1M1HA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group i222
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
182
structure length
182
Chain Sequence
QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 40
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1hA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1hA01
4ESNA 1NPPA 3LPEA 2OUGA 3H7HB 1NZ8A 2LQ8A 1M1GA 3LD7A 2XHCA 3QQCD 4ZN3A 3P8BB 1NPRA 1M1HA 2K06A 4ZN1A 4OBIA 2EXUA 3EWGA 2KPPA
chains in the Genus database with same CATH superfamily
3IAS9 1NK8A 5IS2A 4PQUA 4LREA 4U8YA 2FZKB 2ZDOA 4HI1A 1Y9OA 4OZ2A 2BXJA 2LVWA 2DITA 4OYXA 5IC4B 2CFXA 4ATNA 4OBIA 3W9HA 1R27B 3G8SA 4ZPBA 4GKJF 3MDFA 3MM5B 4NCBA 4DV2F 2MKCA 2R7RA 1UZHA 5CD4A 5C25A 3T5KA 4KPCA 7AT1B 3AJ2A 3D0HE 4ZJOA 2HWIA 3IS9B 3E01A 5ETKA 3EWGA 1GXTA 2MTLA 4ENOA 3UPFA 4OHWA 1SQEA 3BBCA 4DCOB 4F67A 3LD7A 1RAAB 2IAJA 1S1UB 4R5PB 3GSDA 4DQRA 3DM2A 1C1CB 2HRUA 4OLOA 2CJKA 2VG6B 3KUEA 4DFJA 1B0VA 1FERA 5EDWA 4H4OA 3DHWC 2YKMA 4YR2A 5F0UA 1V5VA 4F4YA 1U48A 4CLKA 4LF9F 4ITSA 1NSKL 1F5BA 5AT1B 3IO1A 4Q8EA 3CC4S 4X4OA 4GMKA 4QW8A 2Y3YA 1AUDA 5K14A 2IJNA 1YJUA 2CJXB 5LMNJ 2D41A 1JLBA 1BE4A 4HACB 3AD7C 4NASA 3ZXWA 2F63A 3B4DA 1WACA 2R8IA 3M6VA 4IH7A 1C0UA 4TU7A 1JJCB 3NAIA 3GZ7A 2C2MB 3TEGA 2FHOB 3PO4A 3AD8C 1S0OA 2KPPA 1JX4A 1VISA 1RT1B 4A47A 1HNXJ 2VA2A 4DSEA 2M4MA 2MZTA 4DR7F 3NGUA 4ZN3A 2QFIA 3OR1A 2FUG9 2Z56B 1X8DA 1U0HB 2PT0A 4BWMA 3R2CJ 1EETA 1H2TZ 4KFBA 4Q0BA 2MQQA 3DC2A 2GFFA 1F9FA 2FC8A 3G9CA 3MMAA 1Y5IB 2U1AA 1D8YA 2HHTA 3KG4A 5ETLA 5D6GA 3OVSA 3HZEA 4JI1J 3I32A 1ICEB 3E2EA 3IBWA 3SI8A 4KKOB 3PM9A 4IH5A 4ECVA 2AJ2A 5C24A 3RR8A 3Q83A 2WVDA 1TL5A 3GU0A 4J91A 2OEJA 3QYYA 3MFHA 5CZXA 2AJ1A 2CNOB 3SV3A 1U09A 3U02A 1D9AA 1RXOB 3AA9A 3W5ZA 1IKXB 2ASYA 2CPXA 4DPXA 3MEDB 1HWJA 2H4YB 3BF4A 4ZPWR 4I7FB 3ULHA 2EC0A 1TMMA 1HNIA 2A6OA 2PC6A 3D7SB 2IMWP 2MZJA 2D3UA 3FFIA 3W66A 2HQGA 2DPJA 4XPEA 2GZOA 5K5MA 2V8DA 1RHRB 1PG5B 5CYMB 5IV4A 1TUGB 2ALYB 3FCWA 1KKHA 2C2DA 4TQSA 2IBOA 3KNGA 2YTCA 3MD3A 3CJKA 4WYLA 3PTWA 4M63A 2H48B 4EWTA 5CCLA 5A6WA 1RHKB 4DHVA 3MR5A 4PXCA 1B64A 2UV8G 4IRKA 2R7VA 4XTTA 2E66A 3K5MA 4J9SA 3PFOA 1RT7A 2L3MA 3BBBA 3BN4A 1VK3A 3HHLA 4TYBA 5HMYA 3CWJA 2UXBF 4O0IA 4C3LA 4B9NA 5KT6A 1MSWD 1S4FA 3MUTP 3BKTA 4DUTA 2E29A 2XM3A 3F73A 3OL9A 4KGXB 3Q24A 5L1JA 2D74B 3TOQA 1KD1T 5EGYA 4NWBA 2ZZNA 4LQ9A 3PW2A 3VGTA 2KVIA 3LGNA 2Y8WA 5J1EB 1X7VA 2X1FA 1L3TA 1CS4B 3QAUA 2FHJA 1U6BA 4WP8A 2OO4A 4WU3A 2ZM6F 2I2YA 4AQYJ 1VYAA 2OFGX 3U1LA 1O51A 3I5AA 5L1KA 3CULA 3M7VA 4FP9A 5IT9U 4FKXA 4EEYA 5IT4A 1S1VB 2J76E 2FZGB 2LA6A 3NAHA 1TL1A 1UVJA 1RP5A 3SFUA 3RTVA 3H5YA 4A8FA 3RB4A 2C2OB 3EGNA 4WK1A 1HL6A 2DH8A 2E5HA 5LT5A 1O5JA 2DNYA 3WIVA 3FVYA 4LF4F 3LOUA 3QLHB 3LP1B 3KJVB 1FTRA 1LWXA 1FX2A 1WHVA 5HMXA 2BE2B 1N0VC 1WNEA 2VJVA 1KLMA 3IRXA 1EARA 4WK3A 1UA1A 1Q8LA 3JTOA 3ONQA 3LAKA 4N5SA 4DWIA 3AOCA 3QZ8A 5DDOC 4WFYA 3CJ2A 4DSFA 2ZVIA 2DR9A 3L3CA 3CUNA 4IFVB 1C1BB 2DHSA 3MCMA 3P96A 5F9NA 3LF0A 2QG9B 2BE7D 4NCGB 3ILIA 1S59A 1S1XA 2K7KA 5CAAA 2V4JB 1ZM9A 3FNNA 3V5RA 3UN2A 1EKSA 4F4WA 3CDEA 5CD4H 1TV6B 2A3JA 4RWWA 1ZA2B 2OPQA 3DLGB 1PCAA 1HQUA 3ETOA 3CXCR 2K3IA 3FEXB 1HNVA 4X4TA 3G8QA 2IM1A 1YJNS 1SKWA 2BW2A 3MMCA 1NO8A 4R8UA 4CO5A 1QVGR 1X9WA 4ZP7A 3QWUA 3FBCA 4HYKA 1S1TA 2HNDB 5FD1A 1HBUB 1ELOA 2CDQA 2ROEA 3WQPA 1SV5A 3OVBA 1YRTA 1RHQB 2UVRA 3CJ4A 4GO5X 3VVUA 2OP5A 4JYAJ 2Q6CA 2V0NA 1VBYA 2GIFA 1CSJA 2N3OA 2HLUA 3QFWA 2R2RA 4USJC 1HMVB 5M2UA 2ZBPA 4UQTA 3DGPA 5KFJA 5CABA 1ZZNA 3G82B 1RUSA 4YY3J 2NZ4A 3W3SA 5LJ5Y 4DN9A 5HVHA 3ILLA 2VJUA 2J8AA 1ZTWA 3VAJA 3NS5A 2DGWA 2FLNA 1RKIA 2OD6A 1IJFB 5D3GB 4B17A 2ERRA 3KXDA 1WKKA 4BS2A 2W4CA 2NUUG 4CNYA 1RAIB 2BQUA 3TRGA 3K5OA 1OJ4A 1F2HA 4LSNA 1GX6A 4UOHA 2HIYA 1TTHB 1WD6A 1NDPA 3A8KA 2VC0A 3GFXA 4QCLA 2BRLA 2YPZA 2B9EA 3RG6A 2VD3A 2DRDA 2E1PA 4ZLPA 3H40A 3RRKA 1S6PA 4OX9J 3DOKA 1YWXA 4DX8H 3H0PA 3MMBB 2YKOA 1S6QA 4NI2A 3CB4A 2MHEA 4N41A 2QRRA 1FXRA 3GJSB 3P3DA 1UFLA 2GHVC 3OR2B 4CO0A 3HXMA 4DMZA 2V2VA 1GAOA 2PIIA 3OD2A 2HG4A 1SJRA 5A76A 4I1TA 5FDLB 1XMBA 5C2CA 3NS6A 3R1HA 3FJ2A 2E1RA 3GV7B 2FJBB 2F4FA 4UOGA 3K58A 3C3LA 4NYOA 3Q22A 3IM8A 1ITPA 4C6AA 1XNRJ 3CCRS 2RRBA 5G0RB 3PW5A 2F4VJ 2DHHA 1G4CA 4ECUA 2B3TB 4GKKJ 4OV1A 1N5YA 3HHNB 1Q4RA 4ECRA 2Y9HA 4CM2A 3MECB 1OY9A 4DZDA 4PG6A 4I6YA 4B3RF 3KG0A 4USTA 4S0MA 2X51A 4NA3A 2F65A 3LH2S 3DRSB 2F8MA 4JUZA 4KYZA 4QPTA 3ISNC 5I42A 3VALA 4UZCA 4LSLB 4DL7A 1J5OB 1X4FA 2D3OR 1FJCA 3K5NA 2MEWA 5CHCB 1NJZA 3OFHA 3O2IA 2E1MC 4J9VA 3LO3A 1M5KC 4MIWA 1NK7A 2XHWA 3DDKA 3Q86A 4M94A 4ZCMA 2J8SA 1MMDA 3EZUA 3NP5A 3CMES 1RT6B 2D9OA 1WG1A 3PFEA 1N6QB 4RBTA 3M05A 2UXCJ 3QT8A 4CO3A 3L4BC 2WONB 1J5EJ 4HT5A 1OO0B 2G9OA 3MM5A 4KC5A 5DZ7A 5C2GA 2WVBA 4IRDA 3A3PB 4DV7J 3PKMA 2VA3A 2HHPA 1WEZA 3IS9A 4V19J 3EYZA 5IZHA 5KG1A 2K06A 2ZBIA 4D3HA 3I82A 2ZDPA 3G6ES 4U7UK 2QL9B 4JI0J 3MZIA 3H59A 1WWHA 5KFEA 4LT6A 1S1UA 4R5PA 4HHJA 2RRNA 1J2VA 1TP7A 3H2UB 2BOAA 3V6JA 3H42A 4U7CA 1P27B 2XGQA 4CT8A 3BH7B 1U1LA 5HI7A 4ECZA 2X7IA 2EEYA 2GNKA 2RT3A 2EBGA 2B51A 2YH0A 3KJQB 2JVOA 2HBQB 3A8IA 2AHOB 2HHHF 1NLKL 1FD8A 1F6TA 3BR9A 2CJ9A 2IVYA 5KFWA 3NCPA 3D3CJ 2DH7A 2HS4A 2M8DB 4HACA 4RLEA 4MK7A 2RU3A 1FHTA 3B8HA 5CYQB 5D0HA 1RAEB 2CWXA 2H1YA 1SC1B 4FKYA 2XC9A 3EUNA 3QO9B 3NGKA 3I56S 2CADA 1YJTA 5FLXU 4X4PA 2BX6A 5KG0A 4PXEA 2H9ZA 3P4UB 4GC6A 1RT1A 4J9LA 3P45B 2O67A 2ZNZA 4USVA 3PXGa 1NJWA 3BO3A 1HD0A 1YZ6A 2UVVA 5B0EA 1KVIA 2QZ8A 4FF4A 5F8JA 1E6YA 3H5SA 3MGJA 4FXDA 4ZOSA 2HWHA 3A13A 5KFHA 1ZS6A 2EXUA 3U1MA 3PO5A 1AROP 5FIIA 3BPDA 3R7NB 1C2PA 4OIXA 3HJFA 3OLBA 4TNOA 3J80Y 1NDLA 3R27A 4F4KA 2MSSA 2RDIA 1AZSB 1TAQA 3MFIA 4OHXA 4KKOA 2HFOA 1DZ5A 3BQ1A 1TFWA 3D0GE 1REGX 2RD5C 4OX7A 4NLVA 1RTHA 1H7XA 5GADI 1VRTB 3OTOF 4MAKA 2OTLS 3Q8RB 4L6V3 5RUBA 1IBKF 2RF2B 5C42B 5B0CA 4PWUA 3ENVA 4HKQA 1NHUA 2A10A 3D6TB 2G2YA 2FVPA 1VQYA 4I7FA 4L3KA 1BUXA 4DU8A 1XMOF 1DQ8A 1G1XA 2CQIA 3N79A 3FK4A 5D0GA 1X4GA 1NDKA 3HULA 4LF7J 9ATCB 5CYMA 2P9EA 3JAMU 3GV5B 1FRMA 2XS5A 1SC4B 1RTJB 2EKYA 1AFIA 2V67A 3ZO7A 8ATCB 1Y5LB 2OGUA 1NHVA 3A3NB 1F3VA 4CH7A 2GJ2A 3FSIA 4OJGA 1SIZA 5L1IA 2MKKA 3QIPA 5B7WA 2R4FA 3Q89A 2QLFB 4DV6F 4LR8A 4ICLB 2CNLB 4DR5J 1L3KA 4UQGA 1SC6A 4URSA 2XB2D 4TU8A 1TKZB 1UMJA 2OMLA 1L3SA 3KHGA 1UP1A 3H4BA 2RUSA 1YKWA 1KC8T 3GYXB 4JI5F 4CO1A 4ZPDA 1ZBTA 4PR6A 4C8OA 2H65B 1MWYA 2WRMA 3KJFB 2MKIA 3I31A 1MLAA 5J1EA 2J5AA 2UU9J 2V8VA 2I9SA 1W7WA 2KO1A 4ELVA 4RW9B 1MWQA 3DOLB 4DS5A 4KPYA 4OHYA 1IKWB 3J7YU 1DQAA 3MD1A 3PY8A 2UUBF 1FNXH 3BB5A 3KMQA 1I5OB 4KV8B 3ZNUA 1OSCA 2DGQA 3MM7B 1FDAA 3US5A 4KO0A 2EVZA 4GRSA 3HSGA 1VQ8S 3THPA 4X64F 4DR1J 4FNHA 3E51A 5KFFA 1SL2A 3H98A 3W63A 2F7VA 3K5PA 5IOLA 1GMUA 1HNZF 4MYUA 5HMWA 2PGCA 4X84A 2M0GB 2FJEB 2DNQA 3NY0A 1BMQB 3UDEA 2DT9A 3QLHA 3LP1A 5F8IA 1WF0A 5J1NA 3KJVA 1ZPWX 2ZFHA 3BREA 2D9PA 4JI2J 2CVEA 3QWPA 2DK2A 5GAHU 2HZCA 4C0OC 3OPKA 2NR0A 4QIFA 2ZBRA 4X2BA 1JJ4A 2FVCA 1AYEA 3K17A 3KK1B 1S9GB 2KT2A 1HI0P 2UUTA 4IFVA 4K4WA 2LQ9A 2BDPA 1C1BA 4DV1F 2RU9A 3KK2A 3SDEA 4AT1B 4M5IA 4GKJJ 2JL9A 2ZEJA 4NCGA 4DV2J 5KG7A 2V4JA 1HR0F 4U67Q 3SCLE 1RTDB 3R97A 5IM0A 1X4CA 3DNCA 2H3EB 5KFIA 3CJ0A 3DLGA 3Q8PB 4ED7A 2MPUA 1KDNA 2RS2A 1ZOTA 5ETSA 1YG0A 4NOHA 1KQGB 3KK3A 2VBYA 2QLWA 2PI5A 4ECTA 2GC8A 1Z2ZA 2RKIB 2XZDB 2NYIA 1KLNA 1UVKA 4ELUA 3L7UA 1GQEA 1YDLA 1HBUA 1AW0A 2W4DA 3TAQA 2QO3A 3W65A 1NSPA 1WG4A 5J2NB 1LWEB 3ENWA 2F40A 2AX0A 1QY7A 1X9MA 1IXKA 2J9DA 2KYXA 3FKBA 1KQKA 4KTQA 1IQZA 4ED4A 5KFCA 1NKCA 2AYGA 3D68A 1HMVA 4V1Ak 4NXNF 2NS1B 1OY6A 3CCLS 4DV4F 3GCXP 3FRZA 4WF9Q 3OFEA 2ZD1A 4M5JA 1FKPB 4B3TF 4V19X 1WOSA 2KKHA 5T14A 3LTOA 4M1KA 2B5JB 4YMEA 2E9TA 5D3GA 4IRCA 1FEEA 4CP5A 3M1VB 2VC1A 4A8OA 4DR7J 3CCJS 2DPIA 3GIJA 1TU0B 3OXLA 1OS5A 1WG5A 4RWXA 1XC9A 4JV1A 3RB0A 2X3GA 3RJMB 2F5GA 1CJUB 1VQ5S 4EO8A 3KMSA 4DSKA 2MLZA 