q86A 2MQ8A 1UZHA 1NO8A 1AZSB 1BQMA 1RWOB 1TZ0A 1X4HA 3DOKB 3E01A 4J9SA 1WTBA 3QLHA 3KDNA 3N0VA 2Y9HA 3MFIA 1TKZA 2W25A 3ISNC 4G1QA 4TKTA 2V68A 2CIMA 2L9NA 3NKYA 5CA5A 2RF2A 2OLWA 1RAAB 3DRRA 4ELVA 3K2YA 2ZZNA 4NLRA 3GONA 2L9DA 2JZ5A 1NAQA 1HA1A 2OMLA 3ENAA 3HHLB 2EBEA 6FD1A 3OJUA 5T14A 1X0FA 5F8NA 5FDLB 3BBBA 4DSLA 1K44A 1AW0A 3HP6A 3SV3A 4Q0BB 3VR1A 3IP0A 4J37A 3R8YA 4IUFA 1VQ6S 4O3RA 2XSJA 3OLAA 1F3VA 3G2XA 1ZPWX 3LWMA 2VQFJ 4LFBF 1NB2A 5KFJA 2RS8A 2CNNB 2YX4A 1FRJA 2YNHA 1Z4UA 3T6JA 1JLGA 5KFWA 3PKYA 2QEXS 3AB4B 3GZ7A 2V8VA 3MECA 4OX9F 2CPZA 7FD1A 4Y6IA 3VAIA 3FDSA 1PKUA 3RYLA 5HJYA 2OTJS 4KH1B 4UQGA 1HBMA 1CS4B 1KFSA 1X9SA 1RA6A 1UEKA 1QTNB 4K8RA 1UW4A 2GJFA 2YKOA 2ZNYA 2DGUA 4BC7A 3M7VA 4X62F 1REVB 4X62J 4DR7F 3CO9A 4K5RA 2CRLA 1DQAA 2JHEA 2M8HA 1R8BA 2YPYA 4R0JA 2PA8D 2QE5A 3KLVA 2G0IA 4ZVOB 3UNGC 4DR6J 2FTRA 3M8QB 1UEUA 3BF4A 2PI5A 4Q5VA 3ZZ0A 3QJPA 4NL5A 2HNZA 3C19A 3EGWB 3MURP 2KZZA 4PQUB 4WZMA 4CTAA 1RBOB 1HNVA 2KPPA 3LW5C 3Q0AA 3FSYA 1K47A 2BJ9A 2ZBIA 4WWSA 4ED1A 3W65A 2AYMA 2F8EX 4L74A 4WBFA 3RAMA 3SFUA 2RDJA 3GQCA 3U7JA 4BHQA 1S10A 1VBZA 5AXLA 2DNRA 3OSNA 2VQEJ 1EZZB 2X51A 3FEXB 4PPZA 2B4UA 1RUSA 1GTHA 4DXLA 2B43A 3OR2A 3OTDA 2HZAA 4LBIA 3ICLA 4I56A 4RNFA 2B51A 2HHXA 2YWKA 1PG5B 3Q23A 2Z58B 3HX9A 3D6TB 4M5KA 1BHNA 3UNYA 2M2BA 1SJRA 1U1NA 4RNNA 1P27B 1SJQA 1LXJA 2F8MA 3EZOA 4PRFA 1GMUA 3MD1A 1IR0A 4CLKA 3F0NA 3H40A 2G0JA 3VGTA 2D3UA 3LALA 3V6JA 1SQGA 4NEYA 3TVKA 3MEGB 4NRUA 4DMZA 4MYUA 1S97A 1K8AT 1CG2A 3TZZA 4DPWA 2AV5A 2BVZA 4IH5A 2DVIA 4EK2A 3JXOA 4I6WA 2HQ3A 3WQPA 1GEHA 4I1TA 3D5MA 1SI9A 1XWLA 4KC5A 2Z2MA 3PX0A 2JNJA 1HWKA 2MPUA 4DN9A 4DUTA 5KFOA 3FKBA 2AEMA 3U1NA 2NZ4A 4KGKA 3PO4A 3H8YA 4CO5A 1DTTB 3H2LA 3PHEA 3RAQA 3TP2A 4KV8A 1NKCA 2JL9A 1TL7A 5B7WA 3JSMA 3CE8A 2MKKA 3D1HA 3FEZA 3N5FA 1DTTA 4P7VA 1R27B 1S9EB 1ZPVA 2DITA 4OHWA 1F5BA 4CH0S 4LSZB 5KFXA 4CT8A 5LSLA 1K0TA 2YNGB 4B9NA 3HI9A 4L3KA 2ZHAA 1WOPA 3PRBA 3IR5B 3FBEA 1JLCB 1V5VA 3VAMA 3PVXA 2J0WA 1N48A 1SKRA 1N0UA 2I1RA 1S9GA 5J2PB 2ZZTA 2J6TA 4H4MA 1TKXA 2FJAB 3Q8YA 3CJ8A 4F0HA 5T7LB 4USHA 3J80U 4CCHA 9RUBA 2E9ZA 5AE1A 4ZPWR 3HZGA 4NXMJ 4ZVGA 4X4VA 3BPDA 5C2GA 3IM9A 1RLDA 4FNHA 3IAS9 2HHHF 2UXBF 2WTFA 3BO3A 4HL9A 4S0MA 1N34F 4ELTA 4FDFA 1R0CB 4NXNJ 1PBUA 5CQGA 4I0WA 3UPFA 4YR2A 2DKOB 4H4KC 3W64A 4PUOA 1GXLA 1RKJA 1H73A 4BCAA 3WDOA 4DX6A 4CLPA 1SKSA 1X4AA 4IOCQ 5J1NA 2W2PP 1IBKJ 3TQ1A 1BQMB 1S9GB 1DJ0A 1C4AA 2RDIA 4N77A 1VQMS 4U7UD 3EGNA 4MKAA 4C11B 2IYIA 4F3QA 1JLCA 1S48A 3UQSA 4DLEA 2KFNA 3J7Z5 2DRBA 1NDCA 5HVFA 1LV5A 3H59A 2ZBQA 1F2HA 4K4XA 5KT6A 2CA9A 4WXOA 4DV1J 2HURA 2FYXA 2DNGA 4M5DA 1RAJA 3AJDA 1JMTA 4ZP8A 4GKKJ 1AUSL 1CJUB 3GJSB 3MMAA 4EZ9A 1YJTA 2SXLA 1PIEA 1UVMA 3MD3A 1DURA 4ZJQA 1DTQB 2X3GA 3DHXA 1FO1A 2V8PA 2YQ2A 2IHR1 1B4SA 3GSDA 4ZP9A 1FJEB 3MECB 5D3GA 4R25A 2HGNA 3QGHA 1IKXB 2AHOB 1OYDA 3OTBA 1VS3A 5E7OB 2CQCA 1VHFA 1WEYA 4RBVA 3RJMB 4EBEA 3SI8A 5H9EJ 2E1PA 4OX7A 3QWUA 3DRPA 2FLNA 3SDEB 2MKIA 3MEKA 1QD1A 4FYDA 1U8WA 3GWCA 6FDRA 1WHYA 2PMWA 3QRQA 3GFYA 1GXUA 2DR5A 3L7OA 4K7QA 3B82A 1BGXT 3HO1A 3T19A 1WHVA 1N6QA 2YWEA 2BE2A 4OYIA 4ZCLA 2DNYA 4NMLA 3V81A 4ILRA 1W2IA 2IRXA 1KWMA 1NCLA 2RF2B 2XYPB 3OR1B 2QYCA 4I7FB 4OZJA 5FLXY 2K8GA 2F3JA 3QIPB 4Y00A 1TKZB 4G1QB 5E3PA 4ECSA 5K8OA 2HBZB 3MEDA 4HACA 3MM7A 3KMQA 4ILMA 2PSZA 2V4JB 4AE5A 4F4XA 5DM6Q 1Q5YA 1R8PA 3E3XA 4M5NA 1VK3A 1KP6A 1M5OC 2NYIA 1SVDA 2CYYA 4GVLA 1LWEA 4N47A 1HMVB 4EO6A 1RTIB 2B8QA 3BGOP 2JX2A 3IR7B 1JLQA 3BR9A 4MK9A 3F56A 3H20A 2GC8A 2ZUGA 3NWGA 1RWMB 5KFTA 1C1CB 3FUYA 2ZH4A 2ZH7A 5DG7A 2KXFA 2A6OA 2WHOA 3DOMA 4Y0FA 4JI5F 3DLLQ 1DRZA 2DY9A 2E5IA 2NSCA 2UVUA 3QPIA 1WWHA 1HNIA 1WHWA 4LJMA 3BQ0A 1S0NA 1P9QC 3EGVA 1S76D 4YS2A 2P2CB 3FVYA 3JQJA 1OQ6A 3IBFB 4F26A 2YWFA 4WU2A 2U1AA 3GYNA 1TKTB 1LWCB 1Y7PA 3FZ2A 3H90A 3MM9A 4RW4B 2FHMA 2Y8YA 1KHWA 4DV3J 3VGVA 3UN3A 3IGVA 2QSFA 2L48A 4ED4A 1YJRA 4TLQA 3UCUP 2W1BA 4B3RJ 3B4MA 4NE9C 4KFBB 2ZITA 3P45B 1IM4A 2FZGB 3DCAA 9ATCB 2VA3A 2N7YA 2KYXA 3GTYX 1IJFB 1OSDA 1VIOA 3AHPA 2HNDA 5DLFA 2IBKA 2MB0B 3HXMA 4ERDA 1TR0A 2E5JA 3CJ2A 1EAYC 5DQIA 3QT5A 3NS5A 2Y1JA 5SUHA 3QAUA 2EBGA 1LWFA 2Z2ZA 1P1LA 2QLBB 3DI6B 3GJRB 2M3DA 1VBKA 1XJWB 3I82A 5IC4B 1C1BB 2R2SA 3IA0A 5KFQA 5KG2A 5CD4H 2B5JB 1KVKA 1YIJS 1U6BA 2GIQA 1UMJA 4LF7F 2R7XA 1HBMB 4IKAA 1CULB 2RH3A 3V6HA 1PYSB 2VHGA 1VQKS 5A76A 1LFWA 4QIVA 1NK5A 5D4NA 2DXEA 5M2RA 5KG7A 3UD5A 4X64F 2J6UA 1CJTB 3CJKB 4KHMA 2EW9A 3U02A 2HHQA 5IM0B 2HG4A 2I9SA 1ZH5A 5AXNA 3CJ3A 3EMTA 4NZ0A 2HIYA 3GV7B 3CC4S 3K8VA 3W5ZA 2H3EB 2HVIA 1OMSA 1HI1A 2WONB 5K9FA 1BQNA 4IYQA 1CQMA 1RAFB 4OI3A 4X65J 4A8YA 1KSPA 3DHWC 2ZZMA 4TVAB 2OTLS 1M5SA 3HSJA 4LR7A 2D41A 2O1PA 2O01C 2ZWPA 3RBEA 3GG0A 4P73A 5K14B 3SEOA 1K9MT 5FD1A 1RE1B 3MAAB 4UF4A 3ZO7A 1NK7A 1FD2A 4GRSA 1R8CA 2HHSA 2OIHA 2HFZA 3CD5A 1JKHA 1RAGB 3BYRA 4DG1A 1JLAB 4ECTA 3HK2A 3MOZA 4UOHA 3CDWA 1R89A 2FHOB 1MROB 2WOMA 1JB0C 3DLJA 2NXUA 3LOUA 3PJXA 5JVHQ 3T1YJ 2H5IB 4OQJA 1E6YA 5HSPA 2XS5A 3T41A 1VR6A 2D3ZA 1JLBB 4XTTA 5T7LA 2J6SA 1U26A 1NDPA 5LXYA 4LRDA 2RU9A 1KLNA 2YNFA 1IWAA 5F8LA 1KBRA 5HROB 3D6MB 1HHQA 4FNIA 4Q45A 4UT4A 7AT1B 2VFSA 4PXDA 4C8NA 1U0HA 5ETLA 5HBMB 5CABA 4DUZJ 1KS2A 4K4SA 3NGTA 5A8WA 2PMZD 4JI1F 2DO0A 4ZCIA 1BC6A 3D1OA 2RHQB 3OVAA 2VDHA 8RUCA 1U0SA 3K17A 1G1XA 4KV8B 1FRHA 2F1FA 5G4DA 2Y0BB 3W5XA 4ANCA 4C7QA 4JI3F 3M30A 3W3SA 2ZOMA 2OPRA 5ETMA 3JAMU 2YNIB 1FFSB 3OJSA 1NSPA 3DOLB 4OYOA 3F41A 1Q79A 1UVNA 2R7VA 3G6YA 1VISA 3ZNJ1 2J0SD 1N5YB 3MOJB 2W2QP 1I5OB 4CO4A 2IRUA 1WD6A 2JSXA 5GMKa 1X5PA 1YQHA 3GP9A 4OIXA 3CCLS 3V81B 1LW2A 2F7VA 1TKXB 2CZ4A 4P2MA 1F5AA 3CCUS 4DPOA 2LLZA 3DXBA 3K8WA 1G4CA 2C3YA 2ZVIA 3T5HA 2HVHA 4O44B 2ZJQQ 3R1HA 1KTVA 3HFVA 1A7GE 2ZNZA 3CCJS 3TANA 2UVVA 3OXFA 1KLMA 2BOAA 4WP9A 3BO4A 2Z57B 3A8JA 2ASYA 2YQ0A 4WZQA 2MJNA 1D3WA 2XY7A 1IKVA 4K0KF 3GR0A 4WK1A 3G6XA 2A10A 1IBKF 1P1TA 3IM8A 5KFKA 1P8GA 3N28A 1C0UB 5D0RA 3T1AA 2DIUA 2M0GB 2BA9A 4JV1A 4DG1B 2GVZB 2V8GA 3RG6A 1VRUA 3MTJA 1HHTP 5J2MA 2DH7A 1HKAA 1U7LA 1RHRB 2K1RB 2DK2A 3OT9A 3TA2A 3CMQA 1JJ2R 4QJVA 3NS6A 4C98A 1OY6A 1UWBB 2GIFA 5MAOA 4NXNF 1X31C 3RR8A 4YEAA 2Y0SD 3OV7A 1IWGA 1EKSA 2BM0A 3DM2A 2Q43A 4LR8A 4CLTA 3ELHA 3H2VE 3Q8QB 4NCGA 4PG5A 2OD6A 3ITHA 2XLIA 5GADI 2Q66A 3L7UA 1V9OA 2CPYA 2VG7B 4OZ0A 2MHEA 4USJC 5G0RA 2MQOA 2XY5A 3TZWA 4KJIA 4BWMA 4RUBA 3SSQA 4ZPBA 4EBCA 1V5IB 2GVZA 4BLGA 3KJVA 2H54B 2G2OA 4LSNB 2HBRB 2BJ7A 1KR4A 1S6OA 1X4EA 2ASJA 1IBLJ 5JMNA 1KRPA 1TV6A 3NGUA 3RBZA 3JB9k 1N56A 2RAQA 2QA4G 4YHHJ 1VIXA 3ZZTA 1WOSA 3R97A 1YJVA 1RT7B 3V4IA 3RAXA 4LF9J 2X1GA 3PV8A 2GIRA 4IQMA 4WIQA 1S99A 4M5MA 1U1QA 2IIHA 3W1YC 5GAHI 4A8MP 3UW1A 3DRXA 5C25B 2V2VA 4F0KA 1LK7A 2VG7A 2DPJA 3PHTA 3PZPA 2DT9A 2VFRA 3DI6A 2GJIA 2OPQA 4OJ1A 2V4RA 3BO2A 2MGZA 4N8NA 3AJ2A 1Q16B 4MMOA 1ZBTA 1FF2A 5KFLA 2MY8A 1O5JA 2C3MA 2IFXA 3FCHA 4ZHRA 1SKUB 1UAWA 4ZVHA 4YP3A 2N3OA 3ZTQA 2RS2A 3J7A1 1UEVA 4ZJOA 1IBCB 3BSCA 4ECXA 4L73A 4NCBA 2E9TA 3WIUA 1HWUA 3ET6A 1C4CA 4I68A 4XDCA 5RUBA 5GADU 4DFKA 1IBMJ 2DR6A 4LF2A 4ES3A 1S1WA 4HHJA 2VBXA 1H7XA 1VFJA 2HLTA 2QA1A 3JTNA 5A8RA 2VDIA 2IM2A 2YNHB 2FC9A 2RRAA 2BM1A 4LF1A 1RTDB 4C8ZA 1Q7YT 3MUTP 1QAIA 3BGRA 4WYLA 2HHUA 2FJDB 2EPIA 4LIWA 3ADAC 2F63A 1UFWA 2PD1A 4OMFG 5D0EA 5C25A 1DARA 4ECRA 2ROPA 3PJ9A 1HQUB 1YITS 1JIHA 2XLJA 3H98A 4C8OA 4B9LA 2DEJA 2DNZA 4JB8B 1XMOF 1QM9A 5D8HB 1RT6A 1TL4A 3PCOB 3QT8A 5KG3A 2IDEA 4M5IA 4OBIA 2GQCA 1L5UA 4WE1A 4DPXA 4FXWA 2BUNA 1R43A 2LEAA 4URGA 2MKCA 4PXBA 2CVEA 2FC8A 2P5VA 1ZOTA 3K5OA 4N8OA 4K50A 4FVCA 2CZVC 1FDNA 3KHHA 3Q8VA 1N5QA 3GR1A 4DUYJ 2DO4A 4DSEA 3B6BA 1IN0A 1WHXA 3RB6A 2FVCA 2MQLA 3LP0B 2GV1A 1UWAA 1FE4A 5AT1B 5BYRA 1FKAF 5LOQA 3TAPA 1SCJB 1KC8T 2YH0A 2Q3PA 3HHLD 5A8WB 3MR3A 3GIKA 1NDLA 2LQ5A 2XMWA 3HVTA 3MMCB 2CQ4A 3LWLA 1NBEB 2CJKA 3NOCA 2HNYA 4ED3A 1FRXA 3PX6A 1NKEA 1T02A 2YNIA 3QNWB 4A8WA 1DZ5A 1RWVB 1QSSA 3M8WA 