3ZZYA 1LEOA 5KFNA 3CDBA 2R8HA 3TZWA 3U1NA 4WU2A 4PG4A 2OPRA 3D6HB 3NKYA 3I0RB 4ANDA 3RGIA 2R7QA 4O3RA 3MMBA 5A2QU 1F5AA 3TR5A 1XQIA 2PMHA 3OSNA 1K1QA 3GCWP 1EB0A 1OYDA 3RB6A 3OR2A 4EO6A 4WP3A 4B02A 2C28A 1GMWD 3W2VB 2VASA 1OPIA 4LBIA 4IG3B 2QA1A 5JMNA 5H9EK 4DPWA 1RWVB 3B82A 2CIMA 1JNZB 3JQMA 1Q0NA 2QT7A 3FSXA 1K8AT 3P8BB 5G0RA 3EVWA 4UW2A 3SBMA 4ZCIA 3KLFB 4OX8A 5E3CA 3MPYA 4LF8F 1HYSB 2J6SA 1RHUB 5AE2A 1JIHA 2XO7A 4WFXA 4IH6A 1CQMA 3M2VB 5B08A 1WHXA 2MKYA 2QFJA 5EUHA 4LSLA 1J5OA 4IOCQ 4HH1A 1YBUA 8RUCA 4IG0B 4K50A 2AGOA 3ZTRA 2IHR1 3QSYB 1U45A 1JXVA 2UXBJ 1F60B 3PX4A 2VF3A 1UVLA 4F2RA 1RT6A 4DSLA 1N6QA 1APSA 3N9UC 3OFFA 2WONA 4FYXB 2MQOA 4Z37A 5KTQA 2E9ZA 4DX6A 1FJEB 1RDRA 2IMOA 3HLUA 1WDTA 2ROPA 3PYEA 1WSVA 5IV3A 1FDNA 4C3MA 2ZM6J 3NS7B 3MUVP 4X66F 2R7OA 1F1BB 3Q2TC 2FHKA 3QPIA 3NLCA 1PAEX 3LQVA 2ADBA 4LFCJ 2FJVA 4GC7A 3HP6A 2VZ9A 1RBLA 2PMZD 1MROB 6FDRA 3E3XA 3RBXA 2PD1A 2QX0A 2KI2A 3POTB 2XI3A 2XTJP 2F1FA 2CDRB 3M2RB 1NRKA 4LF4J 2OPPB 3W61A 3DMJB 5ETTA 2IPOB 3FQKA 4MMOA 1D09B 2YWEA 4DLGA 2O5DA 3AA8A 1Y0HA 3I55S 1IWAA 4ZPAA 5AXLA 2YQ2A 4J9QA 3M8QA 4B9SA 1WTFA 4LIWA 1YJWS 2DGXA 1IBLF 4NA2A 3KLGA 3QO9A 4Q43A 2DGSA 4YR0A 4K4VA 3HD2A 1NJYA 4B3SF 4UOFA 3EJMA 1BQXA 1H98A 1S6UA 4GO7X 5K8MA 2H5JB 3KDOA 3CJ5A 1DAXA 2QA4G 3ADAC 3CC7S 2DGTA 6FD1A 1HI8A 5JJBA 4J9KA 2NREA 3NEKA 3EVOA 2W9BB 3IMQJ 4NMLA 4QWBA 1R8PA 5KFLA 4DCPB 1Y10A 3MR6A 4MKYA 4QIEA 2NQPA 2G0JA 1O8BA 2COLA 3CCTA 4NE9C 1BY9A 2QN6B 3IN5A 3ZZOA 4U6PA 3QIDA 1ZPVA 2ATCB 3DRRA 1EAYC 1AZSA 3DCAA 2HVDA 4ZIVA 1VC5A 4RW4A 2N7YA 1UPMB 1Q7YT 4W92B 5HMZA 4TU9A 3DRYA 2C22A 1VRTA 4M5HA 4DL5A 2P9CA 5HROB 3VAFA 3D2WA 1K73T 2RF2A 5HVGA 1HBOB 1T8EA 3GIIA 3W7BA 1N4LA 2VONA 3BGRB 4DX5A 2HVHA 2BJ3A 3HVTA 3LP2B 1HD1A 1RT4B 1RLCL 2R42A 3AJ1A 2ZH1A 3CJSA 2XYGB 3CGIA 3GYGA 3PG9A 2HEKA 2HVIA 4USWA 1RTJA 4ZVGA 2UUWA 1GT8A 1S99A 2PE8A 4N77A 1TL4A 4RNOA 4EGLA 2VB6A 3TQ1A 1UFWA 2NSBA 1G3OA 3S8SA 3M8SA 2HVZA 5ETMA 2D3ZA 1KTQA 3THVA 4ICLA 5LL6d 2HNZB 3MR7A 2MQNA 2W2OP 1TKZA 4I6WA 3BV8A 1UZDA 3BBFA 2KU7A 5KOXA 1Y3JA 2VDIA 2RRAA 3J81Y 4NLUA 1U2FA 2AU0A 2V8HA 4ED3A 1BQMB 2LQBA 4D3GA 2KFYA 1BXNA 4G65A 4NLSA 3VVTA 2YNFB 3SQGB 4A8QA 3J7A1 3KLIB 3BQ2A 2FJWA 1WELA 2V9WA 2RHQB 1IKWA 2VPZB 1S0VA 3CCWA 2DHGA 3A8JA 3M8PA 2CQDA 2YWWA 3JTNA 2GIQA 1RBOB 3CD7A 2C3PA 3MCSA 2DHXA 3DLLQ 3I87A 4KV8A 3MM7A 1LK5A 1PIEA 2MGZB 2BKNA 2YQ3A 3WX8A 4ZN1A 5BR8F 2CJYB 4H4MB 5CZVA 2EFPA 1VK8A 1R43A 1K47A 1N52B 2XS2A 2H51B 4B3RJ 2VFRA 1C4AA 1Q82T 2QTWA 2HHQA 2OEMA 4F0KA 3C16B 1S0MA 2RB7A 2XNQA 1YRUA 1TVRA 2B8PA 1YQHA 2L9WA 3LALA 3CT9A 2AT1B 4NZ6A 4WZMA 3W62A 2LXIA 3VGUA 1KEKA 1VLYA 3RBDA 3VAGA 3EX7B 1XN9A 3JSRA 3PIOQ 5D77A 4RNMA 1IM6A 1RGVA 3KK1A 4WFBQ 3QT5A 3GSIA 4ZVQB 4KHPF 1FRXA 2LEAA 1RISA 1K9MT 2LLZA 4O23A 2IBKA 1PBAA 1QM9A 3M8RA 3I9V9 3C6TB 5M2PA 4OLPA 2WTFA 3CD6S 1H2UX 2VICA 1QD1A 2VFTA 3DLEB 3GB0A 1WSRA 4UF4A 1V3RA 5AXNA 1RTDA 4FBTA 3M6XA 2LA4A 1TAUA 2R7TA 3CMAS 1HBMA 1JLFB 4LR7A 3RU0A 1S9EB 2R7WA 4UUWA 1D9DA 1X31C 4TKTA 3FDSA 1DLOA 4YY3F 4OYMA 1Q16B 5KFDA 1EHWA 4PUOB 3LP0B 4UT4A 2CQHA 2V4QA 1P1LA 2BYCA 2VG5B 4ZVEA 1NAQA 2VBXA 2XGPA 3SMZA 3DU5A 5CYJA 2Z2LA 2C3OA 1V5IB 4UY8T 4YB7A 2JLGA 5J2NA 1LWEA 1N5TA 5F8MA 1OQ6A 2JLFA 1GNKA 4K4UA 4L75A 3GG1A 1GTHA 2QGFB 5B0AA 1FTCA 2MY7A 1H3DA 2P9GA 3FZBA 1K1SA 1JLQA 2DBBA 3JQJA 4OJHA 3CCZA 1RLDA 2CPZA 1SH0A 2WK4A 4KRWA 3F0NA 3DLKB 4LIRA 4X4QA 2W1BA 1FKPA 1TL3A 1U0SA 2WB1D 1S4EA 2Q3PA 1R8CA 3V6KA 2NPFA 4F0MA 3NGSA 5L8RC 1UWBB 4ECXA 3EDQB 3M1VA 2GO9A 1RHMB 3HHLD 4QWDA 3AFGA 1OY8A 4J9UE 3Q0AA 4BBYA 4P71A 5I3UB 2ZHOA 3O8WA 3OT9A 5LM7E 1CJUA 1RACB 4J9RA 4PAAA 5CXTA 3GFYA 3IR6B 4GKKF 5K20B 4KB7A 4MKVA 4X4VA 2F9JA 2YNHB 4NLQA 1NM2A 1AUSL 2HIQA 4QYRA 4OI4A 4ZA1A 3I4HX 5L38A 2FHMA 2DEJA 3VAIA 2XBPA 3W2VA 3OTOJ 1T11A 3I6PA 2Y1JA 5GMDA 4UY85 1UEVA 1IBKJ 5E3RA 3KHLA 2W9AA 4XK8C 4DN0A 5A8KB 3UFCX 4BCAA 3FRYA 1XMOJ 3BQ0A 1HYSA 2XY5A 2KT3A 2UXCF 5J2QB 1SH2A 2DIUA 3M2VA 1QUVA 1X4HA 2Q66A 1JKHB 2N82B 4C11B 2RDJA 2ZH9A 1TK5A 5DQGA 4XPCA 1RABB 4WCEQ 4NLPA 5D78A 4MTPA 1L5UA 4G1IA 5LJ3Y 4DFKA 2W9CB 1D1UA 4IG0A 2HZAA 2U2FA 4DV6J 1AFJA 3N6LA 3A12A 2CQ0A 1U1NA 3KUGA 2YQ1A 1PAUB 4F25A 2BACA 4RUBA 2MKSA 4QQBA 2Y1LB 1CULB 5J2PB 4ZVSB 5GMEA 4OHVA 3N4WA 1G7CB 1ZM3A 3TA0A 4JI5J 4FXWA 1A0OB 2C2NA 1PGZA 2C1EB 2G0IA 3GP9A 1RJJA 2WZ1A 4P6QA 3W1YC 4DL3A 2W8LA 1EQMA 3OTCA 4ZVHA 2DNKA 4PABA 4WXWA 1H7WA 1R7IA 2D1CA 2QE5A 2EK1A 1G6BA 1R8BA 2UZAA 2UUBJ 3DU6A 1T0TV 2EK6A 3AQPA 3OTEA 4K4SA 2RDDA 4LRAA 2VBWA 1WUUA 4DSJA 4J9OA 4RW6B 3MTKA 3C15B 4X64J 1FEHA 1DARA 1MROA 2HBYB 1HKAA 4YUDA 4DV0J 1TUWA 3LPEA 1GEHA 2DTJA 3POTA 2KL8A 3HD1A 1RT2B 4RBUA 2OPPA 2J0SD 2W24A 3DMJA 5ETRA 3ZTQA 2VHGA 4RNNA 2WVCA 2IVMA 2LDYA 2GGPB 1MU2A 2WHOA 2AX1A 3OUYB 3HX9A 4CTAA 1TMJA 4LF5F 1W26A 2E5IA 2CNNB 3PHTA 1SL1A 1W2BR 1KFDA 1J27A 3QRRA 1WKLA 1DTTB 4PZVA 2EI5A 1A7GE 4DV1J 1U1RA 1EX8A 5BYSA 1RTIB 1M0SA 4QYZK 2VOPA 2XI2A 3S6EA 2C2EA 2G1HA 2X1GA 1HR0J 1BQNA 3R3TA 3TA2A 3TUPA 1DFDA 4MIAA 4DQPA 1RQ0A 4DS4A 2BQRA 3N6NA 2E1CA 5KFAA 3RZAA 1BC6A 3D0IE 3H7HB 2ZH3A 3R5AA 4KR0B 2MJNA 1BWEA 2R3VA 1YX2A 3EGWB 3GJRB 4URQU 3FQLA 2PFFB 1IKVA 3IWXA 1NCLA 1NPKA 1DRZA 5DGBA 4QWCA 2DNGA 5KFGA 1EP4B 2HQIA 2XNRA 1T95A 2VH7A 4F2SA 4A48A 2LEBA 1NK0A 5HROA 3VWSA 2YH1A 1HLWA 4KGKA 1SIWB 2APOA 1KR4A 1HBOA 2B6AB 4NXNJ 2DIVA 3ISND 1H0HB 1RT5B 2O1PA 5DDPC 3KNAA 3H5XA 4DV4J 2FC9A 5ETNA 2HNYB 4CYUB 2AYMA 1URNA 3BGRA 1IKYB 4F3QA 1X0PA 3LP2A 4B3TJ 1RT4A 4BLGA 1RWKB 2CQCA 2JNJA 5DM7Q 3NOCA 4O3SA 2A6MA 3KLEB 4OYZA 1UCNA 4PG7A 2XULA 4PKDB 4ES2A 3DYAB 1SKSA 4QPXA 2HBZB 2J0QD 3EM1A 2DNZA 4RZRA 2XQCA 2RQMA 1R0AB 3PIPQ 2AJ0A 2YNIB 2JEGA 3KHHA 3ICLA 2YX4A 4C0BA 2R8JA 2R8KA 2KT5A 4QR2A 2HNZA 3FBBA 5B0GA 3R7BB 4BDPA 4N7TA 4HL9A 3P5BP 2W7OA 1Q81T 3GJTB 1SPBP 2ZE2B 3N5FA 4MFBB 3OJUA 1AT1B 1P9YA 1WORA 5HBMB 2HFVA 1B3TA 3T1HF 4A8SA 2YNFA 2B7CB 3KLIA 3T6JA 2D3O1 5CCMA 2A0FB 2J0WA 4QW9A 4OYWA 3ZC4A 1B7FA 2KZZA 2KDOA 3CSKA 4AUKA 2KXHA 3PNIA 2ZC4A 3J81j 2V4RA 3RYLA 1FRJA 2RMLA 4LF8J 1JMTA 4AL6A 4YDXA 1HI1A 2B4OA 2CPFA 4H4MA 2CAJA 4NXMF 1MG7A 2CPYA 4N56A 1SBRA 3VCDA 1PO6A 4U7UD 1S72S 2CQGA 1NSAA 4C8LA 4Y2IA 2GX8A 4FYDA 3C16A 4J37A 1P1TA 1RWNB 4CO2A 4C8ZA 3LWLA 1FFWB 3NRBA 2GMHA 3C46A 5HJYA 2QJ3A 4UTGA 1YJRA 3DDIA 4K0KF 3PRBA 5CA5A 4C7QA 3SCJE 4KIAA 3KYLA 1LFWA 1LV5A 1DY3A 2XMUA 4C8KA 1DJ0A 5HQLA 2OH2A 4EMDA 2K1RB 5KG3A 2FIUA 2CYYA 3I0SB 2VL1A 5GAEI 3C6TA 3EMTA 3IG1B 2OTJS 4NLWA 1LWCB 4FYVB 2KH9A 4IO9Q 1FWLA 3DLEA 2HQDA 2OI2A 3D66A 3T6BA 2DRBA 3DXBA 3PZPA 2UP1A 4X66J 1JLFA 4UUXA 4HDGA 2HHSA 1NEEA 5GAEU 1S9EA 3HFVA 8AT1B 4O44B 1T3OA 1CVJA 1NH8A 1PKUA 2AYEA 3AB4B 4CH0S 4PUOA 2HKEA 4L73A 4OI0A 1WC4A 4ZKAA 3LP0A 5DETA 2VG5A 1S79A 3T19A 3MPWA 3RAMA 4TLQA 2J7WA 2FVSA 1Y3KA 3IBCB 2BMBA 2AYBA 1H2VZ 1TELA 1FNMA 4NPOA 2AJQA 2CJAA 2L48A 2AV5A 2WBMA 4YOEA 4OMFG 4DXLA 2E44A 1YIJS 3I5BA 2AGPA 3R5DA 5KFQA 4YEAA 1IBLJ 2WVFA 2MYFA 1GXUA 2N3LA 1VQNS 3MAAB 1DBDA 1KTVA 3T3FA 1KONA 2VFUA 3MR3A 3UR0A 4P74A 1U7LA 2GCFA 4B3SJ 2BJ9A 4PG5A 3FBFA 1V6HA 5E0OA 5GAGI 2OMOA 1UWBA 2V69A 3V2UC 5DS7A 4ERDA 1Y00A 5C5JA 1CJKB 4DG1B 4Y34A 3R5CA 4JB8B 2QSWA 1WC3A 4USIA 3OHBA 5I3UA 3AXMA 3P5TL 1RU1A 1B4SA 4BC7A 5AJ3F 5HLFB 1R8AA 5GAGU 3T9NA 3IWLA 3W2WA 4C8NA 1HPZB 1JLCB 1VQ4S 1SVDA 4PYDA 2FVQA 2BABA 1Q7LB 2HK3A 5B0DA 1AXQA 5KT4A 2WVEA 1FWPA 3PR4A 4KHRA 3CMQA 2PA3A 3TANA 4LJMA 4PPDA 1ZAVA 4KH0B 5B09A 1CJVB 2DVIA 4DPYA 1TK8A 3V6DB 1I94F 4X4UA 3TNVA 2KJWA 5A8KA 5KT2A 2F8HA 3C19A 2LP4A 1VBZA 2GHWA 1M5HA 3HHLC 1RTZA 3E01B 3JAMY 1OIAA 4YS2A 1JLEB 2XEXA 2CJQA 3U7JA 5J2QA 2JX2A 3SEOA 2M5YA 1KHVA 5DG8A 4ILRA 3DM2B 4C11A 1GFWB 4LBPA 5I3PA 3FEZA 5KFYA 2CPEA 4MYTA 4JV5F 3EGVA 3JS9A 1NK4A 2JFKA 2E5GA 1TFYA 5F8NA 1SJ4P 2W9CA 1X4BA 4ILMA 1PJ7A 3R5JB 3QGPA 1AA1B 1NB2A 3ZZZA 1XR5A 1DQ9A 5THWA 3TARA 1RB0A 2HRTA 4LFCF 4DL0C 5EHHA 3TX8A 1PJ5A 1FF2A 1JK9B 1MWZA 1CULA 5K14B 1QUPA 1JLBB 3IA0A 3TVYA 3HVWA 1R0BG 1T03A 4N47A 2KM8C 2KRRA 3HM9A 1Q53A 2ZKTA 4NYPA 3Q8QB 1YJ9S 2QYGA 2Q79A 2XMJA 2UXDF 3L09A 4B3MF 3TYTA 2G4BA 4OJ3A 1ZH5A 3O5TB 1UW4A 3VAKA 4DR4F 2QIFA 1K0TA 3D1QA 3OR1B 1T9VA 2VODA 1FDDA 2HHXA 5BR8J 4RW6A 4I56A 3OL8A 2MDAA 2M52A 3C15A 1HBNA 2KXFA 4CLSA 2WW4A 3LWMA 4B9MA 4DV5F 3SQOP 3JSBA 3OW2R 1RT2A 3AOBA 2ZJPQ 4JI8J 2C3YA 3CW2C 4WFZA 3G6XA 2ZUGA 4DR6F 3V81A 4F26A 3AH6A 4I6AA 4MKBA 2DO0A 5HN0A 3VHQA 2QMUB 2Z0GA 4YP3A 3BJYA 4ED0A 3UWTA 2QL7B 2DKOB 2XSFA 3JYTA 3N5BA 3UR3C 2XY6A 3R1LA 1Q8KA 4LFAF 4KHPJ 1R89A 2O66A 1DTTA 4J7CA 4DBQA 2GQCA 3ZZPA 1VQOS 3UD4P 3EXYA 1RTIA 4A8WA 4LFBF 3TI0A 2XWXA 2C2KB 1X60A 3TAPA 2UVWA 2ABYA 4NLXA 4JV0A 1S49A 1U1PA 2C2ZB 4ZDNA 1N33F 1I51B 4K7QA 3CJKB 3IP0A 2DO4A 5DRKA 2H4WB 4QZVB 2CJBA 5AXMA 3CCSS 2QEXS 3TAMA 4Q8FA 5A0YB 1RA6A 1B0TA 4RW8B 1KHWA 4NZ7A 2R7XA 4I2PB 5E5NA 5DG9A 1X5PA 2JZ5A 1C0TB 2QA4S 4FNIA 3LA0A 2G2ZA 2HGLA 1VI7A 5JXSA 5J2MB 4M8LA 1EP4A 2IRXA 1JJHA 3IGVA 4TY9A 4EU0A 4DCJB 2Z30B 3CD0A 2R7SA 2KFZA 4OJ1A 1WF2A 4C0HA 2B6AA 1GK8A 2CPHA 4B3OB 3AOAA 1RT5A 4BC9A 5FJ4A 2HNYA 4CYUA 3JQKA 4JP8A 1IKYA 4CLWA 2EFNA 2OPSB 4Y2KA 1KVKA 4E98A 3PEJA 5C7PA 2Z8QA 4OYOA 2AJ4A 3KLEA 2L9DA 3HSJA 4ILLA 2HS0A 3MM6B 5KFTA 3OJSA 4R25A 4TY8A 2HHVA 1A9NB 4A8MP 3DYAA 2OUGA 3WHIA 4ZVUB 1CJTA 4JI7F 1Q86T 3KUHA 4CLZA 3H8YA 4Z7YA 1G2EA 1R0AA 3ZZTA 3VV2B 5A8RB 3L7OA 1RE1B 4I2QA 2HAFA 3HSZA 3O3LA 4DUZF 3EICA 4XDCA 5KG6A 2NXEA 4U9RA 1TL7B 4H4KA 1EJ7L 2CZ4A 3KTQA 2W2MP 2VFVA 3CPWR 3IRXB 2M88A 2JC1A 2HZVA 4K5SA 3K8VA 3R6GB 4MFBA 4KE5A 2E5JA 3F44A 4M5NA 3H2LA 2RSQA 4U8VA 5HBMA 2LXFA 4C4WA 4CO4A 2VDHA 4RU9A 1TK0A 3PJXA 1NSQA 2V50A 1RWXB 4P7TA 4KSEB 2BM1A 3L9ZA 2DRAA 4HHHA 3QJJA 1QE1B 2YKNB 2ZH7A 4PYAA 4DJBA 2GV1A 1ACMB 2I6WA 4IYQA 2RIJA 3D28A 1D9FA 4J9NA 2RHSB 4F4ZA 4M5DB 4NZ0A 2DCUB 3Q23A 4NRTA 2XZTB 5HQMA 3BM7A 2MLXA 2CNKB 1WJ9A 3MMCB 4WKYA 1GTEA 4JI4F 5L1LA 1X4AA 5L39A 2DXDA 4DQSA 1T9XA 2W4PA 3G2XA 4R0EA 2LU2A 4QU7A 2Z2ZA 1UW9A 4WIQA 3HHKA 1C1CA 2HWTA 4CIOA 3MI7X 2VPWB 2J6UA 2VG6A 4X4RA 3QT7A 3RB3A 2EBEA 2K1RA 1UVMA 3I0SA 1PSDA 5A8WB 4IR9A 1WI8A 1PYTA 1CQNA 1LWCA 1F2GA 3CC2S 2V5HG 2HHWA 2WSEC 2Z4PA 3CTRA 4WE1B 5T41A 2CPIA 1HFEL 3CJ3A 3NCRA 2CUYA 2DD8S 4DL2A 1VQKS 3CO9A 3HHDA 3VAHA 2L9NA 2ZH5A 4P73A 1WC6A 2J6TA 4WKRA 2IRUA 2XY7A 2MQMA 3Q8SB 2ZITA 5F3TA 3CDWA 1XERA 4WFNQ 1UEUA 2KTQA 2K3KA 3BSOA 2GQ2A 1FRHA 3FMWA 4F0HA 5DJBA 2RILA 4MK8A 1QSLA 1JNRB 4DI6A 1U0HA 5KFVA 1K44A 1WC5A 4HDHA 1NMEB 1FKAF 2ZKUA 4DV3F 2MXYA 1NH7A 5E3QA 1R6VA 4LF5J 2FJAB 3HKZD 2DNNA 4DR2F 3WC0A 1U8SA 4CQ1A 2FD2A 5KFBA 2IC3B 3MAAA 1FA0A 2DNMA 1NPPA 1JB0C 3GE9A 3UQSA 4F02A 3GYNA 3G86A 1N56A 1ZAWA 1UTAA 3NMRA 3OSPA 5BJRA 3MTJA 5D4OA 4DF8A 4DG1A 3OV7A 1FJGF 5HVFA 2DR5A 3M6WA 4E0DA 1UVNA 4IO1A 1IKXA 4C98A 2C2RA 5U47A 4UOCA 3O44A 3MEDA 3CCUS 5HLFA 1HHSA 1NKBA 2G13A 2XS7A 3D6MB 4DFPA 2NCKL 4CLTA 1IR1A 1S6OA 1HWKA 3SZ2A 2DYAA 4EZ6A 1JLCA 1W25A 2DY1A 2GO8A 1XIQA 3UE2A 3T5JA 4LRBA 4FYYB 2BOPA 5IXUA 3VF0B 2PO4A 4ETZA 2EG1A 1W2IA 2QMXA 3QNWB 3UD5A 3BKUA 5F8HA 2QMWA 4QWAA 3FCVA 4ANEA 4HTJA 1CJVA 4IOAQ 1R31A 4CLLA 3V6DA 4AD6A 3K59A 1KNZA 4KT0C 2GA7A 3HDSA 2ZUAA 1TKTB 4EYHB 3D6FB 1UFKA 4NLRA 3OBIA 1TKXB 3J7YI 2PA8D 1GXLA 4TVAB 4IQMA 1XTZA 1N32J 1KOOA 2BJ1A 2D7SA 2W2PP 2J9CA 1JLEA 2QC3A 4W4MA 2MB0B 5KAKA 4JV2A 1TR0A 1BWVA 2E7XA 2G1DA 3BR8A 3WX4A 4DPUA 4P7VA 3J7ZT 2NLWA 3G8TA 1VLOA 3I4PA 3DLHA 1FXDA 1CS4A 4RBVA 3K0JA 4AL7A 3TVKA 4WPAA 3PV8A 1U6ZA 2C3UA 2Y8YA 4ID8A 5B0FA 5DO2A 3CCVS 5HSPA 4ED8A 1S1VA 3QFHA 3UDLA 2ZH2A 3HVAA 2G2OA 4L76A 4EBCA 3RAXA 5GAHI 4DV0F 1PYOB 3MUMP 3QJLA 2B4VA 2NPIA 1LK7A 3AODA 3EPGA 3T1HJ 1L3UA 5D15A 3T9ZA 3SV4A 4CLYA 3IR5B 3PYDA 2BE2A 1F3FA 4ZK7M 2HHUA 4I67A 3CJQA 2EFQA 4DZ6A 1S7IA 2HFUA 1D0EA 4A4JA 4DSIA 5KFRA 4PQAA 1AB8A 2KN4A 2HFSA 5E2QA 4O4GB 3BGLA 2J7KA 2MZ1A 1WKJA 3NNAA 4O3QA 1E6YB 2P2CB 4CLPA 4NXMJ 5KFOA 3QSIA 2BW7A 4ALZA 3LPYA 5F3ZA 2DB1A 3N0VA 1Q78A 1WC0A 1KP6A 1ZZFA 1TV6A 1ZM4A 1QAIA 2GMJA 4ZP8A 3IR7B 3J7Z5 1MNEA 4USKA 1Y5NB 2ZWPA 4ED1A 1VQ6S 3UN5A 2IM0A 1WEYA 1WTBA 2VPYB 3OTBA 2XMAA 3AQOA 5KFUA 4K0KJ 2QA2A 1RTHB 2K8GA 1N8RT 1DHMA 1IQTA 4WXOA 1OQ3A 1RYSA 2Q1LA 1KVJA 2ZH6A 1NU4A 5DDQC 4ZITA 4WZQA 3IC1A 4YN3B 2YWHA 1UEKA 2KXNB 1FNOA 4OZ1A 2HNDA 6AT1B 4X4SA 3I96A 2H5EA 4F36A 2Y1RI 3E8OA 3IGNA 4C97A 4IKAA 4O3NA 2OD4A 1XEZA 4I4BA 1X9SA 2BRKA 3W8PA 3CCES 1XJWB 2JVRA 3DLBA 3QZ7A 1I3OB 4EFAC 3WC2A 3TWZA 3C6UB 3CJTA 2J9DE 4ES3A 1VIXA 3S1TA 3G82A 3FSYA 4P10A 4XAKA 3GLJA 5HP1B 1YJVA 5A0YA 2CWKA 3H20A 4RW8A 3VTIA 1SJQA 1YVFA 3ILOA 3TQEA 3QIPB 4RPFA 4I2PA 4EK2A 1M90T 2I38A 1C0TA 3W64A 2RAQA 4P72A 3SFGA 2XYPB 4AXIA 2JOQA 2RVJA 4J9PA 3M8WA 1SL0A 3QT6A 2KJVA 4RUHA 5J2MA 4U95A 4ZS6A 2QLXA 5IC6B 2WBRA 4K4YA 2L08A 5CH7B 1L3VA 4RJVA 4CCHA 1H74A 2Y0BB 1XK8A 3A8EA 3V6HA 3UVJB 3QJPA 2PSZA 4HEA9 1UL3A 2ZZTA 4ESNA 4RR5A 4IOBA 4B3OA 4MIBA 4ZCLA 4WYWA 3GG0A 4Q2MA 3ET6B 3PW7A 4OI2A 3M9OB 3K2YA 1X5TA 3QATA 2OPSA 3RRGA 4LF2A 4FF3A 1X0FA 3PX0A 4ZLNA 4K2JA 3J7AN 1CPZA 5FDLA 2GW8A 4KO0B 1SQFA 4ECSA 2W2NP 4DQQA 3KFWX 3MM6A 1BD6A 3HVRA 3A3OB 2DJWA 2IJRA 4P52A 3T1YF 1U6FA 4Q7AA 3MR2A 2ZWOA 5AJ3J 1JJ2R 2R9LA 2QLBB 3KKFA 5A8RA 1RT3B 2AMCB 3R5BA 2XLJA 3HZGA 4C48A 2Z57B 3VQTA 5F0WA 3HJVA 1RZMA 1TL7A 4ZPVR 3CCQS 5JVGQ 2KFNA 3MECA 2M7SA 3B78A 1CEZA 3EE3A 4FXVA 1FESA 2X1BA 4QOTA 4USMA 2DNOA 4WWSA 4TQRA 4DL6A 3V4IB 4KGVB 3DRSA 4XO0A 2VQFF 2GQQA 3NNHA 4C8YA 3GR0A 1VIOA 4A0UA 4TLRA 5ETPA 5D8HB 3KK2B 3SDEB 2UUCF 1QE1A 4LVOP 2YKNA 3JXOA 2AWZA 1I94J 1FVQA 5HO4A 4F3OA 2QYCA 4KAIA 5IM0B 2DXEA 1C4CA 3ITHB 3LGMA 1E6VB 3OL6A 3R8YA 5DZ6A 2ADCA 1Q8BA 4DUYJ 4M5DA 3KK3B 1KQFB 4E2FB 4LRCA 1MMLA 4OZ5A 5H1SV 2EW9A 3TEHB 1FE0A 5H9FJ 4JV5J 4DEZA 2E5LF 4ANCA 5I4MA 2VQEF 5KG4A 4AE5A 4RW7B 4MJKA 2POKA 3RR7A 5LSRA 1RAGB 3IWNC 5LSLA 1UJ4A 3LAMA 1M1HA 2BZ2A 1PJ6A 4YR3A 1NXIA 3VR1A 1MMNA 1U02A 2LFVA 2GJFA 3MEEB 2QV6A 4LRDA 4CDIA 1RKJA 1RAHB 4LF1A 2OSQA 3MM8B 3BDEA 4ZVOB 5D4NA 5A8WA 4KGZB 1IBMF 2ZD1B 1HQEB 2GAHC 3EZOA 4PRFA 4ER8A 2VV5A 4NLGA 2MQPA 3M4XA 3G96A 4WE1A 2J0XA 2UXDJ 3C14B 4IQXA 4B3MJ 4B9VA 2CVIA 3BGOP 9RUBA 2V63A 1X4DA 1KRPA 3DRXA 5ITHA 3M8YA 4DR4J 5GVQA 4F04B 5CYQA 3FMBA 1S0NA 1HNWF 4MT1A 2KHCA 4OHZA 4O0NA 2Z2YB 3C8YA 2ACMA 1BGXT 3GWCA 4DV5J 1VQ9S 5D4PA 4RUCA 4LF6F 3QBCA 4F4AA 2OPRB 2ZOGA 1SI9A 2LCWA 2HBRB 4ZP9A 1S97A 5L46A 5LOQA 3S7RA 4DR6J 2LDIA 3DGVA 1U1MA 3DDNA 1KOHA 5HATA 4W90B 3VZHA 2R2UA 5KOWA 4CM0A 1R3NA 3M8ZA 2GHPA 2VFSA 1RWWB 2IIHA 2DH9A 3LANA 1WHWA 1ULRA 5I3QA 4LFAJ 4C8MA 1LFPA 3EVMA 2EG2A 3KWMA 2RQCA 2FB0A 4OYBA 2IC3A 4PG8A 4HHUA 3C66A 2W8KA 1V9OA 1EKRA 1YJ7A 2I5JB 1RCOB 4LFBJ 3JTPA 1FO1A 2ZVSA 4O3PA 3B6BA 4ZLJA 4OZ0A 1TZ0A 3GILA 1U25A 2ZH8A 2L41A 4N8NA 4FVMA 1H72C 5C42A 1RAOA 1VOMA 2AJFE 5E41A 1R6YA 1VQLS 1N33J 1S77D 2ZJRQ 5KFXA 4O4RA 3SCKE 3R7SB 4C9DA 2YWGA 1OYEA 3SXLA 1OMSA 1T02A 4NMXA 3HHEA 3M9NB 2O01C 5HL7Q 3BYPA 1OPZA 3TW0A 5HQ8A 2H54B 4YDDB 2ALZA 2FQQB 4Y6IA 5JVHQ 4PEOA 4TXSA 4JI6F 1KWMA 3A1YG 2WSFC 3DRPB 3I5CA 1XMQJ 1X5OA 3NWRA 1VC6A 2N4CA 4CH1A 2IA0A 3M30B 2K2PA 1YSJA 4OZLA 4NLDA 1XBWA 4DOZA 1B99A 2Q43A 5T7LB 2NXUA 5KFMA 1QAXA 3T1AA 2CQ3A 3MCOA 1VFJA 4ECQA 1QAJA 4G3IA 2ZHBA 2MQ8A 2IYIA 1SCJB 1FX4A 1TKTA 4TN2A 3CE8A 1GMVA 4IFYB 2ZBQA 1TKXA 2GMLA 2KVQE 2OIHA 2YWFA 3PDNA 1DTQB 3MM9B 2ASDA 2RE1A 3VQSA 2GJIA 1S7HA 1KS2A 1BHNA 2X3DA 4RW9A 2HQCA 3DOLA 3R2DJ 1DURA 4X65F 4JI7J 2DCLA 1RHJB 4X4NA 4NLTA 3M2UB 4DUZJ 3DHXA 4RO0A 3TP2A 1GH8A 2EFOA 1HW9A 3QAEA 3OXFA 2BE9B 1JXEA 4C3KA 2ZOFA 3BEGB 3TJ8A 1N5QA 4G6VB 3R6LB 3ZZ0A 4YB1P 3TUJC 2UVUA 1FDBA 3BN7A 1IJEB 4NLOA 3H25A 2FLPA 3M8QB 1P6TA 4JI8F 3G4SS 1RWUA 4NX9A 4AXJA 3KLGB 4HI2A 2Q6BA 5ETOA 3U27A 5F8LA 4LSZB 3QMQA 1OWXA 2ATLA 4P75A 4RL1A 2IY5B 2BVZA 3DOMB 4K2XA 5CQGA 2V9KA 5H9FK 3HCXA 3LGHA 1S9GA 1VRUB 4O4GA 