2R7OA 1RTIA 3UDVA 1FEHA 4N41A 4NLXA 4DUZF 2HHVA 1RP5A 1RT1B 4NYOA 3IG1B 4HEA9 4CNZA 3KK2A 3QGGA 1LW0A 3M1VA 2XMAA 1WUUA 4C97A 3UD4P 1T05A 2RUSA 2XWXA 4PWDB 5J2NB 4QQBA 2EFQA 4OHYA 2F9DA 1JX4A 2F65A 4LR9A 1WF2A 2KO1A 3LAKA 1FX4A 1WOOA 2Z2YB 4Y65A 4ZPCA 5HK4A 1PCAA 5ITHA 2MKSA 3FQKA 4JI2F 3T1YF 1AUDA 3D3CJ 2HFOA 3ET6B 4K59A 4YB6A 4ZDNA 5C24B 2QMUB 4OYBA 4PYAA 2HVZA 2JLGA 2AX0A 2LA6A 2OSRA 4NA2A 2P9GA 2AWZA 4WXWA 5E0OA 2M52A 2XGPA 4FF3A 2FGCA 3FCVA 4YY3F 1WC1A 4LVNP 3CF5Q 4QU6A 5ETKA 3KLFA 1OPIA 1JJ4A 3R5DA 2NSBA 5A6PA 4DR7J 2DB1A 3FFIB 3ISND 1BY9A 4OZ3A 3TAMA 4F02A 1CPZA 1M1HA 4A8KA 3DN9A 4FF2A 2HPUA 2KJVA 1S49A 2O66A 1VYAA 2XNQA 1RCOB 4PWWA 1GX6A 3FMBA 3I0RB 2MQNA 4RWWA 2C28A 2R8GA 1FE0A 1RWUA 5HQLA 4X65F 4DN0A 5LJ5Y 1FRKA 1T9WA 3NCPA 5B0CA 1S0MA 3DDIA 1H38A 3CD7A 2AEJA 3R5CA 2WVBA 2I8EA 3TNVA 3VAKA 4MIBA 1CSJA 2XZWA 3MMAB 2AQ4A 3GCWP 1UVKA 1HNXJ 2UU9F 2A6MA 2DHHA 2XBPA 4NLTA 1YJWS 3M6WA 4RNMA 1RU1A 2VU5A 5HMWA 2ATLA 2J0XA 3SCJE 2MZJA 1IR1A 4V19X 4C8YA 5DO2A 1CJTA 2V67A 2XCPA 1WDTA 2BANB 3N9UC 4FF4A 3ZTSA 2GAHC 4OYXA 4KHPJ 1NRKA 5DDPC 4UOCA 4CH7A 1TK0A 1ZZFA 3W63A 1RXOB 4ED8A 1PGZA 2HVEA 3BQ2A 2K7KA 4AL6A 1HBNA 3WX8A 4U6PA 2CJAA 3IS9B 1VLOA 4DR5F 3QJLA 4F4AA 2V69A 1AT1B 3CCRS 3SCKE 1U6ZA 5L38A 1C0UA 5AE2A 4TXSA 3EZ5A 5JXSA 4DV0F 4ZPAA 1FRIA 2I2YA 3D67A 3DLGB 4KB7A 4XPEA 3OTCA 4CO3A 2ZDOA 1DQ8A 2RB7A 4O0NA 4IRCA 3MCOA 2DYAA 4QPXA 2VF3A 2MLYA 1SC3B 5ETRA 3MAHA 4FP9A 3IBWA 4GKKF 2BABA 1Q4RA 4ELUA 1YI2S 3J7YI 1F5CA 4KFBA 5LSRA 4ECZA 2CJXB 2KL8A 2OI2A 1K73T 4DR6F 1G6BA 3D0GE 2HGMA 2KHDA 4TYBA 3TVYA 5KG5A 3IMQJ 4LF5F 4JI5J 1OY8A 5A0YA 1X9MA 4CLUA 1NH8A 1HWLA 3BYPA 4B3SF 4OJ3A 1SL1A 1N36J 1JXLA 3RR7A 3MM5A 3BPSP 2DISA 2RRNA 1QDUB 2XMMA 5D3GB 4CDIA 1RJJA 2FB0A 1X4CA 3K5LA 1HI0P 4Q8EA 1NU4A 3S8SA 4YHHF 1MNEA 4IOAQ 1HI8A 5CD4A 1HD1A 1H6KX 2CXEA 3A8IA 1JXEA 4ZVUB 4HHUA 2F4VF 3H42A 4LFBJ 1M90T 2R8JA 4HR2A 3I9V9 2OPPA 2HRUA 2OP5A 3M8PA 2C22A 1IKWA 4EYHB 2XMTA 4G3IA 4UUXA 4OLPA 2HQGA 1ZAVA 2GGPB 3RRHA 3AAWB 3VCDA 3R1LA 4J9VA 4TQRA 1RHMB 3GCXP 4IDKB 1IUJA 3P6YC 3PRVA 3MPWA 3VAHA 3NP5A 3CVKA 3I5CA 4FKXA 2LCWA 2JWNA 4LF8J 1RT4B 1YRTA 4Z2XA 3MGJA 1FWKA 3CCVS 2OMOA 3CCSS 1SJ4P 1CVJA 1S1VA 2KRRA 2LP4A 1CBKA 2LU1A 1X5SA 2YKNB 3AA9A 1D8ZA 1SH0A 3GPAA 3H5UA 3MM6A 1YRXA 4PQAA 1I3OB 1GMWD 4RW7B 2QA4S 2XS7A 1TAUA 5F9NA 4I2PB 1HBOB 2XCAA 3LGNA 2IYGA 1UVIA 1EHWA 4I2QA 4W4MA 3JSYA 2JOQA 2N82B 3Q89A 4YUDA 3M2UA 2FIUA 2XTJP 1KVIA 3T9ZA 1Q81T 4ZK7M 2C2DA 4USUA 1I94F 4JYAF 4DV4F 3PKMA 1Y3JA 1NPRA 1RWXB 2HQIA 2Y3YA 2D7SA 5L9XA 4RZRA 3M8SA 2XB2D 4N76A 3E51A 1FKOA 1H0HB 2QL9B 4XIUA 4HYKA 4P2SA 4C4WA 2UUCF 2AP6A 1ZTWA 1FDAA 2Q6BA 1Z2LA 4B3SJ 2OH2A 4X4SA 4WU3A 4AXJA 4DV1F 2ACYA 4PYDA 4ALZA 1YHQS 2FLPA 1O6XA 3GLJA 1NJWA 2C3PA 3M30B 3FSIA 4QIEA 2KM8B 3AFGA 3EVMA 4D3HA 1KN6A 2QRRA 4B9UA 2V9KA 1TL7B 1VK8A 3K57A 1FFGB 1EP4A 1GX5A 1S57A 1V3ZA 2WZ1A 3NOGA 4U8VA 1R3NA 3GIRA 2W01A 2B4PA 4DF8A 3T6BA 1CEZA 5HP1B 1SC1B 3N4WA 1RABB 1CJKB 1B0PA 3H4DA 1MLAA 4JI1J 3QFWA 2WB1D 3HLUA 5KG6A 1C1BA 2MSTA 4LF8F 2AGOA 4EWTA 4ED5A 4UZBA 1G7CB 1T94A 1VHIA 2E1CA 1T3NA 4FYWB 2E5LJ 1GQEA 2W2OP 5KG4A 1Q8LA 3ETOA 3KG1A 4IRKA 1SL0A 5IZHA 2PN6A 2A0FB 1TELA 3CGIA 4C0OC 3VZHA 2HZVA 1FK9B 1RQ0A 3TX8A 2PO4A 3I4PA 5I3UA 1YJ9S 4XPCA 4OZ1A 1Q1KA 2PDAA 4ECWA 3S01A 3R5JB 4EMDA 3KJVB 1X60A 2OO4A 2OJ3A 4ZJLA 1SXLA 2HWHA 4UW2A 4BBYA 2VKZG 5ETTA 3VTIA 1CC7A 3CEDA 4GVBA 1DLOB 1NK0A 2D1CA 3P3DA 1VQOS 5D4PA 3QYYA 2BQUA 2GCFA 2ILZA 2KT3A 2RMLA 4QIWD 2RQ4A 1Q8BA 2LXIA 2YKNA 1VQ4S 3FBBA 4K4UA 1IKYA 1J2VA 1WG1A 2BOPA 5EUHA 5KFYA 3U1MA 3NL0A 4USVA 1NEEA 4FKYA 2AIRB 2Q1LA 5IT9U 3OTOF 2R7UA 1HIYA 1H72C 2ZOFA 2B8PA 1CJVA 2LEBA 4ZMMA 3M32B 4JV5J 5I42A 1Q86T 5J2MB 1X4FA 4LBHA 4IO1A 1TK5A 4OZ5A 1PO6A 2HHTA 4B9TA 2D9OA 2Q79A 2E7VA 2RHSB 4LSLA 5I4MA 2ILYA 1IKWB 4ECYA 3MEGA 2I38A 5ETOA 3H7HB 2AT1B 5SZTA 3HD1A 4X4NA 1RISA 4O4GA 1KDNA 1IR2A 2Q6CA 3OVSA 1DLOA 1XEZA 3DGVA 4W90B 2KT5A 4F67A 1CULA 1S59A 1NHVA 1WSRA 4V1Ak 2DNOA 2LXFA 4QR2A 4YDDB 4YB5A 5HN0A 2BR0A 3D54A 3M9NB 3PYEA 1OJ4A 5EWEA 1WC6A 1S4EA 4AL5A 2F9JA 3MM6B 1SH3A 4RKUC 4WFNQ 1TFYA 5U47A 2XHWA 2KRBA 1QJHA 1S1VB 2DGSA 4RNHA 5KFUA 2CVIA 1WI8A 3I0RA 4KPCA 4QZVB 2W4DA 3PNIA 1Y10A 5A8KB 4EUVA 3QQCD 1UFLA 4QPTA 3LH2S 2QSWA 4JI0F 2AYBA 2IRYA 2NQPA 4X84A 2R7QA 2R2TA 2EWHA 3DOLA 2RKIB 4FN5A 3HD2A 5GAGU 3BQ1A 2MSSA 1S9EA 1RHQB 3OBIA 1HQEA 1YG0A 2VQEF 1NJZA 1I51B 2JRSA 4DQPA 5F8JA 3G4SS 5HI7A 1EETA 3C6TB 1NK4A 1R6VA 5J1PA 3C14A 3BDEA 3J81U 1PC5A 3OFEA 1UP1A 4TYAA 4WJBA 1ZETA 3MAQA 3ONQA 3A3NB 4UOGA 1SKWA 4FF1A 1TFWA 4J91A 3QLHB 1KHVA 1KNZA 1MWYA 1RT2B 5H1SV 4RBTA 2KXHA 3CJ0A 1HPZA 3JS9A 1U0HB 3D6HB 2XM3A 3IC1A 4LF6F 1UJ6A 1S1XA 5K8MA 2CNKB 4IR9A 2YTCA 4PWDA 1LWFB 4TLRA 4KIAA 2ZFHA 2Y1LB 4LF5J 1U8SA 1VC0A 5THWA 1JLEB 2HGLA 2ADBA 4DSJA 3C8YA 1WC3A 1VRTB 5EDWA 3LD7A 2XSJB 4RLEA 2AZ1A 3G87A 3PDNA 3NBPB 1SIZA 2NXEA 2QTWA 2PE8A 2C2KB 1SV5A 3NCQA 4KH0B 3LQVA 1FXRA 2COLA 2OD4A 2ROGA 2V5HG 3M6XA 2BQ3A 4OFZA 3ILLA 3D7SB 2MHNA 3PX4A 1QTMA 2XGQA 1TKTA 1M5PC 4KHRA 3IFEA 3IWXA 1RWNB 4DL4A 4B3OB 4ZLPA 4DV2F 3C15B 1S6PB 2CPXA 3HHEA 4NWBA 4P71A 4DCPB 4Y3CA 5F3ZA 3OSPA 4JI0J 5EN1A 1FKPB 1QE1B 1Q7LB 5K8NA 5A2QU 1OWXA 2DH8A 2L41A 4KO0B 2HS3A 1E6VB 1SUQB 3MR7A 2D3OR 3R3TA 4O3QA 2WSCC 3M8QA 5C42B 3PIPQ 2ZBCA 1JLFA 2BDPA 2QFJA 2VIHA 1DY3A 1P6TA 4DQRA 1S72S 3P8BB 2HFSA 3CJTA 2D74B 3DNCA 3ZXWA 1LKZA 3DFEA 3MI7X 5E3RA 1HNXF 3C3LA 1A9NB 3LP2A 2ZWOA 2OEMA 3HCXA 4ZVEA 1J5EF 4EBDA 2I6WA 2ADCA 4YR0A 4FXVA 4DUYF 3PW5A 2AD9A 1N54B 1VGYA 2CQGA 3DLHA 4NLVA 5A2QY 3PW7A 2HK3A 4MK8A 3UVJA 3OTOJ 2RNEA 3OR1A 4I7FA 4ATNA 1M0SA 2X7IA 4LIRA 3BJYA 2W7PA 1RCXB 2R8KA 1YTYA 1HBUA 2FZCB 3NAIA 3JQMA 2AZ3A 2AGQA 4DCOB 5L1IA 4HI1A 3FBCA 2CG4A 3FRZA 3A3OB 3NEKA 2AYEA 2CPDA 3DMJA 3L95X 3CCZA 2H65B 5IWAJ 1S79A 1VMBA 2AKWB 2CPFA 1U47A 2MZSA 3TRGA 2KDOA 4F7VA 1WI6A 3KG0A 2B0GA 3V5RA 2MQMA 2R9LA 1VJWA 3ULHA 3O6QA 4O3PA 5KFRA 1RI7A 3CC2S 4F8RA 4LFAF 4CI0B 5IOLA 1OIAA 3TZXA 3F73A 4Y2IA 2HBYB 2BQRA 2XC9A 4K4VA 2BKNA 3BH7B 3W2WB 2DNNA 2VJUA 2IVMA 2YQ1A 3KJNB 2FHJA 4HI2A 3UR3C 2KYZA 2RIJA 2CUYA 2VPZB 4DCJB 3EYZA 4JI2J 4PUOB 2QZ8A 1EKRA 1B99A 1U25A 3GFXA 3KYLA 3RB3A 3DYAB 2D3O1 1TMMA 2VH7A 3FJ2A 2VC1A 4NLPA 4BC9A 3FNNA 1UPMB 1RGVA 1TVRB 4JBCA 4CQ1A 4CYUA 4F3MA 1VQPS 1U1OA 3EICA 2JLEA 3BV8A 2IMOA 2D9PA 5BJRA 5DG9A 2DNLA 3I0SA 2JFDA 5BR8F 3TOQA 3KLEA 1RT7A 2ZH1A 1D1UA 2KFZA 1TTHB 3WX4A 4WCEQ 3A12A 1LXNA 4GMKA 4LSLB 4ECQA 4J9LA 2ZH9A 2IVFB 3OVBA 2B6AA 3ZTPA 4PG7A 3JAMY 3TARA 2AJ4A 3HHNB 2G2ZA 5FLXU 1VQ7S 2C3OA 4CT9A 2AU0A 4J7CA 2Z30B 1QE1A 1RTHB 3DDNA 2VICA 1HPZB 2H5EA 3C66A 4NCGB 4OI2A 2CADA 5K20B 3VALA 1GMVA 4ED0A 5IT9Y 1AA1B 1XERA 3CJRA 4WK3A 4A4JA 5D0GA 2QC3A 4QU7A 4YB1P 1S5ZA 3TQEA 5I3PA 2QA2A 5A8RB 3HDSA 4RU2A 3HF5A 1RTDA 4B3MJ 2RRBA 2LFVA 3QO9B 1WG5A 2QMXA 4X4OA 3D6FB 1X8DA 3I5AA 1N5VA 5E3CA 2R7WA 2KN4A 3BSAA 3RU0A 3QZ7A 2DXDA 3QSYB 4TU8A 3NBPA 3EWGA 3PRDA 3PYDA 4DJBA 2MLXA 4DQSA 3BN4A 1W2BR 3SQGA 4DU8A 1L3VA 4XAKA 4GO7X 4O3OA 5F0UA 2PC6A 4IFVA 3O8WA 1BWVA 2GVDA 2J5AA 3NGKA 3PXGa 4RW6B 3R9LA 3Q83A 2EFVA 3KK3A 2ZD1B 4A8QA 3PY8A 4M63A 3J7AN 2DEIA 5J1EB 4J90A 3FMWA 5KFDA 4KRWA 2KXNB 5KFHA 4P75A 5KFVA 4F2SA 1SQFA
chains in the Genus database with same CATH topology
2XHCA 4OBIA 1NPRA 1NPPA 1M1HA 1M1GA 2EXUA 4ZN1A 3QQCD 3EWGA 2OUGA 1NZ8A 4ESNA 4ZN3A 3LPEA 3LD7A 2K06A 3H7HB 2KPPA 3P8BB 2LQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHC A;  4OBI A;  1NPR A;  1NPP A;  1M1H A;  1M1G A;  2EXU A;  4ZN1 A;  3QQC D;  3EWG A;  2OUG A;  1NZ8 A;  4ESN A;  4ZN3 A;  3LPE A;  3LD7 A;  2K06 A;  3H7H B;  2KPP A;  3P8B B;  2LQ8 A; 
#chains in the Genus database with same CATH topology