5E3AA 3HFKA 2HGMA 2IDEA 3LUYA 4CT9A 2YQ0A 2A2CA 3W9JA 5DLGA 4B9TA 3IXQA 3HO1A 3FC9A 3R9LA 3X3UA 2A2DA 4P9SA 1NPRA 4ZLLA 4ZVRB 2A1BA 4JI4J 5EX3A 2MLYA 2ZC3A 2WOMB 3DRRB 3IAM9 1FFGB 4RW4B 3CJRA 2HLTA 3GIRA 1CBKA 3G6VA 4IR1A 2MZSA 3OTDA 3MPVA 2BKOA 5ADZA 1IWGA 3TZZA 2VKRA 2JFDA 2RNEA 2NSCA 2QSFA 2RKIA 2MZQA 2KG0A 2B8QA 3FBEA 3CF5Q 1NJIT 2XMTA 5HAOA 1T94A 4IUFA 1SJFA 5GADU 2M9KA 3N01A 3HVTB 5K9FA 2R7UA 5H9EJ 2WCXA 1N36F 2V68A 4F8RA 5KG2A 5EX0A 1X4EA 4G1PA 5SUHA 2ZH4A 1ZAXA 4ECYA 3C6UA 2ZNYA 3UN3A 4F50A 2RH3A 1FRLA 5HP1A 4Z2XA 4RNFA 1A6LA 2JDJA 2B5JA 1TUVA 4XDDA 4DR3F 1NNDA 2HURA 2AEFA 2UUAF 1JWWA 2IA6A 2V6AA 4CI0B 2BA9A 4EZ9A 1LNQA 4YHHF 4DV3J 3TX0A 3UVJA 1N34F 5IQ6A 2KB2A 1LW2B 3I9ZA 5AE1A 1VHIA 4CRJA 2AP6A 3ZTOA 1CC7A 5LXYA 3I0RA 2LEPA 4DR2J 1FK9B 2FHJD 3ET6A 4NCAA 3BGUA 2MMYA 3ELHA 3M8PB 5A6PA 2HQFA 4PXBA 1QTNB 4KH1B 3RBEA 2M2BA 2CQ2A 5E3PA 2E7WA 4IG3A 2P6SA 4FBUA 1FJGJ 3MOZA 1N0UA 4USHA 4OQJA 5K8PA 1U2RA 1XWLA 4PWDB 3BKFA 2B9YA 1XNQF 4PCQA 1RT3A 5EN1A 3ENAA 2JJ4D 1TVRB 3KLFA 2RS8A 1TKDA 1S57A 2BJ8A 1MN7A 3N6MA 1RU2A 2C3MA 3DXSX 4EBEA 4N8OA 4JI3F 2VU5A 3TO8A 4M5LA 2B9XA 1RWOB 3OXGA 2ASLA 3AD9C 3G6YA 2LU1A 3V4IA 1HHTP 2CRLA 1K0VA 1YGYA 1VS3A 2OAUA 1Z1ZA 1SJ1A 2F8EX 5LMUF 4OZJA 2AW0A 1FT8A 2W7AA 2LYVA 2HFZA 1YZ7A 4F3MA 1KFSA 4ED6A 2YY3A 3MAHA 2PEHA 4KY3A 2CKWA 3ITHA 5AE3A 1HBMB 4NLYA 1E6VA 1IR2A 3H90A 5DDRC 2H5IB 4CZCA 2VBZA 2FYXA 2M8HA 2MZRA 2VIHA 1DLOB 1Z2LA 5KFSA 1N48A 3W5XA 4I64A 4WIIA 4FS1A 3CD5A 5IT9Y 2FLLA 3BH6B 5D0RA 1JLGB 3ZTSA 2BANB 1R8HA 4PXDA 4RW7A 3W60A 1FJ7A 1U1OA 4FVCA 2YNGB 3SIPB 3LW5C 2ILZA 4LF9J 4LR9A 4M5GA 4HT7A 3MEEA 3L95X 1S76D 4A8XA 1TQLA 3IBFB 4FZVA 4AYBD 2DR6A 2XMMA 3D1HA 3MM8A 4QIGA 2N4DA 1RCXB 2NYHA 4LBHA 1JLQB 4E8UA 4CLFA 4X62F 3IM9A 1JLAB 3M2RA 2JEIA 4DPTA 4A8YA 2M3DA 5BYRA 1PC5A 4WP9A 3PX6A 2YKPA 1HQEA 3B4MA 4OI6A 1TL3B 1U8WA 3D3BJ 2FDNA 3MPDA 5E7OB 3C14A 1JQGA 4A0TA 2DY9A 1SJ3P 2ACYA 4WBFA 1HHQA 3JSMB 3NOGA 2ZJQQ 1RSCA 3ZNJ1 4ZIWA 4HLBA 3VGSA 2HPUA 1U49A 4LRFA 1YHQS 3NGTA 4P2FA 2GVDB 4QIVA 3ZTPA 4B08A 2FTRA 1ZYQA 2JEFA 2IDLA 1LW0B 1WDDA 1NDCA 4KQZA 1V3SA 5IWAF 3HMJG 3MURP 3MMJA 2KYZA 2MKJA 5KFKA 1LWFB 1Z4UA 1ZA1B 2BQ3A 1RI7A 5AXKA 1NBEB 2DR8A 1S9FA 3M6UA 3NG8A 2PDAA 3MEGB 1LOUA 3GJQB 5HK4A 1IR0A 2EWHA 3PKYA 4HVZA 2W9BA 2HRYA 4J90A 5ETVA 2Z2MA 2XWYA 2V8GA 4Y0FA 5HANA 4Y65A 1I1GA 4LVNP 1NJXA 1Q79A 4ZJLA 4ZHRB 5MAOA 4W98A 2BM0A 3QGGA 2I5JA 3GTYX 2RUGA 4JOUA 2FVRA 3UNYA 3DI6B 4OYAA 4K4ZA 2CG4A 4I68A 3N28A 3MOJB 3NXZA 1YLXA 4BWJA 3T41A 3HT0A 2WAQD 4DX7A 2CXEA 4B9UA 2P8IA 4N76A 4FF1A 3EXCX 3K57A 4I0WA 4HH0A 2HK2A 3KG1A 2NXCA 4ZPCA 1N32F 1M5VC 3AY0A 2DNLA 2JRSA 5KFPA 1KSPA 4P2XA 7FD1A 3JSYA 2GVZB 5ETQA 3WDOA 4EUVA 7FDRA 2YBVA 3ISZA 2WSCC 3DRPA 5BYQA 2W25A 5IFMA 2M70A 4DF4A 3F56A 2XZWA 3M30A 2BEFA 1GX5A 5L9XA 2Z58B 3PW4A 4Q5VA 1SQGA 5T7LA 1RWPB 3MAQA 4GVBB 1VCTA 3GR1A 3AT1B 2JHEA 3BSNA 4YQWA 4ES1A 4ZMMA 2LECA 2JSXA 5MLCV 4LMZA 1RAJA 4QR0A 3OLAA 4DLEA 3MF5A 1EQ0A 5DG7A 2R8GA 5KFZA 4IFYA 3KLHB 2OFHX 3NBPB 1H6KX 1ZM2A 3GFZA 3MPUB 4RKUC 4HTIA 5LMNF 1XR7A 4URGA 2LMIA 1DTQA 1BQMA 3MM9A 1QSYA 5IT0A 3SQGA 5D4LA 1WC1A 1HQ2A 1FD2A 1RADB 4ZJQA 1T05B 4OX6A 3T1YJ 2NUHA 4BHQA 1CLFA 1HNXF 4FN5A 1VMBA 1QAYA 3M2UA 1FKOB 4IDKB 2AIRB 3OFGA 4ELTA 1VGYA 4OI3A 2VG7B 3RW7A 2MGZA 2AF6A 3L7PA 3G71S 3G87A 2KZMA 1O6XA 1MU2B 4EI2A 2K7JA 3VGVA 1SUQB 1VJQA 4L74A 1MW7A 2P5VA 4R0JA 1M5OC 2XSJB 4CTAB 3HPOA 3Q8VA 2VQFJ 3PJWA 1SC3B 4JI1F 1PC4A 3BGFA 2YWKA 2E1AA 2DNRA 1VBKA 3TUIC 1LQ9A 2UUCJ 1RBAA 2XG8A 4J5OA 3J80U 3UO0A 1YBTA 3TVZA 3DOMA 2ZZMA 4F4XA 4OL8A 3BPSP 1BQNB 4L3NA 2NXJA 2OLWA 1VRUA 2BV3A 2ZHAA 4RNHA 5SZTA 2DGOA 2FGCA 1SH3A 4ZP6A 3GV8B 2E5LJ 1NZ8A 2VQEJ 1RA7A 1IKVB 3NWGA 3GPAA 4MKAA 3UCZP 1VRQC 1REVB 4DDFA 1N54B 2WOMA 2NZCA 4B9LA 2GS8A 2OJ3A 3TJ9A 1UETA 5F8GA 1EZZB 1LKZA 3PRVA 1HA1A 2KHDA 1S1WB 3BO2A 4H54A 2SXLA 3AB2B 2EKNA 4LUBA 3IRWP 3NCQA 2W01A 5GMKa 1UJ5A 1B0PA 2X1AA 1UPPA 2XCPA 1VQMS 3BSAA 3TJAA 5K8OA 3PYFA 1IBMJ 3X1LB 3M32B 4I69A 2DXFA 4Y2MA 3VAMA 3PCOB 3H5UA 5KT3A 3D67A 2YKAA 4ZVTB 2XLIA 3QGIA 3UCGA 1YTYA 2O3DA 2MSTA 5FLXY 4M5KA 1NK9A 3NGDA 1HNWJ 3QRPA 3DLKA 4KHMA 2XO6A 2HSEB 1YRXA 2V34A 4AQYF 3DFEA 3FUYA 3Q8YA 2BJEA 4G1QB 1NK5A 4PWWA 3SSQA 3SCIE 2W7PA 4LF6J 2VKZG 3RW6A 4HR2A 1SXLA 3TZYA 3R5GA 1Y11A 2XLKA 2HAIA 2F3JA 1QLNA 4NA1A 4AFFA 3CCMS 2IFXA 2VPXB 1T7PA 1D8ZA 2HFNA 2IJFA 4Y2CA 4ETXA 1M1KT 3MEKA 3CIMA 1QJHA 4QR1A 1FXLA 3TA1A 2YX7A 1LW2A 1MN9A 1RWMB 4K4TA 1T9WA 2HMIB 2AGQA 1OSDA 4ID5B 4NL5A 2VOOA 2BUNA 2YNHA 1FRIA 1FK9A 3BSCA 3HI9A 2DHAA 3FEYB 2ZBCA 2B43A 2BR0A 5DQIA 2B7BB 4NYZA 4PQUB 2OEKA 2AKWB 2PEBA 1VQPS 3FGVA 1KN6A 1F9HA 4WTYA 4ECWA 5EWGA 3W9IA 1IM4A 1YK9A 4MK9A 1FFSB 3OQ2A 1U24A 2JWNA 3CDUA 3FCHA 2MKHA 4PWDA 3QRQA 3PJ9A 5C25B 1VDHA 1XR6A 2AD9A 4P2MA 1U47A 1X5SA 3ILJA 3D5MA 2HVEA 2KG1A 1U2CA 2XHCA 2OELA 4NEYA 4ZCKA 4DUYF 4ZVPB 1ZTTA 2LQ5A 2IAJB 2HS3A 1FRKA 1JKHA 4Q2LA 4JI6J 3ENQA 2EPIA 3K7RA 1S48A 4M5MA 2FJXA 3K89A 4MH8A 5G4DA 4WTOB 2EFVA 3KJNB 4H4OB 5D0EA 1U26A 2V8PA 3H4DA 2IM2A 2YKMB 1T9YA 2PN6A 1RK8A 3Q8UA 5LXRA 4OZ3A 1URRA 3PHEA 4JYAF 3M9MB 4AL5A 2XMWA 3K8WA 2DISA 5E33A 5K8NA 2I0XA 5J2PA 5M2RA 4OZNA 2PFDA 5F9LA 1S12A 5IQQA 4QYZJ 4C2MA 5EWEA 1F0XA 4Y3CA 2IRYA 2VUGA 3VZIA 4QU6A 1C0UB 1IVZA 1KBRA 5JUMA 3UD3P 3IFEA 1JXLA 4X65J 2DNHA 1JLGA 4QJVA 2BANA 2ILYA 4Y2AA 2B9WA 2YNGA 4F7VA 4Y28C 1EETB 2BJ7A 4KFBB 4Q0BB 3SSSA 1B70B 2HHHJ 2B4UA 3MMAB 1UAWA 1M5SA 1ROFA 3MHYA 1RYRA 1BLUA 3BYRA 1CG2A 3CVKA 3PRDA 3NL0A 3PR5B 1S10A 4OX9F 1JLAA 3T5HA 4UZBA 1KQSR 3ZZRA 2V2KA 3KLVA 4CLUA 2EC2A 2HW3A 4FF2A 1FWKA 1WHYA 1N5VA 3WBZA 2GGPA 5KT5A 5C24B 3OUYA 3ZZUA 2UV8A 2B4PA 1IBCB 3JSMA 1WF1A 2CQ4A 1EIYB 2CPDA 4Y00A 3TZXA 1FVSA 4FDFA 2GVDA 1ZETA 3NMAA 1XNRF 3D9BA 1HWIA 3RAQA 1LW0A 1Q5VA 1M1GA 2V94A 4P2SA 2CQBA 3W2WB 2F4VF 3ETMA 1LWFA 1F9EB 1IN0A 1HNIB 3HK2A 1SKUB 4USUA 3FFIB 1T9UA 3MEGA 2HQ3A 1Q1KA 3V4MA 2NXNA 2FJDB 3C2PA 5DLFA 5DQHA 2AEMA 3DN9A 2AQ4A 3UDCA 2PMWA 1T3NA 2A18A 1NB7A 4ZPTR 3MXHP 3F41A 1RT7B 4ZHRA 3DLJA 3HF5A 4A46A 3HHLB 1P9QC 3EZ5A 3BO4A 1Q95G 2XCAA 2WW8A 1XMQF 3DI6A 1Y4ZB 3QQCD 2DEIA 2CA9A 1N36J 3HSDA 2DR7A 1WOPA 1J5EF 4XIUA 3GFHA 2IM3A 2Y1IA 2CQ1A 1VHFA 4K5RA 4RX6A 3CIZA 4DV7F 3EPIA 2V2QA 2C42A 4DFMA 2MHNA 2HYIB 1YI2S 2E9RX 3NGRA 5KG5A 2GAGC 2LQ8A 1GMWA 4ZVFA 4DR3J 5L9NA 2V2ZA 1FCAA 2GVZA 4JI0F 3S01A 2I1RA 1U1QA 2UUAJ 1N88A 2F9DA 5EWFA 3PVXA 1NZAA 3PEHA 1TL1B 1CC8A 3WZ0A 1V3ZA 2ZOMA 3D1OA 1NKEA 3T5LA 4QIWD 4CWBA 4KBIA 3FZ2A 2BKPA 3O6QA 3GQCA 1VC0A 4YHHJ 2KM8B 4FPRA 1N34J 5A2QY 2YNIA 3KHRA 1H38A 1T03B 2B0GA 2GIRA 4GVBA 2FY8A 1HWUA 3GMGA 3RRHA 4ED5A 1WOOA 1KLMB 2J7UA 4DQIA 4M95A 4H4KC 2BJDA 3KLHA 3NBPA 4OI1A 3AAWB 2ZE2A 3SSRA 3EGZA 2ROGA 3W8GA 1QSSA 1UKUA 3OHAA 1M5PC 1LXNA 2E7VA 2CG8A 3UCUP 2FLOA 2JH3A 2LQJA 4U96A 3UI3A 1N5SA 1HBNB 3UW1A 4OV6A 4DPOA 4NEZA 1U1KA 1T05A 1HNZJ 2FY1A 3P6YC 4Z7CA 1YBAA 1S1XB 5KT7A 1XNQJ 3O1LA 4K8RA 4DU7A 1FKOA 3PACA 4IDKA 2FGOA 2OPQB 1HWLA 2VG7A 4FYWB 3BDPA 4RU2A 1NK6A 1HQUB 3V81B 1UJ6A 5DGAA 4JI3J 1RAFB 1QTMA 4WJBA 1WI6A 2J9EA 5DM6Q 1HNVB 1SUQA 3JB9k 3UNGC 2AZ1A 2JLEA 2XSJA 3OL7A 2RQ4A 3JYTB 3CDAA 4PPZA 4LQ3A 4KGMA 2CZ9A 3HT3A 4R8UB 1F5CA 2W2QP 3SYZA 2IYGA 2YVSA 3TUZC 1VQ7S 5LMUJ 3CJ8A 1S1TB 5J1PA 4OYIA 1Q8IA 3AXKA 3MCNA 4CNZA 2FPHX 4QWEA 1I6JA 3EDRB 1LXJA 4YFUA 1SV5B 4Q44A 3UDVA 3DKDA 2HGNA 2G0CA 2DGVA 2ASJA 2YKQA 5B0BA 1VQSA 3A4TA 1Q5YA 3K5LA 4NRUA 3DGPB 3GIMA 2BBEA 3QGHA 4QBUA 2PI4A 2OKQA 2I8EA 4ED2A 1U4BA 3IG1A 4WFAQ 2AZ3A 3TAMB 3CEDA 2CPJA 2LXUA 4YB5A 3AJDA 2RQKA 3AHPA 1HIYA 1H73A 1IUJA 3WIUA 3RUBL 3GIKA 1PYSB 1P8GA 2XMKA 1REVA 4L72B 5LSOA 5F41A 2CZVC 3P49B 4LF7F 4FPIA 4OFZA 1VJWA 2QL5B 1SB6A 4FS2A 1S5ZA 1VR6A 4K4XA 4O44A 3HFZB 1UWAA 2OSRA 4GVLA 2XYHB 2FZCB 4LSNB 2MJUA 2IVFB 1S1WA 3CNQP 1FI4A 2MQLA 3KOAA 3Q2SC 5BXIA 2DGUA 1YITS 3D4JA 4DR5F 1S6PB 4X62J 3DOKB 2LKZA 1HW8A 1S6QB 3GONA 4NI2B 3H2VE 1QVFR 2EFGA 4OYPA 3RBZA 3M32A 1NUEA 2MY8A 2N7CA 3BS9A 2R2TA 4DL4A 2P6TA 4YB6A 3BZQA 1SKRA 3J81U 2UU9F 4A8KA 4TY8B 2CQPA 4EBDA 4K59A 1HARA 1Y7PA 5HJXA 3ZFVA 3MWBA 3CO0P 2JEJA 1CJTB 4Q45A 4O3OA 2Y0SD 1O0PA 4G1QA 1R0CB 4I2QB 5IWAJ 2JC0A 1T9TA 1QDUB 2RJZA 1N5YB 3W5YA 1VBXA 3NNCA 4EYIB 3KDNA 1CJKA 2AEJA 3PW0A 2WB4A 2YPYA 1WEXA 1UA0A 3B54A 4KJIA 4DR1F 2B56A 2OHDA 1NHKL 2R2SA 4JBCA 1PBUA 3D54A 5I42B 1FE4A 3THTA 1HPZA 2HMIA 1D3WA 3HKWA 1UVIA 4RUAA 4ID5A 2YX1A 4J9MA 4JI2F 2KRBA 1B7YB 4TYAA 1PILA 2XMVA 2YXLA 3OVAA 2QLJB 2DNPA 3PYGA 2D69A