 1U4B A;  2VC0 A;  3BSO A;  4KY3 A;  3K5P A;  2BZ2 A;  4F25 A;  5C24 A;  4F3O A;  4HTJ A;  5BYQ A;  3TUJ C;  1WEL A;  2P8I A;  3I56 S;  3CD0 A;  3QGI A;  4FYX B;  3GU0 A;  2IM3 A;  2YKM B;  1NDK A;  1T9T A;  1QAX A;  4M5D B;  3D68 A;  4L3N A;  5ETP A;  3HMJ G;  3JSM B;  4A48 A;  2FJW A;  4DR2 F;  3NS7 B;  5L39 A;  4P2X A;  3IN5 A;  3R5B A;  2CPI A;  1XN9 A;  4KBI A;  4WP3 A;  1N34 J;  4OZ2 A;  2WB4 A;  1FNO A;  4Y2C A;  3B4D A;  3GIL A;  2RIL A;  1TQL A;  1T9U A;  2L3M A;  1Q95 G;  2MKY A;  2R4F A;  3MPD A;  3NWR A;  2OPR B;  4RNO A;  2IMW P;  1VRQ C;  1LQ9 A;  4NXM F;  2HHW A;  2WK4 A;  2JVR A;  3IO1 A;  2F40 A;  5LL6 d;  3MR2 A;  1U49 A;  4UOF A;  4JI6 F;  1OY9 A;  2M9K A;  3CW2 C;  1GFW B;  1XNQ J;  1FI4 A;  3R7S B;  1S4F A;  5EGY A;  2DNQ A;  3IRX A;  3UCZ P;  1K1Q A;  2VJV A;  4F2R A;  3KDO A;  2CJ9 A;  2MJU A;  1TL1 A;  5CYM B;  4A46 A;  4KR0 B;  4NLQ A;  4DFP A;  1NK6 A;  1BQX A;  3KHR A;  4U9R A;  3T5J A;  4GVB B;  1U45 A;  5HRO A;  4E0D A;  4ZA1 A;  3RGI A;  4IRD A;  1MG7 A;  3L9Z A;  3DXS X;  2HQF A;  3BBF A;  3HJV A;  4B3M F;  1W25 A;  4LQ9 A;  4NLD A;  2J9D A;  1HBO A;  1YBA A;  3B8H A;  3G8S A;  2AX1 A;  3PIO Q;  4LF6 J;  3K5N A;  2H1Y A;  4KGM A;  1RDR A;  4A8O A;  2WW4 A;  1CQN A;  4YFU A;  3BN7 A;  3CDE A;  3OL8 A;  1O0P A;  2VPX B;  4IH7 A;  4HH1 A;  4ZP7 A;  2ZHO A;  3FQL A;  4NMX A;  1HQU A;  2F8H A;  4CLY A;  1WSV A;  1GNK A;  3DDK A;  4RUA A;  2XQC A;  2ZH2 A;  3M32 A;  1L3S A;  1HYS B;  2VD3 A;  1QY7 A;  3FFI A;  5D78 A;  3AT1 B;  1FT8 A;  2ZKU A;  3MWB A;  5IT4 A;  3VQS A;  3GV8 B;  2YNG A;  3KLF B;  3NRB A;  2Z2L A;  4Y2M A;  2YBV A;  1WAC A;  4DV0 J;  4LF7 J;  1HLW A;  3C6U A;  3R7B B;  1XMB A;  3NCR A;  4CIO A;  4OLO A;  4DS5 A;  3RB0 A;  2QO3 A;  3ZZZ A;  3U27 A;  2Z8Q A;  4JV0 A;  3DLG A;  1N32 J;  1N5Y A;  2HLU A;  4ES2 A;  4DPU A;  2R7R A;  2OSQ A;  3UO0 A;  3AD8 C;  3CTR A;  3MZI A;  4UST A;  3Q22 A;  1FD8 A;  5L1K A;  4DQI A;  1FES A;  3FC9 A;  3SMZ A;  4TU7 A;  3MM8 B;  3GIJ A;  1XBW A;  2ROE A;  1YDL A;  3RRK A;  3TX0 A;  4NLG A;  1UJ4 A;  3AXM A;  4DX7 A;  2CWX A;  5EX3 A;  1IKV B;  3H0P A;  3OXL A;  3JTP A;  3VAF A;  4TY9 A;  4DL3 A;  5L8R C;  4F36 A;  4BS2 A;  5DDQ C;  1KLM B;  3RW7 A;  5H9F J;  2CG8 A;  4CRJ A;  5EWF A;  3KMS A;  4F4Z A;  2V9W A;  1QSL A;  3R2C J;  5E2Q A;  2LVW A;  4DR3 J;  3OUY A;  1FVQ A;  2BJ3 A;  3K7R A;  3M2U B;  5KFF A;  3A13 A;  1N33 J;  5CYJ A;  1LOU A;  2HSE B;  2LMI A;  2YNF B;  3UDL A;  2JEI A;  2DRD A;  3HHL A;  1S77 D;  2RSQ A;  2C2Z B;  2HHP A;  1R0B G;  2BW7 A;  1S6Q B;  4L72 B;  5BYS A;  2YKA A;  2W9C B;  2HVD A;  4I4B A;  1SPB P;  4RJV A;  3HFK A;  2IAJ A;  2LEP A;  3CIZ A;  2QLW A;  5JJB A;  1F2G A;  4KGV B;  2VZ9 A;  4LBP A;  1RAC B;  1XR6 A;  1RWP B;  5HMY A;  2HRY A;  1XK8 A;  2B56 A;  4OX9 J;  5KAK A;  4YY3 J;  2GO9 A;  3C16 B;  1KOO A;  1KKH A;  2MXY A;  2AW0 A;  3M2R A;  2G0C A;  1FJG J;  1T9X A;  2UXD F;  1RT5 B;  3CJ5 A;  1V3S A;  4I6Y A;  2R8I A;  1UVJ A;  2X3D A;  2NXJ A;  2CJY B;  3I31 A;  4NLW A;  1NHU A;  5T41 A;  4ZCM A;  2W7O A;  4WPA A;  5CAA A;  4ED6 A;  1D9F A;  4JI7 F;  4PXC A;  2DH9 A;  1APS A;  4IH6 A;  2WON A;  3ZZU A;  4AD6 A;  3W2V A;  1C1C A;  3BSN A;  2VG5 A;  3GYG A;  3PJW A;  1RT3 B;  7FDR A;  1F9H A;  1Q8I A;  2DCU B;  5DRK A;  1T7P A;  4CO0 A;  2DPI A;  4C8M A;  4URQ U;  4OJG A;  4I2Q B;  2FLL A;  4C48 A;  2E7X A;  1KON A;  4OZN A;  4W98 A;  2HQD A;  3N5B A;  4B08 A;  3H5Y A;  4DS4 A;  1BD6 A;  4M5L A;  4ED7 A;  3NG8 A;  5KTQ A;  3T9N A;  3NNH A;  4KGX B;  2B4O A;  1YVF A;  3HVR A;  1RWK B;  4DV3 F;  3UVJ B;  1U48 A;  2EG1 A;  2A1B A;  2GW8 A;  2IBO A;  5KOX A;  5LMU F;  2J9D E;  1DFD A;  2IA6 A;  1FJ7 A;  1JKH B;  1JNZ B;  4Q44 A;  3JSB A;  3PR5 B;  3SV4 A;  3AOC A;  3DRY A;  2GHW A;  2V4J A;  4DHV A;  5HVG A;  3THP A;  4MYT A;  4Y2A A;  2KVQ E;  2EFO A;  3ETM A;  2B3T B;  3NXZ A;  4ID5 B;  1GT8 A;  3EVW A;  3P96 A;  1AB8 A;  5EWG A;  3PO5 A;  1QAY A;  4ZVQ B;  3J7Z T;  2YKQ A;  2GGP A;  4P2F A;  2RQC A;  2J9C A;  2IA0 A;  1B3T A;  2HND B;  5EHH A;  2DR9 A;  1RTJ B;  5HAO A;  4F4W A;  2HFV A;  3EPI A;  3PW4 A;  5KFA A;  4RUC A;  1F9F A;  1FEE A;  2OEL A;  3BZQ A;  4KO0 A;  4DL2 A;  4BDP A;  1MN7 A;  2ALY B;  2BX6 A;  2CQ2 A;  3VVU A;  3CDB A;  5IQ6 A;  1XMO J;  1NK8 A;  4I6A A;  1AZS A;  4TY8 A;  4OI1 A;  3WHI A;  2E7W A;  3BGR B;  2ERR A;  2FVQ A;  3U1L A;  4OV6 A;  3QBC A;  5KG0 A;  2B9X A;  2J8S A;  1CC8 A;  5J2N A;  4OYP A;  1NJI T;  4OX8 A;  2FY1 A;  1HWI A;  3NGS A;  2ACM A;  3H2U B;  1LW0 B;  3M1V B;  1ZM4 A;  5F8G A;  3O1L A;  1RT6 B;  2MZQ A;  4MKY A;  4EI2 A;  1S0O A;  1SQE A;  1XIQ A;  3C2P A;  1CJU A;  1HR0 J;  2WVD A;  2QL5 B;  3BGU A;  5I3Q A;  1RAO A;  2HIQ A;  2R3V A;  4CWB A;  2E1R A;  5FJ4 A;  4WTO B;  2EC0 A;  4AT1 B;  3EPG A;  1YGY A;  3K5M A;  2PI4 A;  4MFB B;  3SZ2 A;  1JLE A;  1NZ8 A;  3GV5 B;  4ESN A;  1LWE B;  1X9W A;  3KOA A;  1UET A;  1UCN A;  5D15 A;  4B3R F;  2W4C A;  2J7W A;  2EC2 A;  3TWZ A;  3DU5 A;  3HFZ B;  1EB0 A;  4YME A;  1XMQ J;  4NA1 A;  2EKN A;  3TEG A;  2PT0 A;  4N7T A;  3I6P A;  3G6E S;  4P52 A;  5IV3 A;  2K7J A;  3TJ9 A;  3RB4 A;  5KFS A;  3OFG A;  5K14 A;  4HLB A;  2J0Q D;  2AYG A;  1B7Y B;  2LU2 A;  4F4Y A;  2V34 A;  3R27 A;  1H98 A;  1MN9 A;  4FVM A;  4Q2M A;  1EET B;  5CH7 B;  1K0V A;  4EU0 A;  1TMJ A;  4O4R A;  5HJX A;  3MUV P;  1M5V C;  1VQS A;  2MZR A;  3NY0 A;  8ATC B;  4Q2L A;  3PW2 A;  1YLX A;  1HNZ F;  2DRA A;  1AFJ A;  1S1T B;  3ZTR A;  2KT2 A;  1JK9 B;  4MH8 A;  4B3T J;  2BRK A;  1T0T V;  1YJ7 A;  5HQM A;  1KQF B;  2GS8 A;  3MXH P;  4A8X A;  4TQS A;  1VBY A;  2OEJ A;  4H4O A;  3MMJ A;  4AXI A;  5DG8 A;  1WF0 A;  1Y5N B;  6AT1 B;  4HTI A;  2N7C A;  1ZS6 A;  2HYI B;  3ZTO A;  1B64 A;  3DRP B;  1JWW A;  1KOH A;  4ZPD A;  1D09 B;  2XWY A;  2EVZ A;  1FX2 A;  4LF4 J;  1XNR J;  4Q43 A;  3QSI A;  1U1K A;  5HMZ A;  5GAE U;  3LF0 A;  1NH7 A;  1ROF A;  2OGU A;  3I96 A;  2NYH A;  3UFC X;  2VFV A;  2J8A A;  2KM8 C;  2GZO A;  4J9R A;  2ZJP Q;  2MZT A;  1U24 A;  3W9H A;  3OL6 A;  1VOM A;  4NLS A;  4WTY A;  5LM7 E;  3TAM B;  4OJH A;  4FPR A;  4JI3 J;  4DDF A;  4ZIW A;  4KKO B;  1RYS A;  1SJ1 A;  3QO9 A;  1EIY B;  1IVZ A;  1LWX A;  3PFO A;  2QGF B;  2WSE C;  1P9Y A;  5LJ3 Y;  5DM7 Q;  2OPS A;  1R0A B;  1HQE B;  3C6U B;  3ZZR A;  3KUH A;  2G13 A;  4ID8 A;  4ZS6 A;  2V8H A;  4ENO A;  3JYT B;  1HL6 A;  2XO7 A;  2CQI A;  4KHP F;  2VPY B;  3ISZ A;  1N52 B;  3AA8 A;  2ABY A;  3LUY A;  3N01 A;  4RWX A;  5HBM A;  3KK1 A;  1MML A;  4DV6 J;  1T05 B;  5K8P A;  4JI4 F;  4E2F B;  4PEO A;  4C3K A;  4R5P B;  1HYS A;  1RAE B;  1X4D A;  2H51 B;  5KG1 A;  4QBU A;  3PG9 A;  4MIA A;  3AJ1 A;  2RT3 A;  2KH9 A;  1YX2 A;  4I2P A;  1S0V A;  3P5B P;  4FBT A;  1IQT A;  4JV2 A;  2HQC A;  3BGF A;  2YXL A;  1N5T A;  5AXM A;  1HWJ A;  4DEZ A;  2ZH5 A;  2XYH B;  3TA1 A;  2N4D A;  4B17 A;  3I0S B;  2KJW A;  2BE7 D;  4B9S A;  1PBA A;  4P72 A;  5F0W A;  1TVR A;  5KFG A;  1S7I A;  4CYU B;  5F9L A;  4P10 A;  1RT3 A;  4AND A;  4DV5 J;  4DFM A;  1PJ7 A;  2L08 A;  2BE9 B;  3OUY B;  2CQ0 A;  3MPY A;  4O4G B;  3KK1 B;  1ZTT A;  3ITH B;  1W26 A;  2CFX A;  1PYT A;  2CAJ A;  3IRX B;  4K2J A;  3DM2 B;  3PFE A;  4UZC A;  1FWL A;  1TL3 A;  1WKL A;  2OEK A;  3BB5 A;  3FCW A;  2G9O A;  4NEZ A;  3W66 A;  2FVR A;  2RQK A;  3T1H F;  4DLG A;  1HQ2 A;  1FJG F;  1DHM A;  4JP8 A;  3QID A;  4NLO A;  2FGO A;  1RTH A;  3SIP B;  5LMU J;  3N6N A;  2F4F A;  3K89 A;  3CDA A;  1VQ8 S;  2W8L A;  1ZAW A;  1Y3K A;  3IXQ A;  1KEK A;  4LRE A;  3H25 A;  2HBQ B;  1R8A A;  2HFN A;  4M5J A;  1T9Y A;  4HT5 A;  2RQM A;  3MM5 B;  5IV4 A;  1MU2 A;  2V94 A;  4GC7 A;  1X0P A;  5B0G A;  3AD9 C;  2CPE A;  3DRS A;  1WC4 A;  2UXB J;  2FHK A;  2OPQ B;  3IBC B;  1FNX H;  3C46 A;  3LO3 A;  2P9E A;  3MAA A;  2EK6 A;  2DGO A;  5KT2 A;  5ETS A;  2CQD A;  1HFE L;  3QZ8 A;  4JI7 J;  1SC6 A;  5C5J A;  3KTQ A;  3LAM A;  4FBU