chains in the Genus database with same CATH topology
4ESNA 1NPPA 3LPEA 2OUGA 3H7HB 1NZ8A 2LQ8A 1M1GA 3LD7A 2XHCA 3QQCD 4ZN3A 3P8BB 1NPRA 1M1HA 2K06A 4ZN1A 4OBIA 2EXUA 3EWGA 2KPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESN A;  1NPP A;  3LPE A;  2OUG A;  3H7H B;  1NZ8 A;  2LQ8 A;  1M1G A;  3LD7 A;  2XHC A;  3QQC D;  4ZN3 A;  3P8B B;  1NPR A;  1M1H A;  2K06 A;  4ZN1 A;  4OBI A;  2EXU A;  3EWG A;  2KPP A; 
#chains in the Genus database with same CATH topology
 3IAS 9;  1NK8 A;  5IS2 A;  4PQU A;  4LRE A;  4U8Y A;  2FZK B;  2ZDO A;  4HI1 A;  1Y9O A;  4OZ2 A;  2BXJ A;  2LVW A;  2DIT A;  4OYX A;  5IC4 B;  2CFX A;  4ATN A;  4OBI A;  3W9H A;  1R27 B;  3G8S A;  4ZPB A;  4GKJ F;  3MDF A;  3MM5 B;  4NCB A;  4DV2 F;  2MKC A;  2R7R A;  1UZH A;  5CD4 A;  5C25 A;  3T5K A;  4KPC A;  7AT1 B;  3AJ2 A;  3D0H E;  4ZJO A;  2HWI A;  3IS9 B;  3E01 A;  5ETK A;  3EWG A;  1GXT A;  2MTL A;  4ENO A;  3UPF A;  4OHW A;  1SQE A;  3BBC A;  4DCO B;  4F67 A;  3LD7 A;  1RAA B;  2IAJ A;  1S1U B;  4R5P B;  3GSD A;  4DQR A;  3DM2 A;  1C1C B;  2HRU A;  4OLO A;  2CJK A;  2VG6 B;  3KUE A;  4DFJ A;  1B0V A;  1FER A;  5EDW A;  4H4O A;  3DHW C;  2YKM A;  4YR2 A;  5F0U A;  1V5V A;  4F4Y A;  1U48 A;  4CLK A;  4LF9 F;  4ITS A;  1NSK L;  1F5B A;  5AT1 B;  3IO1 A;  4Q8E A;  3CC4 S;  4X4O A;  4GMK A;  4QW8 A;  2Y3Y A;  1AUD A;  5K14 A;  2IJN A;  1YJU A;  2CJX B;  5LMN J;  2D41 A;  1JLB A;  1BE4 A;  4HAC B;  3AD7 C;  4NAS A;  3ZXW A;  2F63 A;  3B4D A;  1WAC A;  2R8I A;  3M6V A;  4IH7 A;  1C0U A;  4TU7 A;  1JJC B;  3NAI A;  3GZ7 A;  2C2M B;  3TEG A;  2FHO B;  3PO4 A;  3AD8 C;  1S0O A;  2KPP A;  1JX4 A;  1VIS A;  1RT1 B;  4A47 A;  1HNX J;  2VA2 A;  4DSE A;  2M4M A;  2MZT A;  4DR7 F;  3NGU A;  4ZN3 A;  2QFI A;  3OR1 A;  2FUG 9;  2Z56 B;  1X8D A;  1U0H B;  2PT0 A;  4BWM A;  3R2C J;  1EET A;  1H2T Z;  4KFB A;  4Q0B A;  2MQQ A;  3DC2 A;  2GFF A;  1F9F A;  2FC8 A;  3G9C A;  3MMA A;  1Y5I B;  2U1A A;  1D8Y A;  2HHT A;  3KG4 A;  5ETL A;  5D6G A;  3OVS A;  3HZE A;  4JI1 J;  3I32 A;  1ICE B;  3E2E A;  3IBW A;  3SI8 A;  4KKO B;  3PM9 A;  4IH5 A;  4ECV A;  2AJ2 A;  5C24 A;  3RR8 A;  3Q83 A;  2WVD A;  1TL5 A;  3GU0 A;  4J91 A;  2OEJ A;  3QYY A;  3MFH A;  5CZX A;  2AJ1 A;  2CNO B;  3SV3 A;  1U09 A;  3U02 A;  1D9A A;  1RXO B;  3AA9 A;  3W5Z A;  1IKX B;  2ASY A;  2CPX A;  4DPX A;  3MED B;  1HWJ A;  2H4Y B;  3BF4 A;  4ZPW R;  4I7F B;  3ULH A;  2EC0 A;  1TMM A;  1HNI A;  2A6O A;  2PC6 A;  3D7S B;  2IMW P;  2MZJ A;  2D3U A;  3FFI A;  3W66 A;  2HQG A;  2DPJ A;  4XPE A;  2GZO A;  5K5M A;  2V8D A;  1RHR B;  1PG5 B;  5CYM B;  5IV4 A;  1TUG B;  2ALY B;  3FCW A;  1KKH A;  2C2D A;  4TQS A;  2IBO A;  3KNG A;  2YTC A;  3MD3 A;  3CJK A;  4WYL A;  3PTW A;  4M63 A;  2H48 B;  4EWT A;  5CCL A;  5A6W A;  1RHK B;  4DHV A;  3MR5 A;  4PXC A;  1B64 A;  2UV8 G;  4IRK A;  2R7V A;  4XTT A;  2E66 A;  3K5M A;  4J9S A;  3PFO A;  1RT7 A;  2L3M A;  3BBB A;  3BN4 A;  1VK3 A;  3HHL A;  4TYB A;  5HMY A;  3CWJ A;  2UXB F;  4O0I A;  4C3L A;  4B9N A;  5KT6 A;  1MSW D;  1S4F A;  3MUT P;  3BKT A;  4DUT A;  2E29 A;  2XM3 A;  3F73 A;  3OL9 A;  4KGX B;  3Q24 A;  5L1J A;  2D74 B;  3TOQ A;  1KD1 T;  5EGY A;  4NWB A;  2ZZN A;  4LQ9 A;  3PW2 A;  3VGT A;  2KVI A;  3LGN A;  2Y8W A;  5J1E B;  1X7V A;  2X1F A;  1L3T A;  1CS4 B;  3QAU A;  2FHJ A;  1U6B A;  4WP8 A;  2OO4 A;  4WU3 A;  2ZM6 F;  2I2Y A;  4AQY J;  1VYA A;  2OFG X;  3U1L A;  1O51 A;  3I5A A;  5L1K A;  3CUL A;  3M7V A;  4FP9 A;  5IT9 U;  4FKX A;  4EEY A;  5IT4 A;  1S1V B;  2J76 E;  2FZG B;  2LA6 A;  3NAH A;  1TL1 A;  1UVJ A;  1RP5 A;  3SFU A;  3RTV A;  3H5Y A;  4A8F A;  3RB4 A;  2C2O B;  3EGN A;  4WK1 A;  1HL6 A;  2DH8 A;  2E5H A;  5LT5 A;  1O5J A;  2DNY A;  3WIV A;  3FVY A;  4LF4 F;  3LOU A;  3QLH B;  3LP1 B;  3KJV B;  1FTR A;  1LWX A;  1FX2 A;  1WHV A;  5HMX A;  2BE2 B;  1N0V C;  1WNE A;  2VJV A;  1KLM A;  3IRX A;  1EAR A;  4WK3 A;  1UA1 A;  1Q8L A;  3JTO A;  3ONQ A;  3LAK A;  4N5S A;  4DWI A;  3AOC A;  3QZ8 A;  5DDO C;  4WFY A;  3CJ2 A;  4DSF A;  2ZVI A;  2DR9 A;  3L3C A;  3CUN A;  4IFV B;  1C1B B;  2DHS A;  3MCM A;  3P96 A;  5F9N A;  3LF0 A;  2QG9 B;  2BE7 D;  4NCG B;  3ILI A;  1S59 A;  1S1X A;  2K7K A;  5CAA A;  2V4J B;  1ZM9 A;  3FNN A;  3V5R A;  3UN2 A;  1EKS A;  4F4W A;  3CDE A;  5CD4 H;  1TV6 B;  2A3J A;  4RWW A;  1ZA2 B;  2OPQ A;  3DLG B;  1PCA A;  1HQU A;  3ETO A;  3CXC R;  2K3I A;  3FEX B;  1HNV A;  4X4T A;  3G8Q A;  2IM1 A;  1YJN S;  1SKW A;  2BW2 A;  3MMC A;  1NO8 A;  4R8U A;  4CO5 A;  1QVG R;  1X9W A;  4ZP7 A;  3QWU A;  3FBC A;  4HYK A;  1S1T A;  2HND B;  5FD1 A;  1HBU B;  1ELO A;  2CDQ A;  2ROE A;  3WQP A;  1SV5 A;  3OVB A;  1YRT A;  1RHQ B;  2UVR A;  3CJ4 A;  4GO5 X;  3VVU A;  2OP5 A;  4JYA J;  2Q6C A;  2V0N A;  1VBY A;  2GIF A;  1CSJ A;  2N3O A;  2HLU A;  3QFW A;  2R2R A;  4USJ C;  1HMV B;  5M2U A;  2ZBP A;  4UQT A;  3DGP A;  5KFJ A;  5CAB A;  1ZZN A;  3G82 B;  1RUS A;  4YY3 J;  2NZ4 A;  3W3S A;  5LJ5 Y;  4DN9 A;  5HVH A;  3ILL A;  2VJU A;  2J8A A;  1ZTW A;  3VAJ A;  3NS5 A;  2DGW A;  2FLN A;  1RKI A;  2OD6 A;  1IJF B;  5D3G B;  4B17 A;  2ERR A;  3KXD A;  1WKK A;  4BS2 A;  2W4C A;  2NUU G;  4CNY A;  1RAI B;  2BQU A;  3TRG A;  3K5O A;  1OJ4 A;  1F2H A;  4LSN A;  1GX6 A;  4UOH A;  2HIY A;  1TTH B;  1WD6 A;  1NDP A;  3A8K A;  2VC0 A;  3GFX A;  4QCL A;  2BRL A;  2YPZ A;  2B9E A;  3RG6 A;  2VD3 A;  2DRD A;  2E1P A;  4ZLP A;  3H40 A;  3RRK A;  1S6P A;  4OX9 J;  3DOK A;  1YWX A;  4DX8 H;  3H0P A;  3MMB B;  2YKO A;  1S6Q A;  4NI2 A;  3CB4 A;  2MHE A;  4N41 A;  2QRR A;  1FXR A;  3GJS B;  3P3D A;  1UFL A;  2GHV C;  3OR2 B;  4CO0 A;  3HXM A;  4DMZ A;  2V2V A;  1GAO A;  2PII A;  3OD2 A;  2HG4 A;  1SJR A;  5A76 A;  4I1T A;  5FDL B;  1XMB A;  5C2C A;  3NS6 A;  3R1H A;  3FJ2 A;  2E1R A;  3GV7 B;  2FJB B;  2F4F A;  4UOG A;  3K58 A;  3C3L A;  4NYO A;  3Q22 A;  3IM8 A;  1ITP A;  4C6A A;  1XNR J;  3CCR S;  2RRB A;  5G0R B;  3PW5 A;  2F4V J;  2DHH A;  1G4C A;  4ECU A;  2B3T B;  4GKK J;  4OV1 A;  1N5Y A;  3HHN B;  1Q4R A;  4ECR A;  2Y9H A;  4CM2 A;  3MEC B;  1OY9 A;  4DZD A;  4PG6 A;  4I6Y A;  4B3R F;  3KG0 A;  4UST A;  4S0M A;  2X51 A;  4NA3 A;  2F65 A;  3LH2 S;  3DRS B;  2F8M A;  4JUZ A;  4KYZ A;  4QPT A;  3ISN C;  5I42 A;  3VAL A;  4UZC A;  4LSL B;  4DL7 A;  1J5O B;  1X4F A;  2D3O R;  1FJC A;  3K5N A;  2MEW A;  5CHC B;  1NJZ A;  3OFH A;  3O2I A;  2E1M C;  4J9V A;  3LO3 A;  1M5K C;  4MIW A;  1NK7 A;  2XHW A;  3DDK A;  3Q86 A;  4M94 A;  4ZCM A;  2J8S A;  1MMD A;  3EZU A;  3NP5 A;  3CME S;  1RT6 B;  2D9O A;  1WG1 A;  3PFE A;  1N6Q B;  4RBT A;  3M05 A;  2UXC J;  3QT8 A;  4CO3 A;  3L4B C;  2WON B;  1J5E J;  4HT5 A;  1OO0 B;  2G9O A;  3MM5 A;  4KC5 A;  5DZ7 A;  5C2G A;  2WVB A;  4IRD A;  3A3P B;  4DV7 J;  3PKM A;  2VA3 A;  2HHP A;  1WEZ A;  3IS9 A;  4V19 J;  3EYZ A;  5IZH A;  5KG1 A;  2K06 A;  2ZBI A;  4D3H A;  3I82 A;  2ZDP A;  3G6E S;  4U7U K;  2QL9 B;  4JI0 J;  3MZI A;  3H59 A;  1WWH A;  5KFE A;  4LT6 A;  1S1U A;  4R5P A;  4HHJ A;  2RRN A;  1J2V A;  1TP7 A;  3H2U B;  2BOA A;  3V6J A;  3H42 A;  4U7C A;  1P27 B;  2XGQ A;  4CT8 A;  3BH7 B;  1U1L A;  5HI7 A;  4ECZ A;  2X7I A;  2EEY A;  2GNK A;  2RT3 A;  2EBG A;  2B51 A;  2YH0 A;  3KJQ B;  2JVO A;  2HBQ B;  3A8I A;  2AHO B;  2HHH F;  1NLK L;  1FD8 A;  1F6T A;  3BR9 A;  2CJ9 A;  2IVY A;  5KFW A;  3NCP A;  3D3C J;  2DH7 A;  2HS4 A;  2M8D B;  4HAC A;  4RLE A;  4MK7 A;  2RU3 A;  1FHT A;  3B8H A;  5CYQ B;  5D0H A;  1RAE B;  2CWX A;  2H1Y A;  1SC1 B;  4FKY A;  2XC9 A;  3EUN A;  3QO9 B;  3NGK A;  3I56 S;  2CAD A;  1YJT A;  5FLX U;  4X4P A;  2BX6 A;  5KG0 A;  4PXE A;  2H9Z A;  3P4U B;  4GC6 A;  1RT1 A;  4J9L A;  3P45 B;  2O67 A;  2ZNZ A;  4USV A;  3PXG a;  1NJW A;  3BO3 A;  1HD0 A;  1YZ6 A;  2UVV A;  5B0E A;  1KVI A;  2QZ8 A;  4FF4 A;  5F8J A;  1E6Y A;  3H5S A;  3MGJ A;  4FXD A;  4ZOS A;  2HWH A;  3A13 A;  5KFH A;  1ZS6 A;  2EXU A;  3U1M A;  3PO5 A;  1ARO P;  5FII A;  3BPD A;  3R7N B;  1C2P A;  4OIX A;  3HJF A;  3OLB A;  4TNO A;  3J80 Y;  1NDL A;  3R27 A;  4F4K A;  2MSS A;  2RDI A;  1AZS B;  1TAQ A;  3MFI A;  4OHX A;  4KKO A;  2HFO A;  1DZ5 A;  3BQ1 A;  1TFW A;  3D0G E;  1REG X;  2RD5 C;  4OX7 A;  4NLV A;  1RTH A;  1H7X A;  5GAD I;  1VRT B;  3OTO F;  4MAK A;  2OTL S;  3Q8R B;  4L6V 3;  5RUB A;  1IBK F;  2RF2 B;  5C42 B;  5B0C A;  4PWU A;  3ENV A;  4HKQ A;  1NHU A;  2A10 A;  3D6T B;  2G2Y A;  2FVP A;  1VQY A;  4I7F A;  4L3K A;  1BUX A;  4DU8 A;  1XMO F;  1DQ8 A;  1G1X A;  2CQI A;  3N79 A;  3FK4 A;  5D0G A;  1X4G A;  1NDK A;  3HUL A;  4LF7 J;  9ATC B;  5CYM A;  2P9E A;  3JAM U;  3GV5 B;  1FRM A;  2XS5 A;  1SC4 B;  1RTJ B;  2EKY A;  1AFI A;  2V67 A;  3ZO7 A;  8ATC B;  1Y5L B;  2OGU A;  1NHV A;  3A3N B;  1F3V A;  4CH7 A;  2GJ2 A;  3FSI A;  4OJG A;  1SIZ A;  5L1I A;  2MKK A;  3QIP A;  5B7W A;  2R4F A;  3Q89 A;  2QLF B;  4DV6 F;  4LR8 A;  4ICL B;  2CNL B;  4DR5 J;  1L3K A;  4UQG A;  1SC6 A;  4URS A;  2XB2 D;  4TU8 A;  1TKZ B;  1UMJ A;  2OML A;  1L3S A;  3KHG A;  1UP1 A;  3H4B A;  2RUS A;  1YKW A;  1KC8 T;  3GYX B;  4JI5 F;  4CO1 A;  4ZPD A;  1ZBT A;  4PR6 A;  4C8O A;  2H65 B;  1MWY A;  2WRM A;  3KJF B;  2MKI A;  3I31 A;  1MLA A;  5J1E A;  2J5A A;  2UU9 J;  2V8V A;  2I9S A;  1W7W A;  2KO1 A;  4ELV A;  4RW9 B;  1MWQ A;  3DOL B;  4DS5 A;  4KPY A;  4OHY A;  1IKW B;  3J7Y U;  1DQA A;  3MD1 A;  3PY8 A;  2UUB F;  1FNX H;  3BB5 A;  3KMQ A;  1I5O B;  4KV8 B;  3ZNU A;  1OSC A;  2DGQ A;  3MM7 B;  1FDA A;  3US5 A;  4KO0 A;  2EVZ A;  4GRS A;  3HSG A;  1VQ8 S;  3THP A;  4X64 F;  4DR1 J;  4FNH A;  3E51 A;  5KFF A;  1SL2 A;  3H98 A;  3W63 A;  2F7V A;  3K5P A;  5IOL A;  1GMU A;  1HNZ F;  4MYU A;  5HMW A;  2PGC A;  4X84 A;  2M0G B;  2FJE B;  2DNQ A;  3NY0 A;  1BMQ B;  3UDE A;  2DT9 A;  3QLH A;  3LP1 A;  5F8I A;  1WF0 A;  5J1N A;  3KJV A;  1ZPW X;  2ZFH A;  3BRE A;  2D9P A;  4JI2 J;  2CVE A;  3QWP A;  2DK2 A;  5GAH U;  2HZC A;  4C0O C;  3OPK A;  2NR0 A;  4QIF A;  2ZBR A;  4X2B A;  1JJ4 A;  2FVC A;  1AYE A;  3K17 A;  3KK1 B;  1S9G B;  2KT2 A;  1HI0 P;  2UUT A;  4IFV A;  4K4W A;  2LQ9 A;  2BDP A;  1C1B A;  4DV1 F;  2RU9 A;  3KK2 A;  3SDE A;  4AT1 B;  4M5I A;  4GKJ J;  2JL9 A;  2ZEJ A;  4NCG A;  4DV2 J;  5KG7 A;  2V4J A;  1HR0 F;  4U67 Q;  3SCL E;  1RTD B;  3R97 A;  5IM0 A;  1X4C A;  3DNC A;  2H3E B;  5KFI A;  3CJ0 A;  3DLG A;  3Q8P B;  4ED7 A;  2MPU A;  1KDN A;  2RS2 A;  1ZOT A;  5ETS A;  1YG0 A;  4NOH A;  1KQG B;  3KK3 A;  2VBY A;  2QLW A;  2PI5 A;  4ECT A;  2GC8 A;  1Z2Z A;  2RKI B;  2XZD B;  2NYI A;  1KLN A;  1UVK A;  4ELU A;  3L7U A;  1GQE A;  1YDL A;  1HBU A;  1AW0 A;  2W4D A;  3TAQ A;  2QO3 A;  3W65 A;  1NSP A;  1WG4 A;  5J2N B;  1LWE B;  3ENW A;  2F40 A;  2AX0 A;  1QY7 A;  1X9M A;  1IXK A;  2J9D A;  2KYX A;  3FKB A;  1KQK A;  4KTQ A;  1IQZ A;  4ED4 A;  5KFC A;  1NKC A;  2AYG A;  3D68 A;  1HMV A;  4V1A k;  4NXN F;  2NS1 B;  1OY6 A;  3CCL S;  4DV4 F;  3GCX P;  3FRZ A;  4WF9 Q;  3OFE A;  2ZD1 A;  4M5J A;  1FKP B;  4B3T F;  4V19 X;  1WOS A;  2KKH A;  5T14 A;  3LTO A;  4M1K A;  2B5J B;  4YME A;  2E9T A;  5D3G A;  4IRC A;  1FEE A;  4CP5 A;  3M1V B;  2VC1 A;  4A8O A;  4DR7 J;  3CCJ S;  2DPI A;  3GIJ A;  1TU0 B;  3OXL A;  1OS5 A;  1WG5 A;  4RWX A;  1XC9 A;  4JV1 A;  3RB0 A;  2X3G A;  3RJM B;  2F5G A;  1CJU B;  1VQ5 S;  4EO8 A;  3KMS A;  4DSK A;  2MLZ A;  3ZZY A;  1LEO A;  5KFN A;  3CDB A;  2R8H A;  3TZW A;  3U1N A;  4WU2 A;  4PG4 A;  2OPR A;  3D6H B;  3NKY A;  3I0R B;  4AND A;  3RGI A;  2R7Q A;  4O3R A;  3MMB A;  5A2Q U;  1F5A A;  3TR5 A;  1XQI A;  2PMH A;  3OSN A;  1K1Q A;  3GCW P;  1EB0 A;  1OYD A;  3RB6 A;  3OR2 A;  4EO6 A;  4WP3 A;  4B02 A;  2C28 A;  1GMW D;  3W2V B;  2VAS A;  1OPI A;  4LBI A;  4IG3 B;  2QA1 A;  5JMN A;  5H9E K;  4DPW A;  1RWV B;  3B82 A;  2CIM A;  1JNZ B;  3JQM A;  1Q0N A;  2QT7 A;  3FSX A;  1K8A T;  3P8B B;  5G0R A;  3EVW A;  4UW2 A;  3SBM A;  4ZCI A;  3KLF B;  4OX8 A;  5E3C A;  3MPY A;  4LF8 F;  1HYS B;  2J6S A;  1RHU B;  5AE2 A;  1JIH A;  2XO7 A;  4WFX A;  4IH6 A;  1CQM A;  3M2V B;  5B08 A;  1WHX A;  2MKY A;  2QFJ A;  5EUH A;  4LSL A;  1J5O A;  4IOC Q;  4HH1 A;  1YBU A;  8RUC A;  4IG0 B;  4K50 A;  2AGO A;  3ZTR A;  2IHR 1;  3QSY B;  1U45 A;  1JXV A;  2UXB J;  1F60 B;  3PX4 A;  2VF3 A;  1UVL A;  4F2R A;  1RT6 A;  4DSL A;  1N6Q A;  1APS A;  3N9U C;  3OFF A;  2WON A;  4FYX B;  2MQO A;  4Z37 A;  5KTQ A;  2E9Z A;  4DX6 A;  1FJE B;  1RDR A;  2IMO A;  3HLU A;  1WDT A;  2ROP A;  3PYE A;  1WSV A;  5IV3 A;  1FDN A;  4C3M A;  2ZM6 J;  3NS7 B;  3MUV P;  4X66 F;  2R7O A;  1F1B B;  3Q2T C;  2FHK A;  3QPI A;  3NLC A;  1PAE X;  3LQV A;  2ADB A;  4LFC J;  2FJV A;  4GC7 A;  3HP6 A;  2VZ9 A;  1RBL A;  2PMZ D;  1MRO B;  6FDR A;  3E3X A;  3RBX A;  2PD1 A;  2QX0 A;  2KI2 A;  3POT B;  2XI3 A;  2XTJ P;  2F1F A;  2CDR B;  3M2R B;  1NRK A;  4LF4 J;  2OPP B;  3W61 A;  3DMJ B;  5ETT A;  2IPO B;  3FQK A;  4MMO A;  1D09 B;  2YWE A;  4DLG A;  2O5D A;  3AA8 A;  1Y0H A;  3I55 S;  1IWA A;  4ZPA A;  5AXL A;  2YQ2 A;  4J9Q A;  3M8Q A;  4B9S A;  1WTF A;  4LIW A;  1YJW S;  2DGX A;  1IBL F;  4NA2 A;  3KLG A;  3QO9 A;  4Q43 A;  2DGS A;  4YR0 A;  4K4V A;  3HD2 A;  1NJY A;  4B3S F;  4UOF A;  3EJM A;  1BQX A;  1H98 A;  1S6U A;  4GO7 X;  5K8M A;  2H5J B;  3KDO A;  3CJ5 A;  1DAX A;  2QA4 G;  3ADA C;  3CC7 S;  2DGT A;  6FD1 A;  1HI8 A;  5JJB A;  4J9K A;  2NRE A;  3NEK A;  3EVO A;  2W9B B;  3IMQ J;  4NML A;  4QWB A;  1R8P A;  5KFL A;  4DCP B;  1Y10 A;  3MR6 A;  4MKY A;  4QIE A;  2NQP A;  2G0J A;  1O8B A;  2COL A;  3CCT A;  4NE9 C;  1BY9 A;  2QN6 B;  3IN5 A;  3ZZO A;  4U6P A;  3QID A;  1ZPV A;  2ATC B;  3DRR A;  1EAY C;  1AZS A;  3DCA A;  2HVD A;  4ZIV A;  1VC5 A;  4RW4 A;  2N7Y A;  1UPM B;  1Q7Y T;  4W92 B;  5HMZ A;  4TU9 A;  3DRY A;  2C22 A;  1VRT A;  4M5H A;  4DL5 A;  2P9C A;  5HRO B;  3VAF A;  3D2W A;  1K73 T;  2RF2 A;  5HVG A;  1HBO B;  1T8E A;  3GII A;  3W7B A;  1N4L A;  2VON A;  3BGR B;  4DX5 A;  2HVH A;  2BJ3 A;  3HVT A;  3LP2 B;  1HD1 A;  1RT4 B;  1RLC L;  2R42 A;  3AJ1 A;  2ZH1 A;  3CJS A;  2XYG B;  3CGI A;  3GYG A;  3PG9 A;  2HEK A;  2HVI A;  4USW A;  1RTJ A;  4ZVG A;  2UUW A;  1GT8 A;  1S99 A;  2PE8 A;  4N77 A;  1TL4 A;  4RNO A;  4EGL A;  2VB6 A;  3TQ1 A;  1UFW A;  2NSB A;  1G3O A;  3S8S A;  3M8S A;  2HVZ A;  5ETM A;  2D3Z A;  1KTQ A;  3THV A;  4ICL A;  5LL6 d;  2HNZ B;  3MR7 A;  2MQN A;  2W2O P;  1TKZ A;  4I6W A;  3BV8 A;  1UZD A;  3BBF A;  2KU7 A;  5KOX A;  1Y3J A;  2VDI A;  2RRA A;  3J81 Y;  4NLU A;  1U2F A;  2AU0 A;  2V8H A;  4ED3 A;  1BQM B;  2LQB A;  4D3G A;  2KFY A;  1BXN A;  4G65 A;  4NLS A;  3VVT A;  2YNF B;  3SQG B;  4A8Q A;  3J7A 1;  3KLI B;  3BQ2 A;  2FJW A;  1WEL A;  2V9W A;  2RHQ B;  1IKW A;  2VPZ B;  1S0V A;  3CCW A;  2DHG A;  3A8J A;  3M8P A;  2CQD A;  2YWW A;  3JTN A;  2GIQ A;  1RBO B;  3CD7 A;  2C3P A;  3MCS A;  2DHX A;  3DLL Q;  3I87 A;  4KV8 A;  3MM7 A;  1LK5 A;  1PIE A;  2MGZ B;  2BKN A;  2YQ3 A;  3WX8 A;  4ZN1 A;  