A;  2YWG A;  3V6D A;  1FNM A;  1YZ6 A;  2C2M B;  3V6K A;  3HKW A;  2FLO A;  3A8E A;  1I6J A;  2GHP A;  4LMZ A;  3P5T L;  2DNM A;  2OPS B;  4DV7 J;  3OFH A;  2C2O B;  2GVD B;  2IM1 A;  2VV5 A;  4EO8 A;  3TZY A;  3KK3 B;  5E33 A;  2KI2 A;  1S1W B;  1A6L A;  2CPH A;  1SIW B;  1FKP A;  2QLJ B;  2DCL A;  4LFC F;  3OD2 A;  2WW8 A;  3DMJ B;  3D2W A;  2FD2 A;  3G71 S;  2LQ9 A;  1U1M A;  4RO0 A;  3G86 A;  1S6P A;  1MU2 B;  2I0X A;  5DS7 A;  3CJK A;  1LK5 A;  4RBU A;  2APO A;  4MTP A;  3EX7 B;  4DV5 F;  1RWW B;  3BEG B;  5C7P A;  2KU7 A;  2CQP A;  2OUG A;  4EFA C;  1PIL A;  2CWK A;  4OI6 A;  4X64 J;  1WJ9 A;  2BJ8 A;  1RT4 A;  5IT0 A;  3CCQ S;  2QT7 A;  3CJS A;  4C0H A;  1SJF A;  2UUA J;  3BS9 A;  4R8U B;  1F1B B;  1FDD A;  3D0H E;  2WBR A;  4QYR A;  1WF1 A;  4R0E A;  5ETV A;  5B0F A;  4CP5 A;  4C11 A;  2MEW A;  2K1R A;  3MEE B;  4KTQ A;  2HW3 A;  2HZC A;  1UW9 A;  1VRU B;  4DBQ A;  1KD1 T;  3AOA A;  2WRM A;  2B9E A;  2P6S A;  4DV6 F;  3D4J A;  3NLC A;  4B02 A;  5LMN F;  2MY7 A;  3HJF A;  2OPP B;  3BM7 A;  2H4Y B;  3M8P B;  4O0I A;  3VAJ A;  1LFP A;  4DR5 J;  4IQX A;  1E6V A;  1MRO A;  2WOM B;  1NUE A;  3A4T A;  1S1X B;  4QWC A;  4C8K A;  4ZIV A;  1YBT A;  1U1P A;  1N5S A;  3UN2 A;  1H74 A;  1NPK A;  1YSJ A;  2A18 A;  1QVF R;  3SFG A;  4GC6 A;  3EUN A;  4LRC A;  2GMH A;  4G6V B;  5DET A;  5G0R B;  3C15 A;  1OPZ A;  4EYI B;  1NK9 A;  1H3D A;  4H54 A;  4DQQ A;  3M2V A;  1ZM9 A;  3CC7 S;  2DHS A;  2Y8W A;  3W2W A;  5B0E A;  3RTV A;  4KE5 A;  3I4H X;  2UUB J;  1WOR A;  1Q78 A;  1YJU A;  4G1I A;  3EE3 A;  4MFB A;  5DDO C;  4ZVT B;  1VI7 A;  2UUA F;  5DDR C;  3DOM B;  3QT6 A;  2V2Q A;  3KUG A;  5D4O A;  5AE3 A;  3KLH A;  1XNR F;  4QWD A;  2XHC A;  4ICL B;  3LGM A;  4AQY J;  3KLG A;  3BKT A;  1FHT A;  2NRE A;  3SDE A;  5KFB A;  2OFG X;  5LSO A;  4DSK A;  3M4X A;  5B0A A;  2MYF A;  3ZFV A;  3MM9 B;  3WBZ A;  2HK2 A;  3LAN A;  4GKJ F;  1WG4 A;  3H5S A;  1FWP A;  4LT6 A;  4ZVP B;  3VF0 B;  3R6L B;  1HNZ J;  2V2Z A;  3EZU A;  2BBE A;  3KKF A;  5M2U A;  4LF9 F;  1FRM A;  3E8O A;  1IQZ A;  2L9W A;  5ETN A;  3D28 A;  4YQW A;  1TUG B;  3DKD A;  4QR1 A;  5ETQ A;  4QWB A;  3IRW P;  5CHC B;  4PG6 A;  3MM7 B;  4WYW A;  2V4Q A;  4KYZ A;  3Q8U A;  3DLE A;  3KNG A;  2KKH A;  3I32 A;  3L7P A;  4X66 J;  3IAM 9;  2JC1 A;  4FZV A;  4P74 A;  5F41 A;  4X4T A;  2AJF E;  4M5G A;  2PII A;  3AQP A;  1JLQ B;  2KG0 A;  1SBR A;  1AYE A;  2G2Y A;  3LTO A;  4ZVF A;  3X3U A;  2E44 A;  2C1E B;  3UCG A;  2RJZ A;  5KT7 A;  2EKY A;  1FRL A;  3LP0 A;  4RW8 A;  2C42 A;  2MDA A;  2W4P A;  2ZE2 B;  5HQ8 A;  3M9M B;  1BMQ B;  1MMD A;  4K4Y A;  2CJB A;  3T3F A;  2XMK A;  3KLH B;  2JVO A;  4DL5 A;  1TL5 A;  2MTL A;  4J9U E;  3OXG A;  5D6G A;  1N4L A;  1S1T A;  4DR2 J;  2RUG A;  1X5O A;  2MQQ A;  1MMN A;  2HKE A;  2IC3 B;  3HHD A;  4QYZ J;  2QV6 A;  3DRR B;  2XMU A;  4OYA A;  3S1T A;  4K5S A;  2IAJ B;  2YX1 A;  3GFZ A;  3W62 A;  3J80 Y;  3OW2 R;  5HO4 A;  4TN2 A;  2W9C A;  4ER8 A;  2ASL A;  2IC3 A;  4M5H A;  4PG4 A;  1D9D A;  2UXC F;  3IWN C;  5DGA A;  3BBC A;  2W7A A;  2WBM A;  3ZZO A;  4XO0 A;  1G3O A;  2K3K A;  4QOT A;  3T1H J;  3HVW A;  1UA0 A;  1YWX A;  3ILJ A;  4K0K J;  5DQG A;  4CTA B;  4ZLJ A;  2HMI A;  1XTZ A;  4OHX A;  3M8R A;  3NMR A;  1KFD A;  2N3L A;  4RW8 B;  1Y00 A;  4FPI A;  4KPY A;  1IJE B;  1DAX A;  2EFN A;  4O23 A;  3G9C A;  4QWE A;  2AJ0 A;  3KJQ B;  1NJX A;  1YKW A;  3G8Q A;  2DXF A;  3ZNU A;  5GMD A;  1RTZ A;  3AD7 C;  5J2P A;  4UY8 5;  1RAH B;  4Q0B A;  2AF6 A;  3MEE A;  3JTO A;  3TVZ A;  3J81 j;  2W9A A;  1NSK L;  2QMW A;  4AL7 A;  1HNW F;  3E2E A;  3ILO A;  1G2E A;  2B5J A;  3MED B;  3CCT A;  4HAC B;  4K4W A;  3DC2 A;  2NPF A;  2XLK A;  1NHK L;  3O3L A;  3I87 A;  2DNK A;  2QLX A;  3C14 B;  1L3U A;  3ENW A;  3TAQ A;  2DJW A;  2V0N A;  4YB7 A;  4PPD A;  5CYQ A;  1IM6 A;  3TYT A;  4JI4 J;  4QIF A;  2DR8 A;  2JFK A;  2CQ1 A;  3D3B J;  3VGS A;  1X5T A;  3WIV A;  4ZVR B;  1LNQ A;  1NSA A;  1SUQ A;  4J9K A;  4DPT A;  2LKZ A;  2E9R X;  1RHU B;  1Z1Z A;  2NXC A;  3OTE A;  3QRR A;  3KWM A;  1VQ9 S;  2W24 A;  3F44 A;  4W92 B;  1FKO B;  4PKD B;  1ZM2 A;  3D1Q A;  1FXL A;  4ZCK A;  2MMY A;  3QAT A;  1FTR A;  4Y28 C;  4OX6 A;  2QIF A;  5KFM A;  1TKD A;  3R5G A;  4QWA A;  2F5G A;  4J5O A;  1WKK A;  3G8T A;  1T8E A;  3RBD A;  4I64 A;  4DR4 F;  2XS2 A;  4KT0 C;  4X66 F;  3T5L A;  2R42 A;  1N32 F;  1RAI B;  3OHB A;  3BDP A;  4WII A;  4NX9 A;  5CYM A;  5E5N A;  4L76 A;  1SJ3 P;  3N6L A;  4Z7Y A;  3X1L B;  1CLF A;  4NA3 A;  1DBD A;  4U8Y A;  2VBW A;  3EM1 A;  3CO0 P;  1XR5 A;  3RUB L;  2HFU A;  3ZC4 A;  5IWA F;  4R5P A;  3J81 Y;  1VQN S;  5ADZ A;  3DLE B;  1B70 B;  2UUW A;  4B9V A;  2IJN A;  4UQT A;  4X4P A;  5CXT A;  3FZB A;  4DU7 A;  5KT4 A;  4PQU A;  1S12 A;  2RD5 C;  4PZV A;  4GKJ J;  1IBL F;  3GJT B;  1RBL A;  2DHG A;  3EXY A;  5KFN A;  3J7Y U;  4OHV A;  1IKY B;  1N33 F;  3QIP A;  1VC6 A;  2U2F A;  3VV2 B;  1N8R T;  2R8H A;  1U1L A;  2M7S A;  2XSF A;  3CJQ A;  1BLU A;  2LQJ A;  3W9J A;  4KKO A;  1TUW A;  2ZM6 F;  4MT1 A;  3HM9 A;  1XMQ F;  4WF9 Q;  1OS5 A;  2MZ1 A;  2KG1 A;  4QR0 A;  3JSR A;  4WE1 B;  4WP8 A;  2CJQ A;  2FQQ B;  1C0T B;  5I3U B;  1VRT A;  3W7B A;  4CLL A;  2E29 A;  2UVR A;  4N5S A;  2VBY A;  1T11 A;  1S6Q A;  2E1A A;  5E41 A;  4G1P A;  3NGD A;  3BH6 B;  2NUH A;  4QW9 A;  3HVA A;  2KB2 A;  1VC5 A;  1F60 B;  1FCA A;  4G65 A;  5AJ3 F;  3UDC A;  2W2M P;  4GO5 X;  3GG1 A;  5GME A;  5M2P A;  5LMN J;  4NZ7 A;  3M6U A;  1HNV B;  1DTQ A;  3R5A A;  5KT3 A;  4DV2 J;  4CO1 A;  1I1G A;  4CH1 A;  4Y34 A;  5L9N A;  4ZOS A;  2ZVS A;  3MFH A;  4F50 A;  2AGP A;  1RYR A;  5JUM A;  2YX7 A;  2WVC A;  3CUN A;  3IGN A;  3N79 A;  4Q8F A;  3OR2 B;  2ASD A;  3US5 A;  1KQS R;  2PGC A;  2GO8 A;  1TK8 A;  2E66 A;  1REV A;  2MKH A;  2P9C A;  5KT5 A;  1TP7 A;  2BE2 B;  2CDR B;  1MWZ A;  5FII A;  5IFM A;  4X4U A;  3CCW A;  3QWP A;  4DWI A;  4J9M A;  3MTK A;  5I42 B;  3MR5 A;  4C9D A;  4RX6 A;  1NPP A;  1NLK L;  1AXQ A;  3IS9 A;  2ZUA A;  4L75 A;  3VQT A;  3O2I A;  1Y5L B;  2MKJ A;  3PR4 A;  1H2V Z;  4CLW A;  5LXR A;  3T5K A;  2AEF A;  1V6H A;  3W61 A;  4CLZ A;  2HNZ B;  2BXJ A;  1VDH A;  1B7F A;  2QYG A;  5J1E A;  2ZC3 A;  3O44 A;  4K4T A;  5L1L A;  4USM A;  3Q8S B;  3RRG A;  4Z37 A;  4IO9 Q;  2VAS A;  3Q2S C;  4OV1 A;  2XMJ A;  4P9S A;  1V3R A;  3Q24 A;  1MSW D;  1FFW B;  1UWB A;  3EVO A;  3AB2 B;  3ILI A;  1NZA A;  2ZOG A;  3PEJ A;  3NNA A;  1ELO A;  1EAR A;  2GA7 A;  1WC5 A;  3TUZ C;  4X4R A;  4OI4 A;  4CM0 A;  1CS4 A;  1RBA A;  2EI5 A;  2CDQ A;  2NUU G;  2X1B A;  3V4M A;  3ZZP A;  1T03 B;  4ZLN A;  1HW9 A;  1GTE A;  3FRY A;  4NLU A;  4P6Q A;  2VQF F;  1REG X;  3M8Y A;  5D0H A;  4UTG A;  3VHQ A;  1TV6 B;  2IJR A;  1JLG B;  5GAG I;  3FK4 A;  2DGT A;  2FZK B;  4UY8 T;  3N6M A;  3D9B A;  2V6A A;  3MMB A;  4LSN A;  2DR7 A;  4V19 J;  3W60 A;  3NGR A;  5GVQ A;  3E01 B;  2DHA A;  2E5G A;  3AXK A;  4NI2 B;  4FYY B;  1BQN B;  1CJV B;  2YKP A;  2H9Z A;  2BKP A;  2O3D A;  2VB6 A;  3GSI A;  3PYG A;  4H4K A;  3SCI E;  4CO2 A;  4X4Q A;  2W9B A;  2LDI A;  4OYZ A;  1EQ0 A;  1M5H A;  4A8S A;  2ZE2 A;  4ZN3 A;  1QLN A;  2YY3 A;  4FXD A;  1TL3 B;  3ENQ A;  2XZT B;  1PJ5 A;  4I69 A;  3RBX A;  5CYQ B;  5D77 A;  3ZZY A;  2ZBR A;  5DLG A;  4F0M A;  3KLE B;  3OFF A;  3OHA A;  3A3P B;  3VVT A;  2LEC A;  1GXT A;  4QYZ K;  3LPY A;  4NYZ A;  3MCM A;  4K2X A;  4KAI A;  4AUK A;  2ZH3 A;  2VL1 A;  3DYA A;  3CSK A;  1EJ7 L;  5HAT A;  4UUW A;  3OL9 A;  4LRB A;  1H2T Z;  2GQQ A;  3KJF B;  4HHH A;  4HT7 A;  4C3L A;  1FER A;  4C2M A;  3NAH A;  2ZHB A;  4WKR A;  4MAK A;  1ULR A;  2HRT A;  2YKM A;  2BJD A;  2QJ3 A;  3BR8 A;  2GHV C;  5A0Y B;  1FTC A;  3VAG A;  2YQ3 A;  3HT3 A;  3EGZ A;  2PFD A;  3KLG B;  5J2Q B;  1URR A;  4PWU A;  3VWS A;  2EK1 A;  1CJK A;  1VJQ A;  3UDE A;  4U95 A;  2H5J B;  1TUV A;  3B54 A;  1WDD A;  3TW0 A;  4PAB A;  5HP1 A;  3GYX B;  1LW2 B;  2GMJ A;  2ZEJ A;  1R31 A;  2EEY A;  4ZKA A;  3NMA A;  3UWT A;  2VON A;  4XK8 C;  2HAI A;  2LYV A;  4HDG A;  3TA0 A;  2XMV A;  1J5O B;  3GIM A;  3MDF A;  1WEX A;  3HT0 A;  1NB7 A;  1L3K A;  2WCX A;  4PCQ A;  2VOP A;  4PG8 A;  2BYC A;  4MIW A;  4WKY A;  2DGX A;  2BJE A;  1PJ6 A;  4DL0 C;  4A8F A;  4ITS A;  1M1G A;  1NME B;  2CQ3 A;  4A47 A;  4U67 Q;  2M4M A;  2Y1I A;  3WC2 A;  2KHC A;  3FBF A;  1A0O B;  2YPZ A;  2EFP A;  3DLK B;  3MPV A;  2ZBP A;  3LP2 B;  2W2N P;  4IOB A;  2QX0 A;  1NJY A;  1PAE X;  3UD3 P;  2BAN A;  2BRL A;  1HMV A;  1MWQ A;  3WZ0 A;  2HHH J;  5KFE A;  3KHL A;  4QW8 A;  2PFF B;  4ECV A;  5MLC V;  1Q0N A;  2AMC B;  2ZM6 J;  4H4O B;  2HNY B;  4TU9 A;  3AOB A;  4QCL A;  1K1S A;  2OHD A;  2RDD A;  1S7H A;  2VG5 B;  4M8L A;  4LF4 F;  1GH8 A;  4I67 A;  4EEY A;  3MMC A;  1UPP A;  4RPF A;  1D9A A;  1FXD A;  2QLF B;  1JLB A;  3W8G A;  5KFP A;  4WFB Q;  4J9O A;  4PR6 A;  1Y11 A;  3CDU A;  1RU2 A;  1E6Y B;  4M95 A;  2BKO A;  3HSD A;  1Y0H A;  2UZA A;  2V50 A;  5DQH A;  1M5K C;  4B3O A;  3SYZ A;  1VQ5 S;  4DZD A;  2NCK L;  2EXU A;  2ZJR Q;  1RA7 A;  4CM2 A;  3C16 A;  3MCS A;  4IG3 A;  5F8M A;  2UUC J;  3MM8 A;  1U6F A;  3D66 A;  2UP1 A;  1WNE A;  1UKU A;  2J76 E;  1N6Q B;  3CCE S;  1VQL S;  2Z0G A;  3IWL A;  4NAS A;  1WKJ A;  3KHG A;  1U2C A;  2CKW A;  1T3O A;  3VGU A;  2KVI A;  4IG0 B;  4U96 A;  2QN6 B;  5KFZ A;  2XO6 A;  2FVP A;  4CNY A;  4NCA A;  5E3A A;  4JI6 J;  5FDL A;  4AQY F;  1RZM A;  3TUI C;  4AYB D;  4NOH A;  3SQO P;  3LA0 A;  1J5E J;  4NPO A;  4OYM A;  5B08 A;  1D0E A;  3VZI A;  3PEH A;  3B78 A;  5KOW A;  4ZLL A;  2XEX A;  5B09 A;  1SC4 B;  4M94 A;  4Q7A A;  1O8B A;  2MQP A;  1PC4 A;  2XNR A;  1BXN A;  4WFZ A;  3CD6 S;  2J7U A;  2JEF A;  1D8Y A;  4PAA A;  4X2B A;  2G1D A;  1Q82 T;  2V2K A;  1ZM3 A;  5HMX A;  2DIV A;  2G4B A;  2BW2 A;  3MHY A;  1L3T A;  4F4K A;  1GMW A;  2FJX A;  4MJK A;  1HR0 F;  2RE1 A;  2GQ2 A;  2WVF A;  4BWJ A;  4J9P A;  2FHJ D;  3C6T A;  3UR0 A;  2M5Y A;  3CCM S;  1RT1 A;  3KK2 B;  2GJ2 A;  1HNI B;  3Q2T C;  2HWT A;  1RLC L;  5DJB A;  4PXE A;  5HAN A;  1IXK A;  2J7K A;  2JLF A;  2N4C A;  4KGZ B;  1UFK A;  5C2C A;  3POT A;  2UVW A;  2WSF C;  3HVT B;  1Q53 A;  5F8H A;  3G96 A;  1DQ9 A;  2A2D A;  3W8P A;  1F9E B;  3I55 S;  4ZHR B;  2OAU A;  1T95 A;  1YJN S;  2VG6 A;  1JLF B;  3G82 A;  2QFI A;  4NLY A;  3M05 A;  2FUG 9;  2B9W A;  1RT5 A;  3MUM P;  3M2V B;  2UUT A;  5EX0 A;  4B9M A;  4P7T A;  2MLZ A;  3DGP A;  5KFI A;  2W9B B;  3PAC A;  3L4B C;  2KZM A;  4DFJ A;  1JJC B;  1U1R A;  4Z7C A;  1ZZN A;  2E1M C;  3THT A;  2NZC A;  1FVS A;  1BUX A;  1HBN B;  3MMB B;  1N36 F;  1LWC A;  3DGP B;  4RW4 A;  2K3I A;  4LQ3 A;  4LFC J;  3GB0 A;  3S7R A;  4DL7 A;  2BEF A;  1Y9O A;  1SB6 A;  3I9Z A;  3SSR A;  2B7C B;  4DPY A;  4L6V 3;  4ES1 A;  1QVG R;  2XZD B;  2JEG A;  2AJ1 A;  3P49 B;  1X4G A;  1R8H A;  1S6U A;  4DSF A;  3CMA S;  3P4U B;  5B0D A;  4OI0 A;  4RW9 B;  2UXC J;  1Q8K A;  4ID5 A;  3V6D B;  2LA4 A;  1Q5V A;  3EJM A;  3EDR B;  3R7N B;  2UUB F;  1QUP A;  3TI0 A;  1S1U B;  3M9O B;  1HW8 A;  3DRS B;  4HDH A;  2JEJ A;  1IKX A;  1ICE B;  2DD8 S;  1URN A;  2POK A;  1EP4 B;  5AJ3 J;  2VFU A;  1FJC A;  1N0V C;  3CT9 A;  3M2R B;  3KUE A;  5F3T A;  3SQG B;  3TR5 A;  4NRT A;  3TJA A;  4DX8 H;  1SL2 A;  2FY8 A;  2NS1 B;  4TY8 B;  4ILL A;  2QL7 B;  3CNQ P;  1NND A;  2O67 A;  1RB0 A;  2DTJ A;  3AY0 A;  4ICL A;  4OHZ A;  2BV3 A;  5CCM A;  1YBU A;  1OQ3 A;  3GJQ B;  3CUL A;  2ATC B;  4C3M A;  1UZD A;  3KG4 A;  3EXC X;  3TEH B;  1FK9 A;  1JJH A;  1UJ5 A;  4ED2 A;  3CB4 A;  3IR6 B;  5B0B A;  4YR3 A;  4CLF A;  3SSS A;  2VA2 A;  2MGZ B;  2B9Y A;  2CNL B;  1M1K T;  4RR5 A;  2UU9 J;  1X7V A;  1S1U A;  5IXU A;  2JC0 A;  5L1J A;  3KNA A;  2IJF A;  1RAD B;  1TU0 B;  4IG0 A;  2EG2 A;  3MCN A;  4O44 A;  2P6T A;  4YN3 B;  5DZ6 A;  3W5Y A;  1QSY A;  4OL8 A;  3KFW X;  2R7S A;  3H4B A;  2M8D B;  5HVH A;  4K4Z A;  5HL7 Q;  4DF4 A;  3CME S;  4ZN1 A;  3SBM A;  3PTW A;  1LEO A;  1XC9 A;  2AJQ A;  3V4I B;  4F04 B;  1NKB A;  2LDY A;  5CCL A;  2BJ1 A;  5BXI A;  1C0T A;  2HS4 A;  3MPU B;  2CPJ A;  2K06 A;  2PMH A;  2WAQ D;  3LP1 A;  1JQG A;  3QRP A;  2FPH X;  2KFY A;  4KSE B;  3MR6 A;  3W2V B;  2LQ8 A;  2IPO B;  2XG8 A;  2OFH X;  2Z4P A;  4WFY A;  1UA1 A;  4R8U A;  3FGV A;  2GX8 A;  4ZVS B;  4YDX A;  5K5M A;  4JV5 F;  2C3U A;  3V2U C;  1ACM B;  2LXU A;  3JYT A;  4H4M B;  2ZDP A;  5CZX A;  2VOD A;  3AOD A;  4O3S A;  4USK A;  4JUZ A;  4TNO A;  3BGL A;  1RK8 A;  2XY6 A;  3QFH A;  2E5L F;  1VQY A;  3LP1 B;  1QUV A;  5A6W A;  2XI3 A;  1B0T A;  2FDN A;  1KTQ A;  3QGP A;  1UVL A;  1HHS A;  4O3N A;  1Z2Z A;  4U7U K;  1TAQ A;  2YWW A;  4LVO P;  2VUG A;  3HPO A;  1RSC A;  1UTA A;  5CZV A;  4DX5 A;  3UI3 A;  4JI8 J;  1EQM A;  2R2R A;  1JLA A;  4A0T A;  3BKU A;  1W7W A;  1F0X A;  4DR1 J;  2NPI A;  2XI2 A;  2IY5 B;  2XUL A;  3MF5 A;  3DLB A;  1OYE A;  4DZ6 A;  4IFY B;  2DGV A;  3R2D J;  2LQB A;  2YVS A;  5J2Q A;  4M1K A;  4IDK A;  2C2N A;  4DSI A;  3AH6 A;  1ARO P;  2FJE B;  2R7T A;  3Q8P B;  1ZA2 B;  2ZC4 A;  2ZD1 A;  1HNW J;  1JNR B;  2W8K A;  3WC0 A;  1R0A A;  4B3T F;  4HKQ A;  5C42 A;  1JXV A;  1YZ7 A;  2E5H A;  4IFV B;  1FA0 A;  3DU6 A;  1XR7 A;  2DNH A;  3POT B;  3Q8R B;  4RL1 A;  1J27 A;  1NXI A;  1MW7 A;  1U2F A;  3A1Y G;  4C0B A;  2GFF A;  2RVJ A;  5JVG Q;  3JQK A;  3PYF A;  4DV7 F;  1I94 J;  2VBZ A;  3EDQ B;  1XNQ F;  4JYA J;  2ZH8 A;  1WTF A;  2FJB B;  1IBM F;  3D0I E;  2BAC A;  4DR4 J;  1N88 A;  4ANE A;  2VOO A;  1VLY A;  1Y5I B;  1ZAX A;  1YK9 A;  3HSZ A;  2JJ4 D;  2QG9 B;  4U7C A;  5GAH U;  1KQK A;  3HZE A;  2XYG B;  2DNP A;  3CPW R;  2DBB A;  4FS1 A;  3QAE A;  4USI A;  8AT1 B;  2KTQ A;  3LGH A;  4E98 A;  1YRU A;  4IFY A;  2R2U A;  2IDL A;  1U09 A;  5E3Q A;  1X4B A;  4CZC A;  2UV8 G;  3GE9 A;  1NSQ A;  4E8U A;  4IR1 A;  4ZPT R;  1H7W A;  1RKI A;  2G1H A;  4RW6 A;  3GII A;  5H9E K;  3KLI A;  5L46 A;  4EZ6 A;  1OO0 B;  1C2P A;  2HMI B;  1F3F A;  2J9E A;  3THV A;  1T03 A;  3NNC A;  2K2P A;  3K58 A;  2M70 A;  3HHL C;  5DZ7 A;  5KFC A;  4IG3 B;  4MKV A;  4ZIT A;  4RU9 A;  1ZA1 B;  3S6E A;  1PYO B;  1RHJ B;  3GFH A;  2F4V J;  3L09 A;  3QT7 A;  4ETX A;  2ALZ A;  4RW7 A;  3RZA A;  2HWI A;  1RTJ A;  1XQI A;  5IS2 A;  3R6G B;  1BE4 A;  1RHK B;  3UE2 A;  2A2C A;  3H5X A;  2VG6 B;  3G82 B;  1KVJ A;  2GNK A;  1VBX A;  5F8I A;  3HHK A;  2DGW A;  3KXD A;  1SV5 B;  1U2R A;  2RKI A;  4MK7 A;  3K59 A;  3M6V A;  1R6Y A;  2X1F A;  2V63 A;  3HUL A;  4KQZ A;  5D4L A;  3GMG A;  4NYP A;  1FDB A;  3CXC R;  2B7B B;  2WVE A;  2B6A B;  4FS2 A;  2VPW B;  2Z56 B;  2CNO B;  2ZKT A;  2H48 B;  1S9F A;  2ZH6 A;  2CQH A;  3I5B A;  1PSD A;  3A8K A;  5DGB A;  4DR1 F;  2EFG A;  3BRE A;  3SXL A;  3DLK A;  3IG1 A;  4D3G A;  3HSG A;  5AXK A;  4JI8 F;  2X1A A;  4LRA A;  2DGQ A;  4ECU A;  3HKZ D;  1Y4Z B;  2CZ9 A;  3CIM A;  1RT2 A;  1WC0 A;  5LT5 A;  2IVY A;  4QIG A;  3L3C A;  3FEY B;  4ZP6 A;  5BR8 J;  4DOZ A;  3CWJ A;  4A0U A;  4C6A A;  2C2E A;  1BWE A;  4FYV B;  2DHX A;  1PAU B;  2H4W B;  1B0V A;  2JDJ A;  2PA3 A;  2Y1R I;  3CJ4 A;  2HEK A;  4MKB A;  1EX8 A;  1F6T A;  2YWH A;  4NZ6 A;  3BKF A;  4OYW A;  4ETZ A;  4DL6 A;  4CLS A;  5H9F K;  4N56 A;  4DI6 A;  1NM2 A;  4URS A;  5IC6 B;  3TUP A;  4AFF A;  3TO8 A;  4HH0 A;  2HAF A;  3AQO A;  5HLF A;  4YOE A;  2IM0 A;  2NXN A;  3LPE A;  4WFX A;  2B4V A;  1H2U X;  1HAR A;  2VKR A;  3OLB A;  4OZL A;  2DY1 A;  4HVZ A;  2AJ2 A;  2PEB A;  2BMB A;  3PM9 A;  3QMQ A;  1SH2 A;  4NI2 A;  2UXD J;  1GAO A;  2UV8 A;  5A8K A;  2I5J B;  3TJ8 A;  1O51 A;  2FJV A;  2NLW A;  1HBU B;  1HD0 