5BR8 F;  2CJY B;  4H4M B;  5CZV A;  2EFP A;  1VK8 A;  1R43 A;  1K47 A;  1N52 B;  2XS2 A;  2H51 B;  4B3R J;  2VFR A;  1C4A A;  1Q82 T;  2QTW A;  2HHQ A;  2OEM A;  4F0K A;  3C16 B;  1S0M A;  2RB7 A;  2XNQ A;  1YRU A;  1TVR A;  2B8P A;  1YQH A;  2L9W A;  3LAL A;  3CT9 A;  2AT1 B;  4NZ6 A;  4WZM A;  3W62 A;  2LXI A;  3VGU A;  1KEK A;  1VLY A;  3RBD A;  3VAG A;  3EX7 B;  1XN9 A;  3JSR A;  3PIO Q;  5D77 A;  4RNM A;  1IM6 A;  1RGV A;  3KK1 A;  4WFB Q;  3QT5 A;  3GSI A;  4ZVQ B;  4KHP F;  1FRX A;  2LEA A;  1RIS A;  1K9M T;  2LLZ A;  4O23 A;  2IBK A;  1PBA A;  1QM9 A;  3M8R A;  3I9V 9;  3C6T B;  5M2P A;  4OLP A;  2WTF A;  3CD6 S;  1H2U X;  2VIC A;  1QD1 A;  2VFT A;  3DLE B;  3GB0 A;  1WSR A;  4UF4 A;  1V3R A;  5AXN A;  1RTD A;  4FBT A;  3M6X A;  2LA4 A;  1TAU A;  2R7T A;  3CMA S;  1HBM A;  1JLF B;  4LR7 A;  3RU0 A;  1S9E B;  2R7W A;  4UUW A;  1D9D A;  1X31 C;  4TKT A;  3FDS A;  1DLO A;  4YY3 F;  4OYM A;  1Q16 B;  5KFD A;  1EHW A;  4PUO B;  3LP0 B;  4UT4 A;  2CQH A;  2V4Q A;  1P1L A;  2BYC A;  2VG5 B;  4ZVE A;  1NAQ A;  2VBX A;  2XGP A;  3SMZ A;  3DU5 A;  5CYJ A;  2Z2L A;  2C3O A;  1V5I B;  4UY8 T;  4YB7 A;  2JLG A;  5J2N A;  1LWE A;  1N5T A;  5F8M A;  1OQ6 A;  2JLF A;  1GNK A;  4K4U A;  4L75 A;  3GG1 A;  1GTH A;  2QGF B;  5B0A A;  1FTC A;  2MY7 A;  1H3D A;  2P9G A;  3FZB A;  1K1S A;  1JLQ A;  2DBB A;  3JQJ A;  4OJH A;  3CCZ A;  1RLD A;  2CPZ A;  1SH0 A;  2WK4 A;  4KRW A;  3F0N A;  3DLK B;  4LIR A;  4X4Q A;  2W1B A;  1FKP A;  1TL3 A;  1U0S A;  2WB1 D;  1S4E A;  2Q3P A;  1R8C A;  3V6K A;  2NPF A;  4F0M A;  3NGS A;  5L8R C;  1UWB B;  4ECX A;  3EDQ B;  3M1V A;  2GO9 A;  1RHM B;  3HHL D;  4QWD A;  3AFG A;  1OY8 A;  4J9U E;  3Q0A A;  4BBY A;  4P71 A;  5I3U B;  2ZHO A;  3O8W A;  3OT9 A;  5LM7 E;  1CJU A;  1RAC B;  4J9R A;  4PAA A;  5CXT A;  3GFY A;  3IR6 B;  4GKK F;  5K20 B;  4KB7 A;  4MKV A;  4X4V A;  2F9J A;  2YNH B;  4NLQ A;  1NM2 A;  1AUS L;  2HIQ A;  4QYR A;  4OI4 A;  4ZA1 A;  3I4H X;  5L38 A;  2FHM A;  2DEJ A;  3VAI A;  2XBP A;  3W2V A;  3OTO J;  1T11 A;  3I6P A;  2Y1J A;  5GMD A;  4UY8 5;  1UEV A;  1IBK J;  5E3R A;  3KHL A;  2W9A A;  4XK8 C;  4DN0 A;  5A8K B;  3UFC X;  4BCA A;  3FRY A;  1XMO J;  3BQ0 A;  1HYS A;  2XY5 A;  2KT3 A;  2UXC F;  5J2Q B;  1SH2 A;  2DIU A;  3M2V A;  1QUV A;  1X4H A;  2Q66 A;  1JKH B;  2N82 B;  4C11 B;  2RDJ A;  2ZH9 A;  1TK5 A;  5DQG A;  4XPC A;  1RAB B;  4WCE Q;  4NLP A;  5D78 A;  4MTP A;  1L5U A;  4G1I A;  5LJ3 Y;  4DFK A;  2W9C B;  1D1U A;  4IG0 A;  2HZA A;  2U2F A;  4DV6 J;  1AFJ A;  3N6L A;  3A12 A;  2CQ0 A;  1U1N A;  3KUG A;  2YQ1 A;  1PAU B;  4F25 A;  2BAC A;  4RUB A;  2MKS A;  4QQB A;  2Y1L B;  1CUL B;  5J2P B;  4ZVS B;  5GME A;  4OHV A;  3N4W A;  1G7C B;  1ZM3 A;  3TA0 A;  4JI5 J;  4FXW A;  1A0O B;  2C2N A;  1PGZ A;  2C1E B;  2G0I A;  3GP9 A;  1RJJ A;  2WZ1 A;  4P6Q A;  3W1Y C;  4DL3 A;  2W8L A;  1EQM A;  3OTC A;  4ZVH A;  2DNK A;  4PAB A;  4WXW A;  1H7W A;  1R7I A;  2D1C A;  2QE5 A;  2EK1 A;  1G6B A;  1R8B A;  2UZA A;  2UUB J;  3DU6 A;  1T0T V;  2EK6 A;  3AQP A;  3OTE A;  4K4S A;  2RDD A;  4LRA A;  2VBW A;  1WUU A;  4DSJ A;  4J9O A;  4RW6 B;  3MTK A;  3C15 B;  4X64 J;  1FEH A;  1DAR A;  1MRO A;  2HBY B;  1HKA A;  4YUD A;  4DV0 J;  1TUW A;  3LPE A;  1GEH A;  2DTJ A;  3POT A;  2KL8 A;  3HD1 A;  1RT2 B;  4RBU A;  2OPP A;  2J0S D;  2W24 A;  3DMJ A;  5ETR A;  3ZTQ A;  2VHG A;  4RNN A;  2WVC A;  2IVM A;  2LDY A;  2GGP B;  1MU2 A;  2WHO A;  2AX1 A;  3OUY B;  3HX9 A;  4CTA A;  1TMJ A;  4LF5 F;  1W26 A;  2E5I A;  2CNN B;  3PHT A;  1SL1 A;  1W2B R;  1KFD A;  1J27 A;  3QRR A;  1WKL A;  1DTT B;  4PZV A;  2EI5 A;  1A7G E;  4DV1 J;  1U1R A;  1EX8 A;  5BYS A;  1RTI B;  1M0S A;  4QYZ K;  2VOP A;  2XI2 A;  3S6E A;  2C2E A;  2G1H A;  2X1G A;  1HR0 J;  1BQN A;  3R3T A;  3TA2 A;  3TUP A;  1DFD A;  4MIA A;  4DQP A;  1RQ0 A;  4DS4 A;  2BQR A;  3N6N A;  2E1C A;  5KFA A;  3RZA A;  1BC6 A;  3D0I E;  3H7H B;  2ZH3 A;  3R5A A;  4KR0 B;  2MJN A;  1BWE A;  2R3V A;  1YX2 A;  3EGW B;  3GJR B;  4URQ U;  3FQL A;  2PFF B;  1IKV A;  3IWX A;  1NCL A;  1NPK A;  1DRZ A;  5DGB A;  4QWC A;  2DNG A;  5KFG A;  1EP4 B;  2HQI A;  2XNR A;  1T95 A;  2VH7 A;  4F2S A;  4A48 A;  2LEB A;  1NK0 A;  5HRO A;  3VWS A;  2YH1 A;  1HLW A;  4KGK A;  1SIW B;  2APO A;  1KR4 A;  1HBO A;  2B6A B;  4NXN J;  2DIV A;  3ISN D;  1H0H B;  1RT5 B;  2O1P A;  5DDP C;  3KNA A;  3H5X A;  4DV4 J;  2FC9 A;  5ETN A;  2HNY B;  4CYU B;  2AYM A;  1URN A;  3BGR A;  1IKY B;  4F3Q A;  1X0P A;  3LP2 A;  4B3T J;  1RT4 A;  4BLG A;  1RWK B;  2CQC A;  2JNJ A;  5DM7 Q;  3NOC A;  4O3S A;  2A6M A;  3KLE B;  4OYZ A;  1UCN A;  4PG7 A;  2XUL A;  4PKD B;  4ES2 A;  3DYA B;  1SKS A;  4QPX A;  2HBZ B;  2J0Q D;  3EM1 A;  2DNZ A;  4RZR A;  2XQC A;  2RQM A;  1R0A B;  3PIP Q;  2AJ0 A;  2YNI B;  2JEG A;  3KHH A;  3ICL A;  2YX4 A;  4C0B A;  2R8J A;  2R8K A;  2KT5 A;  4QR2 A;  2HNZ A;  3FBB A;  5B0G A;  3R7B B;  4BDP A;  4N7T A;  4HL9 A;  3P5B P;  2W7O A;  1Q81 T;  3GJT B;  1SPB P;  2ZE2 B;  3N5F A;  4MFB B;  3OJU A;  1AT1 B;  1P9Y A;  1WOR A;  5HBM B;  2HFV A;  1B3T A;  3T1H F;  4A8S A;  2YNF A;  2B7C B;  3KLI A;  3T6J A;  2D3O 1;  5CCM A;  2A0F B;  2J0W A;  4QW9 A;  4OYW A;  3ZC4 A;  1B7F A;  2KZZ A;  2KDO A;  3CSK A;  4AUK A;  2KXH A;  3PNI A;  2ZC4 A;  3J81 j;  2V4R A;  3RYL A;  1FRJ A;  2RML A;  4LF8 J;  1JMT A;  4AL6 A;  4YDX A;  1HI1 A;  2B4O A;  2CPF A;  4H4M A;  2CAJ A;  4NXM F;  1MG7 A;  2CPY A;  4N56 A;  1SBR A;  3VCD A;  1PO6 A;  4U7U D;  1S72 S;  2CQG A;  1NSA A;  4C8L A;  4Y2I A;  2GX8 A;  4FYD A;  3C16 A;  4J37 A;  1P1T A;  1RWN B;  4CO2 A;  4C8Z A;  3LWL A;  1FFW B;  3NRB A;  2GMH A;  3C46 A;  5HJY A;  2QJ3 A;  4UTG A;  1YJR A;  3DDI A;  4K0K F;  3PRB A;  5CA5 A;  4C7Q A;  3SCJ E;  4KIA A;  3KYL A;  1LFW A;  1LV5 A;  1DY3 A;  2XMU A;  4C8K A;  1DJ0 A;  5HQL A;  2OH2 A;  4EMD A;  2K1R B;  5KG3 A;  2FIU A;  2CYY A;  3I0S B;  2VL1 A;  5GAE I;  3C6T A;  3EMT A;  3IG1 B;  2OTJ S;  4NLW A;  1LWC B;  4FYV B;  2KH9 A;  4IO9 Q;  1FWL A;  3DLE A;  2HQD A;  2OI2 A;  3D66 A;  3T6B A;  2DRB A;  3DXB A;  3PZP A;  2UP1 A;  4X66 J;  1JLF A;  4UUX A;  4HDG A;  2HHS A;  1NEE A;  5GAE U;  1S9E A;  3HFV A;  8AT1 B;  4O44 B;  1T3O A;  1CVJ A;  1NH8 A;  1PKU A;  2AYE A;  3AB4 B;  4CH0 S;  4PUO A;  2HKE A;  4L73 A;  4OI0 A;  1WC4 A;  4ZKA A;  3LP0 A;  5DET A;  2VG5 A;  1S79 A;  3T19 A;  3MPW A;  3RAM A;  4TLQ A;  2J7W A;  2FVS A;  1Y3K A;  3IBC B;  2BMB A;  2AYB A;  1H2V Z;  1TEL A;  1FNM A;  4NPO A;  2AJQ A;  2CJA A;  2L48 A;  2AV5 A;  2WBM A;  4YOE A;  4OMF G;  4DXL A;  2E44 A;  1YIJ S;  3I5B A;  2AGP A;  3R5D A;  5KFQ A;  4YEA A;  1IBL J;  2WVF A;  2MYF A;  1GXU A;  2N3L A;  1VQN S;  3MAA B;  1DBD A;  1KTV A;  3T3F A;  1KON A;  2VFU A;  3MR3 A;  3UR0 A;  4P74 A;  1U7L A;  2GCF A;  4B3S J;  2BJ9 A;  4PG5 A;  3FBF A;  1V6H A;  5E0O A;  5GAG I;  2OMO A;  1UWB A;  2V69 A;  3V2U C;  5DS7 A;  4ERD A;  1Y00 A;  5C5J A;  1CJK B;  4DG1 B;  4Y34 A;  3R5C A;  4JB8 B;  2QSW A;  1WC3 A;  4USI A;  3OHB A;  5I3U A;  3AXM A;  3P5T L;  1RU1 A;  1B4S A;  4BC7 A;  5AJ3 F;  5HLF B;  1R8A A;  5GAG U;  3T9N A;  3IWL A;  3W2W A;  4C8N A;  1HPZ B;  1JLC B;  1VQ4 S;  1SVD A;  4PYD A;  2FVQ A;  2BAB A;  1Q7L B;  2HK3 A;  5B0D A;  1AXQ A;  5KT4 A;  2WVE A;  1FWP A;  3PR4 A;  4KHR A;  3CMQ A;  2PA3 A;  3TAN A;  4LJM A;  4PPD A;  1ZAV A;  4KH0 B;  5B09 A;  1CJV B;  2DVI A;  4DPY A;  1TK8 A;  3V6D B;  1I94 F;  4X4U A;  3TNV A;  2KJW A;  5A8K A;  5KT2 A;  2F8H A;  3C19 A;  2LP4 A;  1VBZ A;  2GHW A;  1M5H A;  3HHL C;  1RTZ A;  3E01 B;  3JAM Y;  1OIA A;  4YS2 A;  1JLE B;  2XEX A;  2CJQ A;  3U7J A;  5J2Q A;  2JX2 A;  3SEO A;  2M5Y A;  1KHV A;  5DG8 A;  4ILR A;  3DM2 B;  4C11 A;  1GFW B;  4LBP