A;  2V8D A;  1VCT A;  1R7I A;  3G6V A;  3O5T B;  3OPK A;  3M8Z A;  3ENV A;  4LFA J;  4EGL A;  1GK8 A;  3KLI B;  1J5O A;  2FVS A;  3QJJ A;  2I5J A;  2M88 A;  4LUB A;  3DOK A;  1UL3 A;  2NR0 A;  3UN5 A;  4WFA Q;  5GAE I;  3PW0 A;  3K0J A;  4XDD A;  5IQQ A;  2CQB A;  2HS0 A;  3FSX A;  1T9V A;  4RW9 A;  2C2R A;  4RUH A;  3RW6 A;  4DV4 J;  1KQG B;  1TL1 B;  5HLF B;  1ITP A;  2A3J A;  5IM0 A;  2O5D A;  2JH3 A;  1ZYQ A;  1AFI A;  4C8L A;  4LRF A;  1WEZ A;  3OL7 A;  4DR3 F;  4ZPV R;  3W9I A;  4J9Q A;  2YH1 A;  1U02 A;  2GML A;  3OQ2 A;  1OSC A;  2D69 A;  2OKQ A;  2RU3 A;  2GAG C;  4JOU A;  2PEH A;  4Y2K A;  3SCL E;  4J9N A;  2VFT A;  1QAJ A;  4USW A;  3Q86 A;  2MQ8 A;  1UZH A;  1NO8 A;  1AZS B;  1BQM A;  1RWO B;  1TZ0 A;  1X4H A;  3DOK B;  3E01 A;  4J9S A;  1WTB A;  3QLH A;  3KDN A;  3N0V A;  2Y9H A;  3MFI A;  1TKZ A;  2W25 A;  3ISN C;  4G1Q A;  4TKT A;  2V68 A;  2CIM A;  2L9N A;  3NKY A;  5CA5 A;  2RF2 A;  2OLW A;  1RAA B;  3DRR A;  4ELV A;  3K2Y A;  2ZZN A;  4NLR A;  3GON A;  2L9D A;  2JZ5 A;  1NAQ A;  1HA1 A;  2OML A;  3ENA A;  3HHL B;  2EBE A;  6FD1 A;  3OJU A;  5T14 A;  1X0F A;  5F8N A;  5FDL B;  3BBB A;  4DSL A;  1K44 A;  1AW0 A;  3HP6 A;  3SV3 A;  4Q0B B;  3VR1 A;  3IP0 A;  4J37 A;  3R8Y A;  4IUF A;  1VQ6 S;  4O3R A;  2XSJ A;  3OLA A;  1F3V A;  3G2X A;  1ZPW X;  3LWM A;  2VQF J;  4LFB F;  1NB2 A;  5KFJ A;  2RS8 A;  2CNN B;  2YX4 A;  1FRJ A;  2YNH A;  1Z4U A;  3T6J A;  1JLG A;  5KFW A;  3PKY A;  2QEX S;  3AB4 B;  3GZ7 A;  2V8V A;  3MEC A;  4OX9 F;  2CPZ A;  7FD1 A;  4Y6I A;  3VAI A;  3FDS A;  1PKU A;  3RYL A;  5HJY A;  2OTJ S;  4KH1 B;  4UQG A;  1HBM A;  1CS4 B;  1KFS A;  1X9S A;  1RA6 A;  1UEK A;  1QTN B;  4K8R A;  1UW4 A;  2GJF A;  2YKO A;  2ZNY A;  2DGU A;  4BC7 A;  3M7V A;  4X62 F;  1REV B;  4X62 J;  4DR7 F;  3CO9 A;  4K5R A;  2CRL A;  1DQA A;  2JHE A;  2M8H A;  1R8B A;  2YPY A;  4R0J A;  2PA8 D;  2QE5 A;  3KLV A;  2G0I A;  4ZVO B;  3UNG C;  4DR6 J;  2FTR A;  3M8Q B;  1UEU A;  3BF4 A;  2PI5 A;  4Q5V A;  3ZZ0 A;  3QJP A;  4NL5 A;  2HNZ A;  3C19 A;  3EGW B;  3MUR P;  2KZZ A;  4PQU B;  4WZM A;  4CTA A;  1RBO B;  1HNV A;  2KPP A;  3LW5 C;  3Q0A A;  3FSY A;  1K47 A;  2BJ9 A;  2ZBI A;  4WWS A;  4ED1 A;  3W65 A;  2AYM A;  2F8E X;  4L74 A;  4WBF A;  3RAM A;  3SFU A;  2RDJ A;  3GQC A;  3U7J A;  4BHQ A;  1S10 A;  1VBZ A;  5AXL A;  2DNR A;  3OSN A;  2VQE J;  1EZZ B;  2X51 A;  3FEX B;  4PPZ A;  2B4U A;  1RUS A;  1GTH A;  4DXL A;  2B43 A;  3OR2 A;  3OTD A;  2HZA A;  4LBI A;  3ICL A;  4I56 A;  4RNF A;  2B51 A;  2HHX A;  2YWK A;  1PG5 B;  3Q23 A;  2Z58 B;  3HX9 A;  3D6T B;  4M5K A;  1BHN A;  3UNY A;  2M2B A;  1SJR A;  1U1N A;  4RNN A;  1P27 B;  1SJQ A;  1LXJ A;  2F8M A;  3EZO A;  4PRF A;  1GMU A;  3MD1 A;  1IR0 A;  4CLK A;  3F0N A;  3H40 A;  2G0J A;  3VGT A;  2D3U A;  3LAL A;  3V6J A;  1SQG A;  4NEY A;  3TVK A;  3MEG B;  4NRU A;  4DMZ A;  4MYU A;  1S97 A;  1K8A T;  1CG2 A;  3TZZ A;  4DPW A;  2AV5 A;  2BVZ A;  4IH5 A;  2DVI A;  4EK2 A;  3JXO A;  4I6W A;  2HQ3 A;  3WQP A;  1GEH A;  4I1T A;  3D5M A;  1SI9 A;  1XWL A;  4KC5 A;  2Z2M A;  3PX0 A;  2JNJ A;  1HWK A;  2MPU A;  4DN9 A;  4DUT A;  5KFO A;  3FKB A;  2AEM A;  3U1N A;  2NZ4 A;  4KGK A;  3PO4 A;  3H8Y A;  4CO5 A;  1DTT B;  3H2L A;  3PHE A;  3RAQ A;  3TP2 A;  4KV8 A;  1NKC A;  2JL9 A;  1TL7 A;  5B7W A;  3JSM A;  3CE8 A;  2MKK A;  3D1H A;  3FEZ A;  3N5F A;  1DTT A;  4P7V A;  1R27 B;  1S9E B;  1ZPV A;  2DIT A;  4OHW A;  1F5B A;  4CH0 S;  4LSZ B;  5KFX A;  4CT8 A;  5LSL A;  1K0T A;  2YNG B;  4B9N A;  3HI9 A;  4L3K A;  2ZHA A;  1WOP A;  3PRB A;  3IR5 B;  3FBE A;  1JLC B;  1V5V A;  3VAM A;  3PVX A;  2J0W A;  1N48 A;  1SKR A;  1N0U A;  2I1R A;  1S9G A;  5J2P B;  2ZZT A;  2J6T A;  4H4M A;  1TKX A;  2FJA B;  3Q8Y A;  3CJ8 A;  4F0H A;  5T7L B;  4USH A;  3J80 U;  4CCH A;  9RUB A;  2E9Z A;  5AE1 A;  4ZPW R;  3HZG A;  4NXM J;  4ZVG A;  4X4V A;  3BPD A;  5C2G A;  3IM9 A;  1RLD A;  4FNH A;  3IAS 9;  2HHH F;  2UXB F;  2WTF A;  3BO3 A;  4HL9 A;  4S0M A;  1N34 F;  4ELT A;  4FDF A;  1R0C B;  4NXN J;  1PBU A;  5CQG A;  4I0W A;  3UPF A;  4YR2 A;  2DKO B;  4H4K C;  3W64 A;  4PUO A;  1GXL A;  1RKJ A;  1H73 A;  4BCA A;  3WDO A;  4DX6 A;  4CLP A;  1SKS A;  1X4A A;  4IOC Q;  5J1N A;  2W2P P;  1IBK J;  3TQ1 A;  1BQM B;  1S9G B;  1DJ0 A;  1C4A A;  2RDI A;  4N77 A;  1VQM S;  4U7U D;  3EGN A;  4MKA A;  4C11 B;  2IYI A;  4F3Q A;  1JLC A;  1S48 A;  3UQS A;  4DLE A;  2KFN A;  3J7Z 5;  2DRB A;  1NDC A;  5HVF A;  1LV5 A;  3H59 A;  2ZBQ A;  1F2H A;  4K4X A;  5KT6 A;  2CA9 A;  4WXO A;  4DV1 J;  2HUR A;  2FYX A;  2DNG A;  4M5D A;  1RAJ A;  3AJD A;  1JMT A;  4ZP8 A;  4GKK J;  1AUS L;  1CJU B;  3GJS B;  3MMA A;  4EZ9 A;  1YJT A;  2SXL A;  1PIE A;  1UVM A;  3MD3 A;  1DUR A;  4ZJQ A;  1DTQ B;  2X3G A;  3DHX A;  1FO1 A;  2V8P A;  2YQ2 A;  2IHR 1;  1B4S A;  3GSD A;  4ZP9 A;  1FJE B;  3MEC B;  5D3G A;  4R25 A;  2HGN A;  3QGH A;  1IKX B;  2AHO B;  1OYD A;  3OTB A;  1VS3 A;  5E7O B;  2CQC A;  1VHF A;  1WEY A;  4RBV A;  3RJM B;  4EBE A;  3SI8 A;  5H9E J;  2E1P A;  4OX7 A;  3QWU A;  3DRP A;  2FLN A;  3SDE B;  2MKI A;  3MEK A;  1QD1 A;  4FYD A;  1U8W A;  3GWC A;  6FDR A;  1WHY A;  2PMW A;  3QRQ A;  3GFY A;  1GXU A;  2DR5 A;  3L7O A;  4K7Q A;  3B82 A;  1BGX T;  3HO1 A;  3T19 A;  1WHV A;  1N6Q A;  2YWE A;  2BE2 A;  4OYI A;  4ZCL A;  2DNY A;  4NML A;  3V81 A;  4ILR A;  1W2I A;  2IRX A;  1KWM A;  1NCL A;  2RF2 B;  2XYP B;  3OR1 B;  2QYC A;  4I7F B;  4OZJ A;  5FLX Y;  2K8G A;  2F3J A;  3QIP B;  4Y00 A;  1TKZ B;  4G1Q B;  5E3P A;  4ECS A;  5K8O A;  2HBZ B;  3MED A;  4HAC A;  3MM7 A;  3KMQ A;  4ILM A;  2PSZ A;  2V4J B;  4AE5 A;  4F4X A;  5DM6 Q;  1Q5Y A;  1R8P A;  3E3X A;  4M5N A;  1VK3 A;  1KP6 A;  1M5O C;  2NYI A;  1SVD A;  2CYY A;  4GVL A;  1LWE A;  4N47 A;  1HMV B;  4EO6 A;  1RTI B;  2B8Q A;  3BGO P;  2JX2 A;  3IR7 B;  1JLQ A;  3BR9 A;  4MK9 A;  3F56 A;  3H20 A;  2GC8 A;  2ZUG A;  3NWG A;  1RWM B;  5KFT A;  1C1C B;  3FUY A;  2ZH4 A;  2ZH7 A;  5DG7 A;  2KXF A;  2A6O A;  2WHO A;  3DOM A;  4Y0F A;  4JI5 F;  3DLL Q;  1DRZ A;  2DY9 A;  2E5I A;  2NSC A;  2UVU A;  3QPI A;  1WWH A;  1HNI A;  1WHW A;  4LJM A;  3BQ0 A;  1S0N A;  1P9Q C;  3EGV A;  1S76 D;  4YS2 A;  2P2C B;  3FVY A;  3JQJ A;  1OQ6 A;  3IBF B;  4F26 A;  2YWF A;  4WU2 A;  2U1A A;  3GYN A;  1TKT B;  1LWC B;  1Y7P A;  3FZ2 A;  3H90 A;  3MM9 A;  4RW4 B;  2FHM A;  2Y8Y A;  1KHW A;  4DV3 J;  3VGV A;  3UN3 A;  3IGV A;  2QSF A;  2L48 A;  4ED4 A;  1YJR A;  4TLQ A;  3UCU P;  2W1B A;  4B3R J;  3B4M A;  4NE9 C;  4KFB B;  2ZIT A;  3P45 B;  1IM4 A;  2FZG B;  3DCA A;  9ATC B;  2VA3 A;  2N7Y A;  2KYX A;  3GTY X;  1IJF B;  1OSD A;  1VIO A;  3AHP A;  2HND A;  5DLF A;  2IBK A;  2MB0 B;  3HXM A;  4ERD A;  1TR0 A;  2E5J A;  3CJ2 A;  1EAY C;  5DQI A;  3QT5 A;  3NS5 A;  2Y1J A;  5SUH A;  3QAU A;  2EBG A;  1LWF A;  2Z2Z A;  1P1L A;  2QLB B;  3DI6 B;  3GJR B;  2M3D A;  1VBK A;  1XJW B;  3I82 A;  5IC4 B;  1C1B B;  2R2S A;  3IA0 A;  5KFQ A;  5KG2 A;  5CD4 H;  2B5J B;  1KVK A;  1YIJ S;  1U6B A;  2GIQ A;  1UMJ A;  4LF7 F;  2R7X A;  1HBM B;  4IKA A;  1CUL B;  2RH3 A;  3V6H A;  1PYS B;  2VHG A;  1VQK S;  5A76 A;  1LFW A;  4QIV A;  1NK5 A;  5D4N A;  2DXE A;  5M2R A;  5KG7 A;  3UD5 A;  4X64 F;  2J6U A;  1CJT B;  3CJK B;  4KHM A;  2EW9 A;  3U02 A;  2HHQ A;  5IM0 B;  2HG4 A;  2I9S A;  1ZH5 A;  5AXN A;  3CJ3 A;  3EMT A;  4NZ0 A;  2HIY A;  3GV7 B;  3CC4 S;  3K8V A;  3W5Z A;  2H3E B;  2HVI A;  1OMS A;  1HI1 A;  2WON B;  5K9F A;  1BQN A;  4IYQ A;  1CQM A;  1RAF B;  4OI3 A;  4X65 J;  4A8Y A;  1KSP A;  3DHW C;  2ZZM A;  4TVA B;  2OTL S;  1M5S A;  3HSJ A;  4LR7 A;  2D41 A;  2O1P A;  2O01 C;  2ZWP A;  3RBE A;  3GG0 A;  4P73 A;  5K14 B;  3SEO A;  1K9M T;  5FD1 A;  1RE1 B;  3MAA B;  4UF4 A;  3ZO7 A;  1NK7 A;  1FD2 A;  4GRS A;  1R8C A;  2HHS A;  2OIH A;  2HFZ A;  3CD5 A;  1JKH A;  1RAG B;  3BYR A;  4DG1 A;  1JLA B;  4ECT A;  3HK2 A;  3MOZ A;  4UOH A;  3CDW A;  1R89 A;  2FHO B;  1MRO B;  2WOM A;  1JB0 C;  3DLJ A;  2NXU A;  3LOU A;  3PJX A;  5JVH Q;  3T1Y J;  2H5I B;  4OQJ A;  1E6Y A;  5HSP A;  2XS5 A;  3T41 A;  1VR6 A;  2D3Z A;  1JLB B;  4XTT A;  5T7L A;  2J6S A;  1U26 A;  1NDP A;  5LXY A;  4LRD A;  2RU9 A;  1KLN A;  2YNF A;  1IWA A;  5F8L A;  1KBR A;  5HRO B;  3D6M B;  1HHQ A;  4FNI A;  4Q45 A;  4UT4 A;  7AT1 B;  2VFS A;  4PXD A;  4C8N A;  1U0H A;  5ETL A;  5HBM B;  5CAB A;  4DUZ J;  1KS2 A;  4K4S A;  3NGT A;  5A8W A;  2PMZ D;  4JI1 F;  2DO0 A;  4ZCI A;  1BC6 A;  3D1O A;  2RHQ B;  3OVA A;  2VDH A;  8RUC A;  1U0S A;  3K17 A;  1G1X A;  4KV8 B;  1FRH A;  2F1F A;  5G4D A;  2Y0B B;  3W5X A;  4ANC A;  4C7Q A;  4JI3 F;  3M30 A;  3W3S A;  2ZOM A;  2OPR A;  5ETM A;  3JAM U;  2YNI B;  1FFS B;  3OJS A;  1NSP A;  3DOL B;  4OYO A;  3F41 A;  1Q79 A;  1UVN A;  2R7V A;  3G6Y A;  1VIS A;  3ZNJ 1;  2J0S D;  1N5Y B;  3MOJ B;  2W2Q P;  1I5O B;  4CO4 A;  2IRU A;  1WD6 A;  2JSX A;  5GMK a;  1X5P A;  1YQH A;  3GP9 A;  4OIX A;  3CCL S;  3V81 B;  1LW2 A;  2F7V A;  1TKX B;  2CZ4 A;  4P2M A;  1F5A A;  3CCU S;  4DPO A;  2LLZ A;  3DXB A;  3K8W A;  1G4C A;  2C3Y A;  2ZVI A;  3T5H A;  2HVH A;  4O44 B;  2ZJQ Q;  3R1H A;  1KTV A;  3HFV A;  1A7G E;  2ZNZ A;  3CCJ S;  3TAN A;  2UVV A;  3OXF A;  1KLM A;  2BOA A;  4WP9 A;  3BO4 A;  2Z57 B;  3A8J A;  2ASY A;  2YQ0 A;  4WZQ A;  2MJN A;  1D3W A;  2XY7 A;  1IKV A;  4K0K F;  3GR0 A;  4WK1 A;  3G6X A;  2A10 A;  1IBK F;  1P1T A;  3IM8 A;  5KFK A;  1P8G A;  3N28 A;  1C0U B;  5D0R A;  3T1A A;  2DIU A;  2M0G B;  2BA9 A;  4JV1 A;  4DG1 B;  2GVZ B;  2V8G A;  3RG6 A;  1VRU A;  3MTJ A;  1HHT P;  5J2M A;  2DH7 A;  1HKA A;  1U7L A;  1RHR B;  2K1R B;  2DK2 A;  3OT9 A;  3TA2 A;  3CMQ A;  1JJ2 R;  4QJV A;  3NS6 A;  4C98 A;  1OY6 A;  1UWB B;  2GIF A;  5MAO A;  4NXN F;  1X31 C;  3RR8 A;  4YEA A;  2Y0S D;  3OV7 A;  1IWG A;  1EKS A;  2BM0 A;  3DM2 A;  2Q43 A;  4LR8 A;  4CLT A;  3ELH A;  3H2V E;  3Q8Q B;  4NCG A;  4PG5 A;  2OD6 A;  3ITH A;  2XLI A;  5GAD I;  2Q66 A;  3L7U A;  1V9O A;  2CPY A;  2VG7 B;  4OZ0 A;  2MHE A;  4USJ C;  5G0R A;  2MQO A;  2XY5 A;  3TZW A;  4KJI A;  4BWM A;  4RUB A;  3SSQ A;  4ZPB A;  4EBC A;  1V5I B;  2GVZ A;  4BLG A;  3KJV A;  2H54 B;  2G2O A;  4LSN B;  2HBR B;  2BJ7 A;  1KR4 A;  1S6O A;  1X4E A;  2ASJ A;  1IBL J;  5JMN A;  1KRP A;  1TV6 A;  3NGU A;  3RBZ A;  3JB9 k;  1N56 A;  2RAQ A;  2QA4 G;  4YHH J;  1VIX A;  3ZZT A;  1WOS A;  3R97 A;  1YJV A;  1RT7 B;  3V4I A;  3RAX A;  4LF9 J;  2X1G A;  3PV8 A;  2GIR A;  4IQM A;  4WIQ A;  1S99 A;  4M5M A;  1U1Q A;  2IIH A;  3W1Y C;  5GAH I;  4A8M P;  3UW1 A;  3DRX A;  5C25 B;  2V2V A;  4F0K A;  1LK7 A;  2VG7 A;  2DPJ A;  3PHT A;  3PZP A;  2DT9 A;  2VFR A;  3DI6 A;  2GJI A;  2OPQ A;  4OJ1 A;  2V4R A;  3BO2 A;  2MGZ A;  4N8N A;  3AJ2 A;  1Q16 B;  4MMO A;  1ZBT A;  1FF2 A;  5KFL A;  2MY8 A;  1O5J A;  2C3M A;  2IFX A;  3FCH A;  4ZHR A;  1SKU B;  1UAW A;  4ZVH A;  4YP3 A;  2N3O A;  3ZTQ A;  2RS2 A;  3J7A 1;  1UEV A;  4ZJO A;  1IBC B;  3BSC A;  4ECX A;  4L73 A;  4NCB A;  2E9T A;  3WIU A;  1HWU A;  3ET6 A;  1C4C A;  4I68 A;  4XDC A;  5RUB A;  5GAD U;  4DFK A;  1IBM J;  2DR6 A;  4LF2 A;  4ES3 A;  1S1W A;  4HHJ A;  2VBX A;  1H7X A;  1VFJ A;  2HLT A;  2QA1 A;  3JTN A;  5A8R A;  2VDI A;  2IM2 A;  2YNH B;  2FC9 A;  2RRA A;  2BM1 A;  4LF1 A;  1RTD B;  4C8Z A;  1Q7Y T;  3MUT P;  1QAI A;  3BGR A;  4WYL A;  2HHU A;  2FJD B;  2EPI A;  4LIW A;  3ADA C;  2F63 A;  1UFW A;  2PD1 A;  4OMF G;  5D0E A;  5C25 A;  1DAR A;  4ECR A;  2ROP A;  3PJ9 A;  1HQU B;  1YIT S;  1JIH A;  2XLJ A;  3H98 A;  4C8O A;  4B9L A;  2DEJ A;  2DNZ A;  4JB8 B;  1XMO F;  1QM9 A;  5D8H B;  1RT6 A;  1TL4 A;  3PCO B;  3QT8 A;  5KG3 A;  2IDE A;  4M5I A;  4OBI A;  2GQC A;  1L5U A;  4WE1 A;  4DPX A;  4FXW A;  2BUN A;  1R43 A;  2LEA A;  4URG A;  2MKC A;  4PXB A;  2CVE A;  2FC8 A;  2P5V A;  1ZOT A;  3K5O A;  4N8O A;  4K50 A;  4FVC A;  2CZV C;  1FDN A;  3KHH A;  3Q8V A;  1N5Q A;  3GR1 A;  4DUY J;  2DO4 A;  4DSE A;  3B6B A;  1IN0 A;  1WHX A;  3RB6 A;  2FVC A;  2MQL A;  3LP0 B;  2GV1 A;  1UWA A;  1FE4 A;  5AT1 B;  5BYR A;  1FKA F;  5LOQ A;  3TAP A;  1SCJ B;  1KC8 T;  2YH0 A;  2Q3P A;  3HHL D;  5A8W B;  3MR3 A;  3GIK A;  1NDL A;  2LQ5 A;  2XMW A;  3HVT A;  3MMC B;  2CQ4 A;  3LWL A;  1NBE B;  2CJK A;  3NOC A;  2HNY A;  4ED3 A;  1FRX A;  3PX6 A;  1NKE A;  1T02 A;  2YNI A;  3QNW B;  4A8W A;  1DZ5 A;  1RWV B;  1QSS A;  3M8W A;  2R7O A;  1RTI A;  3UDV A;  1FEH A;  4N41 A;  4NLX A;  4DUZ F;  2HHV A;  1RP5 A;  1RT1 B;  4NYO A;  3IG1 B;  4HEA 9;  4CNZ A;  3KK2 A;  3QGG A;  1LW0 A;  3M1V A;  2XMA A;  1WUU A;  4C97 A;  3UD4 P;  1T05 A;  2RUS A;  2XWX A;  4PWD B;  5J2N B;  4QQB A;  2EFQ A;  4OHY A;  2F9D A;  1JX4 A;  2F65 A;  4LR9 A;  1WF2 A;  2KO1 A;  3LAK A;  1FX4 A;  1WOO A;  2Z2Y B;  4Y65 A;  4ZPC A;  5HK4 A;  1PCA A;  5ITH A;  2MKS A;  3FQK A;  4JI2 F;  3T1Y F;  1AUD A;  3D3C J;  2HFO A;  3ET6 B;  4K59 A;  4YB6 A;  4ZDN A;  5C24 B;  2QMU B;  4OYB A;  4PYA A;  2HVZ A;  2JLG A;  2AX0 A;  2LA6 A;  2OSR A;  4NA2 A;  2P9G A;  2AWZ A;  4WXW A;  5E0O A;  2M52 A;  2XGP A;  4FF3 A;  2FGC A;  3FCV A;  4YY3 F;  1WC1 A;  4LVN P;  3CF5 Q;  4QU6 A;  5ETK A;  3KLF A;  1OPI A;  1JJ4 A;  3R5D A;  2NSB A;  5A6P A;  4DR7 J;  2DB1 A;  3FFI B;  3ISN D;  1BY9 A;  4OZ3 A;  3TAM A;  4F02 A;  1CPZ A;  1M1H A;  4A8K A;  3DN9 A;  4FF2 A;  2HPU A;  2KJV A;  1S49 A;  2O66 A;  1VYA A;  2XNQ A;  1RCO B;  4PWW A;  1GX6 A;  3FMB A;  3I0R B;  2MQN A;  4RWW A;  2C28 A;  2R8G A;  1FE0 A;  1RWU A;  5HQL A;  4X65 F;  4DN0 A;  5LJ5 Y;  1FRK A;  1T9W A;  3NCP A;  5B0C A;  1S0M A;  3DDI A;  1H38 A;  3CD7 A;  2AEJ A;  3R5C A;  2WVB A;  2I8E A;  3TNV A;  3VAK A;  4MIB A;  1CSJ A;  2XZW A;  3MMA B;  2AQ4 A;  3GCW P;  1UVK A;  1HNX J;  2UU9 F;  2A6M A;  2DHH A;  2XBP A;  4NLT A;  1YJW S;  3M6W A;  4RNM A;  1RU1 A;  2VU5 A;  5HMW A;  2ATL A;  2J0X A;  3SCJ E;  2MZJ A;  1IR1 A;  4V19 X;  4C8Y A;  5DO2 A;  1CJT A;  2V67 A;  2XCP A;  1WDT A;  2BAN B;  3N9U C;  4FF4 A;  3ZTS A;  2GAH C;  4OYX A;  4KHP J;  1NRK A;  5DDP C;  4UOC A;  4CH7 A;  1TK0 A;  1ZZF A;  3W63 A;  1RXO B;  4ED8 A;  1PGZ A;  2HVE A;  3BQ2 A;  2K7K A;  4AL6 A;  1HBN A;  3WX8 A;  4U6P A;  2CJA A;  3IS9 B;  1VLO A;  4DR5 F;  3QJL A;  4F4A A;  2V69 A;  1AT1 B;  3CCR S;  3SCK E;  1U6Z A;  5L38 A;  1C0U A;  5AE2 A;  4TXS A;  3EZ5 A;  5JXS A;  4DV0 F;  4ZPA A;  1FRI A;  2I2Y A;  3D67 A;  3DLG B;  4KB7 A;  4XPE A;  3OTC A;  4CO3 A;  2ZDO A;  1DQ8 A;  2RB7 A;  4O0N A;  4IRC A;  3MCO A;  2DYA A;  4QPX A;  2VF3 A;  2MLY A;  1SC3 B;  5ETR A;  3MAH A;  4FP9 A;  3IBW A;  4GKK F;  2BAB A;  1Q4R A;  4ELU A;  1YI2 S;  3J7Y I;  1F5C A;  4KFB A;  5LSR A;  4ECZ A;  2CJX B;  2KL8 A;  2OI2 A;  1K73 T;  4DR6 F;  1G6B A;  3D0G E;  2HGM A;  2KHD A;  4TYB A;  3TVY A;  5KG5 A;  3IMQ J;  4LF5 F;  4JI5 J;  1OY8 A;  5A0Y A;  1X9M A;  4CLU A;  1NH8 A;  1HWL A;  3BYP A;  4B3S F;  4OJ3 A;  1SL1 A;  1N36 J;  1JXL A;  3RR7 A;  3MM5 A;  3BPS P;  2DIS A;  2RRN A;  1QDU B;  2XMM A;  5D3G B;  4CDI A;  1RJJ A;  2FB0 A;  1X4C A;  3K5L A;  1HI0 P;  4Q8E A;  1NU4 A;  3S8S A;  4YHH F;  1MNE A;  4IOA Q;  1HI8 A;  5CD4 A;  1HD1 A;  1H6K X;  2CXE A;  3A8I A;  1JXE A;  4ZVU B;  4HHU A;  2F4V F;  3H42 A;  4LFB J;  1M90 T;  2R8J A;  4HR2 A;  3I9V 9;  2OPP A;  2HRU A;  2OP5 A;  3M8P A;  2C22 A;  1IKW A;  4EYH B;  2XMT A;  4G3I A;  4UUX A;  4OLP A;  2HQG A;  1ZAV A;  2GGP B;  3RRH A;  3AAW B;  3VCD A;  3R1L A;  4J9V A;  4TQR A;  1RHM B;  3GCX P;  4IDK B;  1IUJ A;  3P6Y C;  3PRV A;  3MPW A;  3VAH A;  3NP5 A;  3CVK A;  3I5C A;  4FKX A;  2LCW A;  2JWN A;  4LF8 J;  1RT4 B;  1YRT A;  4Z2X A;  3MGJ A;  1FWK A;  3CCV S;  2OMO A;  3CCS S;  1SJ4 P;  1CVJ A;  1S1V A;  2KRR A;  2LP4 A;  1CBK A;  2LU1 A;  1X5S A;  2YKN B;  3AA9 A;  1D8Z A;  1SH0 A;  3GPA A;  3H5U A;  3MM6 A;  1YRX A;  4PQA A;  1I3O B;  1GMW D;  4RW7 B;  2QA4 S;  2XS7 A;  1TAU A;  5F9N A;  4I2P B;  1HBO B;  2XCA A;  3LGN A;  2IYG A;  1UVI A;  1EHW A;  4I2Q A;  4W4M A;  3JSY A;  2JOQ A;  2N82 B;  3Q89 A;  4YUD A;  3M2U A;  2FIU A;  2XTJ P;  1KVI A;  3T9Z A;  1Q81 T;  4ZK7 M;  2C2D A;  4USU A;  1I94 F;  4JYA F;  4DV4 F;  3PKM A;  1Y3J A;  1NPR A;  1RWX B;  2HQI A;  2Y3Y A;  2D7S A;  5L9X A;  4RZR A;  3M8S A;  2XB2 D;  4N76 A;  3E51 A;  1FKO A;  1H0H B;  2QL9 B;  4XIU A;  4HYK A;  4P2S A;  4C4W A;  2UUC F;  2AP6 A;  1ZTW A;  1FDA A;  2Q6B A;  1Z2L A;  4B3S J;  2OH2 A;  4X4S A;  4WU3 A;  4AXJ A;  4DV1 F;  2ACY A;  4PYD A;  4ALZ A;  1YHQ S;  2FLP A;  1O6X A;  3GLJ A;  1NJW A;  2C3P A;  3M30 B;  3FSI A;  4QIE A;  2KM8 B;  3AFG A;  3EVM A;  4D3H A;  1KN6 A;  2QRR A;  4B9U A;  2V9K A;  1TL7 B;  1VK8 A;  3K57 A;  1FFG B;  1EP4 A;  1GX5 A;  1S57 A;  1V3Z A;  2WZ1 A;  3NOG A;  4U8V A;  1R3N A;  3GIR A;  2W01 A;  2B4P A;  4DF8 A;  3T6B A;  1CEZ A;  5HP1 B;  1SC1 B;  3N4W A;  1RAB B;  1CJK B;  1B0P A;  3H4D A;  1MLA A;  4JI1 J;  3QFW A;  2WB1 D;  3HLU A;  5KG6 A;  1C1B A;  2MST A;  4LF8 F;  2AGO A;  4EWT A;  4ED5 A;  4UZB A;  1G7C B;  1T94 A;  1VHI A;  2E1C A;  1T3N A;  4FYW B;  2E5L J;  1GQE A;  2W2O P;  5KG4 A;  1Q8L A;  3ETO A;  3KG1 A;  4IRK A;  1SL0 A;  5IZH A;  2PN6 A;  2A0F B;  1TEL A;  3CGI A;  4C0O C;  3VZH A;  2HZV A;  1FK9 B;  1RQ0 A;  3TX8 A;  2PO4 A;  3I4P A;  5I3U A;  1YJ9 S;  4XPC A;  4OZ1 A;  1Q1K A;  2PDA A;  4ECW A;  3S01 A;  3R5J B;  4EMD A;  3KJV B;  1X60 A;  2OO4 A;  2OJ3 A;  4ZJL A;  1SXL A;  2HWH A;  4UW2 A;  4BBY A;  2VKZ G;  5ETT A;  3VTI A;  1CC7 A;  3CED A;  4GVB A;  1DLO B;  1NK0 A;  2D1C A;  3P3D A;  1VQO S;  5D4P A;  3QYY A;  2BQU A;  2GCF A;  2ILZ A;  2KT3 A;  2RML A;  4QIW D;  2RQ4 A;  1Q8B A;  2LXI A;  2YKN A;  1VQ4 S;  3FBB A;  4K4U A;  1IKY A;  1J2V A;  1WG1 A;  2BOP A;  5EUH A;  5KFY A;  3U1M A;  3NL0 A;  4USV A;  1NEE A;  4FKY A;  2AIR B;  2Q1L A;  5IT9 U;  3OTO F;  2R7U A;  1HIY A;  1H72 C;  2ZOF A;  2B8P A;  1CJV A;  2LEB A;  4ZMM A;  3M32 B;  4JV5 J;  5I42 A;  1Q86 T;  5J2M B;  1X4F A;  4LBH A;  4IO1 A;  1TK5 A;  4OZ5 A;  1PO6 A;  2HHT A;  4B9T A;  2D9O A;  2Q79 A;  2E7V A;  2RHS B;  4LSL A;  5I4M A;  2ILY A;  1IKW B;  4ECY A;  3MEG A;  2I38 A;  5ETO A;  3H7H B;  2AT1 B;  5SZT A;  3HD1 A;  4X4N A;  1RIS A;  4O4G A;  1KDN A;  1IR2 A;  2Q6C A;  3OVS A;  1DLO A;  1XEZ A;  3DGV A;  4W90 B;  2KT5 A;  4F67 A;  1CUL A;  1S59 A;  1NHV A;  1WSR A;  4V1A k;  2DNO A;  2LXF A;  4QR2 A;  4YDD B;  4YB5 A;  5HN0 A;  2BR0 A;  3D54 A;  3M9N B;  3PYE A;  1OJ4 A;  5EWE A;  1WC6 A;  1S4E A;  4AL5 A;  2F9J A;  3MM6 B;  1SH3 A;  4RKU C;  4WFN Q;  1TFY A;  5U47 A;  2XHW A;  2KRB A;  1QJH A;  1S1V B;  2DGS A;  4RNH A;  5KFU A;  2CVI A;  1WI8 A;  3I0R A;  4KPC A;  4QZV B;  2W4D A;  3PNI A;  1Y10 A;  5A8K B;  4EUV A;  3QQC D;  1UFL A;  4QPT A;  3LH2 S;  2QSW A;  4JI0 F;  2AYB A;  2IRY A;  2NQP A;  4X84 A;  2R7Q A;  2R2T A;  2EWH A;  3DOL A;  2RKI B;  4FN5 A;  3HD2 A;  5GAG U;  3BQ1 A;  2MSS A;  1S9E A;  1RHQ B;  3OBI A;  1HQE A;  1YG0 A;  2VQE F;  1NJZ A;  1I51 B;  2JRS A;  4DQP A;  5F8J A;  3G4S S;  5HI7 A;  1EET A;  3C6T B;  1NK4 A;  1R6V A;  5J1P A;  3C14 A;  3BDE A;  3J81 U;  1PC5 A;  3OFE A;  1UP1 A;  4TYA A;  4WJB A;  1ZET A;  3MAQ A;  3ONQ A;  3A3N B;  4UOG A;  1SKW A;  4FF1 A;  1TFW A;  4J91 A;  3QLH B;  1KHV A;  1KNZ A;  1MWY A;  1RT2 B;  5H1S V;  4RBT A;  2KXH A;  3CJ0 A;  1HPZ A;  3JS9 A;  1U0H B;  3D6H B;  2XM3 A;  3IC1 A;  4LF6 F;  1UJ6 A;  1S1X A;  5K8M A;  2CNK B;  4IR9 A;  2YTC A;  4PWD A;  1LWF B;  4TLR A;  4KIA A;  2ZFH A;  2Y1L B;  4LF5 J;  1U8S A;  1VC0 A;  5THW A;  1JLE B;  2HGL A;  2ADB A;  4DSJ A;  3C8Y A;  1WC3 A;  1VRT B;  5EDW A;  3LD7 A;  2XSJ B;  4RLE A;  2AZ1 A;  3G87 A;  3PDN A;  3NBP B;  1SIZ A;  2NXE A;  2QTW A;  2PE8 A;  2C2K B;  1SV5 A;  3NCQ A;  4KH0 B;  3LQV A;  1FXR A;  2COL A;  2OD4 A;  2ROG A;  2V5H G;  3M6X A;  2BQ3 A;  4OFZ A;  3ILL A;  3D7S B;  2MHN A;  3PX4 A;  1QTM A;  2XGQ A;  1TKT A;  1M5P C;  4KHR A;  3IFE A;  3IWX A;  1RWN B;  4DL4 A;  4B3O B;  4ZLP A;  4DV2 F;  3C15 B;  1S6P B;  2CPX A;  3HHE A;  4NWB A;  4P71 A;  4DCP B;  4Y3C A;  5F3Z A;  3OSP A;  4JI0 J;  5EN1 A;  1FKP B;  1QE1 B;  1Q7L B;  5K8N A;  5A2Q U;  1OWX A;  2DH8 A;  2L41 A;  4KO0 B;  2HS3 A;  1E6V B;  1SUQ B;  3MR7 A;  2D3O R;  3R3T A;  4O3Q A;  2WSC C;  3M8Q A;  5C42 B;  3PIP Q;  2ZBC A;  1JLF A;  2BDP A;  2QFJ A;  2VIH A;  1DY3 A;  1P6T A;  4DQR A;  1S72 S;  3P8B B;  2HFS A;  3CJT A;  2D74 B;  3DNC A;  3ZXW A;  1LKZ A;  3DFE A;  3MI7 X;  5E3R A;  1HNX F;  3C3L A;  1A9N B;  3LP2 A;  2ZWO A;  2OEM A;  3HCX A;  4ZVE A;  1J5E F;  4EBD A;  2I6W A;  2ADC A;  4YR0 A;  4FXV A;  4DUY F;  3PW5 A;  2AD9 A;  1N54 B;  1VGY A;  2CQG A;  3DLH A;  4NLV A;  5A2Q Y;  3PW7 A;  2HK3 A;  4MK8 A;  3UVJ A;  3OTO J;  2RNE A;  3OR1 A;  4I7F A;  4ATN A;  1M0S A;  2X7I A;  4LIR A;  3BJY A;  2W7P A;  1RCX B;  2R8K A;  1YTY A;  1HBU A;  2FZC B;  3NAI A;  3JQM A;  2AZ3 A;  2AGQ A;  4DCO B;  5L1I A;  4HI1 A;  3FBC A;  2CG4 A;  3FRZ A;  3A3O B;  3NEK A;  2AYE A;  2CPD A;  3DMJ A;  3L95 X;  3CCZ A;  2H65 B;  5IWA J;  1S79 A;  1VMB A;  2AKW B;  2CPF A;  1U47 A;  2MZS A;  3TRG A;  2KDO A;  4F7V A;  1WI6 A;  3KG0 A;  2B0G A;  3V5R A;  2MQM A;  2R9L A;  1VJW A;  3ULH A;  3O6Q A;  4O3P A;  5KFR A;  1RI7 A;  3CC2 S;  4F8R A;  4LFA F;  4CI0 B;  5IOL A;  1OIA A;  3TZX A;  3F73 A;  4Y2I A;  2HBY B;  2BQR A;  2XC9 A;  4K4V A;  2BKN A;  3BH7 B;  3W2W B;  2DNN A;  2VJU A;  2IVM A;  2YQ1 A;  3KJN B;  2FHJ A;  4HI2 A;  3UR3 C;  2KYZ A;  2RIJ A;  2CUY A;  2VPZ B;  4DCJ B;  3EYZ A;  4JI2 J;  4PUO B;  2QZ8 A;  1EKR A;  1B99 A;  1U25 A;  3GFX A;  3KYL A;  3RB3 A;  3DYA B;  2D3O 1;  1TMM A;  2VH7 A;  3FJ2 A;  2VC1 A;  4NLP A;  4BC9 A;  3FNN A;  1UPM B;  1RGV A;  1TVR B;  4JBC A;  4CQ1 A;  4CYU A;  4F3M A;  1VQP S;  1U1O A;  3EIC A;  2JLE A;  3BV8 A;  2IMO A;  2D9P A;  5BJR A;  5DG9 A;  2DNL A;  3I0S A;  2JFD A;  5BR8 F;  3TOQ A;  3KLE A;  1RT7 A;  2ZH1 A;  1D1U A;  2KFZ A;  1TTH B;  3WX4 A;  4WCE Q;  3A12 A;  1LXN A;  4GMK A;  4LSL B;  4ECQ A;  4J9L A;  2ZH9 A;  2IVF B;  3OVB A;  2B6A A;  3ZTP A;  4PG7 A;  3JAM Y;  3TAR A;  2AJ4 A;  3HHN B;  2G2Z A;  5FLX U;  1VQ7 S;  2C3O A;  4CT9 A;  2AU0 A;  4J7C A;  2Z30 B;  1QE1 A;  1RTH B;  3DDN A;  2VIC A;  1HPZ B;  2H5E A;  3C66 A;  4NCG B;  4OI2 A;  2CAD A;  5K20 B;  3VAL A;  1GMV A;  4ED0 A;  5IT9 Y;  1AA1 B;  1XER A;  3CJR A;  4WK3 A;  4A4J A;  5D0G A;  2QC3 A;  4QU7 A;  4YB1 P;  1S5Z A;  3TQE A;  5I3P A;  2QA2 A;  5A8R B;  3HDS A;  4RU2 A;  3HF5 A;  1RTD A;  4B3M J;  2RRB A;  2LFV A;  3QO9 B;  1WG5 A;  2QMX A;  4X4O A;  3D6F B;  1X8D A;  3I5A A;  1N5V A;  5E3C A;  2R7W A;  2KN4 A;  3BSA A;  3RU0 A;  3QZ7 A;  2DXD A;  3QSY B;  4TU8 A;  3NBP A;  3EWG A;  3PRD A;  3PYD A;  4DJB A;  2MLX A;  4DQS A;  3BN4 A;  1W2B R;  3SQG A;  4DU8 A;  1L3V A;  4XAK A;  4GO7 X;  4O3O A;  5F0U A;  2PC6 A;  4IFV A;  3O8W A;  1BWV A;  2GVD A;  2J5A A;  3NGK A;  3PXG a;  4RW6 B;  3R9L A;  3Q83 A;  2EFV A;  3KK3 A;  2ZD1 B;  4A8Q A;  3PY8 A;  4M63 A;  3J7A N;  2DEI A;  5J1E B;  4J90 A;  3FMW A;  5KFD A;  4KRW A;  2KXN B;  5KFH A;  4P75 A;  5KFV A;  4F2S A;  1SQF A; 
#chains in the Genus database with same CATH homology
 2XHC A;  4OBI A;  1NPR A;  1NPP A;  1M1H A;  1M1G A;  2EXU A;  4ZN1 A;  3QQC D;  3EWG A;  2OUG A;  1NZ8 A;  4ESN A;  4ZN3 A;  3LPE A;  3LD7 A;  2K06 A;  3H7H B;  2KPP A;  3P8B B;  2LQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...