A;  5I3P A;  3FEZ A;  5KFY A;  2CPE A;  4MYT A;  4JV5 F;  3EGV A;  3JS9 A;  1NK4 A;  2JFK A;  2E5G A;  1TFY A;  5F8N A;  1SJ4 P;  2W9C A;  1X4B A;  4ILM A;  1PJ7 A;  3R5J B;  3QGP A;  1AA1 B;  1NB2 A;  3ZZZ A;  1XR5 A;  1DQ9 A;  5THW A;  3TAR A;  1RB0 A;  2HRT A;  4LFC F;  4DL0 C;  5EHH A;  3TX8 A;  1PJ5 A;  1FF2 A;  1JK9 B;  1MWZ A;  1CUL A;  5K14 B;  1QUP A;  1JLB B;  3IA0 A;  3TVY A;  3HVW A;  1R0B G;  1T03 A;  4N47 A;  2KM8 C;  2KRR A;  3HM9 A;  1Q53 A;  2ZKT A;  4NYP A;  3Q8Q B;  1YJ9 S;  2QYG A;  2Q79 A;  2XMJ A;  2UXD F;  3L09 A;  4B3M F;  3TYT A;  2G4B A;  4OJ3 A;  1ZH5 A;  3O5T B;  1UW4 A;  3VAK A;  4DR4 F;  2QIF A;  1K0T A;  3D1Q A;  3OR1 B;  1T9V A;  2VOD A;  1FDD A;  2HHX A;  5BR8 J;  4RW6 A;  4I56 A;  3OL8 A;  2MDA A;  2M52 A;  3C15 A;  1HBN A;  2KXF A;  4CLS A;  2WW4 A;  3LWM A;  4B9M A;  4DV5 F;  3SQO P;  3JSB A;  3OW2 R;  1RT2 A;  3AOB A;  2ZJP Q;  4JI8 J;  2C3Y A;  3CW2 C;  4WFZ A;  3G6X A;  2ZUG A;  4DR6 F;  3V81 A;  4F26 A;  3AH6 A;  4I6A A;  4MKB A;  2DO0 A;  5HN0 A;  3VHQ A;  2QMU B;  2Z0G A;  4YP3 A;  3BJY A;  4ED0 A;  3UWT A;  2QL7 B;  2DKO B;  2XSF A;  3JYT A;  3N5B A;  3UR3 C;  2XY6 A;  3R1L A;  1Q8K A;  4LFA F;  4KHP J;  1R89 A;  2O66 A;  1DTT A;  4J7C A;  4DBQ A;  2GQC A;  3ZZP A;  1VQO S;  3UD4 P;  3EXY A;  1RTI A;  4A8W A;  4LFB F;  3TI0 A;  2XWX A;  2C2K B;  1X60 A;  3TAP A;  2UVW A;  2ABY A;  4NLX A;  4JV0 A;  1S49 A;  1U1P A;  2C2Z B;  4ZDN A;  1N33 F;  1I51 B;  4K7Q A;  3CJK B;  3IP0 A;  2DO4 A;  5DRK A;  2H4W B;  4QZV B;  2CJB A;  5AXM A;  3CCS S;  2QEX S;  3TAM A;  4Q8F A;  5A0Y B;  1RA6 A;  1B0T A;  4RW8 B;  1KHW A;  4NZ7 A;  2R7X A;  4I2P B;  5E5N A;  5DG9 A;  1X5P A;  2JZ5 A;  1C0T B;  2QA4 S;  4FNI A;  3LA0 A;  2G2Z A;  2HGL A;  1VI7 A;  5JXS A;  5J2M B;  4M8L A;  1EP4 A;  2IRX A;  1JJH A;  3IGV A;  4TY9 A;  4EU0 A;  4DCJ B;  2Z30 B;  3CD0 A;  2R7S A;  2KFZ A;  4OJ1 A;  1WF2 A;  4C0H A;  2B6A A;  1GK8 A;  2CPH A;  4B3O B;  3AOA A;  1RT5 A;  4BC9 A;  5FJ4 A;  2HNY A;  4CYU A;  3JQK A;  4JP8 A;  1IKY A;  4CLW A;  2EFN A;  2OPS B;  4Y2K A;  1KVK A;  4E98 A;  3PEJ A;  5C7P A;  2Z8Q A;  4OYO A;  2AJ4 A;  3KLE A;  2L9D A;  3HSJ A;  4ILL A;  2HS0 A;  3MM6 B;  5KFT A;  3OJS A;  4R25 A;  4TY8 A;  2HHV A;  1A9N B;  4A8M P;  3DYA A;  2OUG A;  3WHI A;  4ZVU B;  1CJT A;  4JI7 F;  1Q86 T;  3KUH A;  4CLZ A;  3H8Y A;  4Z7Y A;  1G2E A;  1R0A A;  3ZZT A;  3VV2 B;  5A8R B;  3L7O A;  1RE1 B;  4I2Q A;  2HAF A;  3HSZ A;  3O3L A;  4DUZ F;  3EIC A;  4XDC A;  5KG6 A;  2NXE A;  4U9R A;  1TL7 B;  4H4K A;  1EJ7 L;  2CZ4 A;  3KTQ A;  2W2M P;  2VFV A;  3CPW R;  3IRX B;  2M88 A;  2JC1 A;  2HZV A;  4K5S A;  3K8V A;  3R6G B;  4MFB A;  4KE5 A;  2E5J A;  3F44 A;  4M5N A;  3H2L A;  2RSQ A;  4U8V A;  5HBM A;  2LXF A;  4C4W A;  4CO4 A;  2VDH A;  4RU9 A;  1TK0 A;  3PJX A;  1NSQ A;  2V50 A;  1RWX B;  4P7T A;  4KSE B;  2BM1 A;  3L9Z A;  2DRA A;  4HHH A;  3QJJ A;  1QE1 B;  2YKN B;  2ZH7 A;  4PYA A;  4DJB A;  2GV1 A;  1ACM B;  2I6W A;  4IYQ A;  2RIJ A;  3D28 A;  1D9F A;  4J9N A;  2RHS B;  4F4Z A;  4M5D B;  4NZ0 A;  2DCU B;  3Q23 A;  4NRT A;  2XZT B;  5HQM A;  3BM7 A;  2MLX A;  2CNK B;  1WJ9 A;  3MMC B;  4WKY A;  1GTE A;  4JI4 F;  5L1L A;  1X4A A;  5L39 A;  2DXD A;  4DQS A;  1T9X A;  2W4P A;  3G2X A;  4R0E A;  2LU2 A;  4QU7 A;  2Z2Z A;  1UW9 A;  4WIQ A;  3HHK A;  1C1C A;  2HWT A;  4CIO A;  3MI7 X;  2VPW B;  2J6U A;  2VG6 A;  4X4R A;  3QT7 A;  3RB3 A;  2EBE A;  2K1R A;  1UVM A;  3I0S A;  1PSD A;  5A8W B;  4IR9 A;  1WI8 A;  1PYT A;  1CQN A;  1LWC A;  1F2G A;  3CC2 S;  2V5H G;  2HHW A;  2WSE C;  2Z4P A;  3CTR A;  4WE1 B;  5T41 A;  2CPI A;  1HFE L;  3CJ3 A;  3NCR A;  2CUY A;  2DD8 S;  4DL2 A;  1VQK S;  3CO9 A;  3HHD A;  3VAH A;  2L9N A;  2ZH5 A;  4P73 A;  1WC6 A;  2J6T A;  4WKR A;  2IRU A;  2XY7 A;  2MQM A;  3Q8S B;  2ZIT A;  5F3T A;  3CDW A;  1XER A;  4WFN Q;  1UEU A;  2KTQ A;  2K3K A;  3BSO A;  2GQ2 A;  1FRH A;  3FMW A;  4F0H A;  5DJB A;  2RIL A;  4MK8 A;  1QSL A;  1JNR B;  4DI6 A;  1U0H A;  5KFV A;  1K44 A;  1WC5 A;  4HDH A;  1NME B;  1FKA F;  2ZKU A;  4DV3 F;  2MXY A;  1NH7 A;  5E3Q A;  1R6V A;  4LF5 J;  2FJA B;  3HKZ D;  2DNN A;  4DR2 F;  3WC0 A;  1U8S A;  4CQ1 A;  2FD2 A;  5KFB A;  2IC3 B;  3MAA A;  1FA0 A;  2DNM A;  1NPP A;  1JB0 C;  3GE9 A;  3UQS A;  4F02 A;  3GYN A;  3G86 A;  1N56 A;  1ZAW A;  1UTA A;  3NMR A;  3OSP A;  5BJR A;  3MTJ A;  5D4O A;  4DF8 A;  4DG1 A;  3OV7 A;  1FJG F;  5HVF A;  2DR5 A;  3M6W A;  4E0D A;  1UVN A;  4IO1 A;  1IKX A;  4C98 A;  2C2R A;  5U47 A;  4UOC A;  3O44 A;  3MED A;  3CCU S;  5HLF A;  1HHS A;  1NKB A;  2G13 A;  2XS7 A;  3D6M B;  4DFP A;  2NCK L;  4CLT A;  1IR1 A;  1S6O A;  1HWK A;  3SZ2 A;  2DYA A;  4EZ6 A;  1JLC A;  1W25 A;  2DY1 A;  2GO8 A;  1XIQ A;  3UE2 A;  3T5J A;  4LRB A;  4FYY B;  2BOP A;  5IXU A;  3VF0 B;  2PO4 A;  4ETZ A;  2EG1 A;  1W2I A;  2QMX A;  3QNW B;  3UD5 A;  3BKU A;  5F8H A;  2QMW A;  4QWA A;  3FCV A;  4ANE A;  4HTJ A;  1CJV A;  4IOA Q;  1R31 A;  4CLL A;  3V6D A;  4AD6 A;  3K59 A;  1KNZ A;  4KT0 C;  2GA7 A;  3HDS A;  2ZUA A;  1TKT B;  4EYH B;  3D6F B;  1UFK A;  4NLR A;  3OBI A;  1TKX B;  3J7Y I;  2PA8 D;  1GXL A;  4TVA B;  4IQM A;  1XTZ A;  1N32 J;  1KOO A;  2BJ1 A;  2D7S A;  2W2P P;  2J9C A;  1JLE A;  2QC3 A;  4W4M A;  2MB0 B;  5KAK A;  4JV2 A;  1TR0 A;  1BWV A;  2E7X A;  2G1D A;  3BR8 A;  3WX4 A;  4DPU A;  4P7V A;  3J7Z T;  2NLW A;  3G8T A;  1VLO A;  3I4P A;  3DLH A;  1FXD A;  1CS4 A;  4RBV A;  3K0J A;  4AL7 A;  3TVK A;  4WPA A;  3PV8 A;  1U6Z A;  2C3U A;  2Y8Y A;  4ID8 A;  5B0F A;  5DO2 A;  3CCV S;  5HSP A;  4ED8 A;  1S1V A;  3QFH A;  3UDL A;  2ZH2 A;  3HVA A;  2G2O A;  4L76 A;  4EBC A;  3RAX A;  5GAH I;  4DV0 F;  1PYO B;  3MUM P;  3QJL A;  2B4V A;  2NPI A;  1LK7 A;  3AOD A;  3EPG A;  3T1H J;  1L3U A;  5D15 A;  3T9Z A;  3SV4 A;  4CLY A;  3IR5 B;  3PYD A;  2BE2 A;  1F3F A;  4ZK7 M;  2HHU A;  4I67 A;  3CJQ A;  2EFQ A;  4DZ6 A;  1S7I A;  2HFU A;  1D0E A;  4A4J A;  4DSI A;  5KFR A;  4PQA A;  1AB8 A;  2KN4 A;  2HFS A;  5E2Q A;  4O4G B;  3BGL A;  2J7K A;  2MZ1 A;  1WKJ A;  3NNA A;  4O3Q A;  1E6Y B;  2P2C B;  4CLP A;  4NXM J;  5KFO A;  3QSI A;  2BW7 A;  4ALZ A;  3LPY A;  5F3Z A;  2DB1 A;  3N0V A;  1Q78 A;  1WC0 A;  1KP6 A;  1ZZF A;  1TV6 A;  1ZM4 A;  1QAI A;  2GMJ A;  4ZP8 A;  3IR7 B;  3J7Z 5;  1MNE A;  4USK A;  1Y5N B;  2ZWP A;  4ED1 A;  1VQ6 S;  3UN5 A;  2IM0 A;  1WEY A;  1WTB A;  2VPY B;  3OTB A;  2XMA A;  3AQO A;  5KFU A;  4K0K J;  2QA2 A;  1RTH B;  2K8G A;  1N8R T;  1DHM A;  1IQT A;  4WXO A;  1OQ3 A;  1RYS A;  2Q1L A;  1KVJ A;  2ZH6 A;  1NU4 A;  5DDQ C;  4ZIT A;  4WZQ A;  3IC1 A;  4YN3 B;  2YWH A;  1UEK A;  2KXN B;  1FNO A;  4OZ1 A;  2HND A;  6AT1 B;  4X4S A;  3I96 A;  2H5E A;  4F36 A;  2Y1R I;  3E8O A;  3IGN A;  4C97 A;  4IKA A;  4O3N A;  2OD4 A;  1XEZ A;  4I4B A;  1X9S A;  2BRK A;  3W8P A;  3CCE S;  1XJW B;  2JVR A;  3DLB A;  3QZ7 A;  1I3O B;  4EFA C;  3WC2 A;  3TWZ A;  3C6U B;  3CJT A;  2J9D E;  4ES3 A;  1VIX A;  3S1T A;  3G82 A;  3FSY A;  4P10 A;  4XAK A;  3GLJ A;  5HP1 B;  1YJV A;  5A0Y A;  2CWK A;  3H20 A;  4RW8 A;  3VTI A;  1SJQ A;  1YVF A;  3ILO A;  3TQE A;  3QIP B;  4RPF A;  4I2P A;  4EK2 A;  1M90 T;  2I38 A;  1C0T A;  3W64 A;  2RAQ A;  4P72 A;  3SFG A;  2XYP B;  4AXI A;  2JOQ A;  2RVJ A;  4J9P A;  3M8W A;  1SL0 A;  3QT6 A;  2KJV A;  4RUH A;  5J2M A;  4U95 A;  4ZS6 A;  2QLX A;  5IC6 B;  2WBR A;  4K4Y A;  2L08 A;  5CH7 B;  1L3V A;  4RJV A;  4CCH A;  1H74 A;  2Y0B B;  1XK8 A;  3A8E A;  3V6H A;  3UVJ B;  3QJP A;  2PSZ A;  4HEA 9;  1UL3 A;  2ZZT A;  4ESN A;  4RR5 A;  4IOB A;  4B3O A;  4MIB A;  4ZCL A;  4WYW A;  3GG0 A;  4Q2M A;  3ET6 B;  3PW7 A;  4OI2 A;  3M9O B;  3K2Y A;  1X5T A;  3QAT A;  2OPS A;  3RRG A;  4LF2 A;  4FF3 A;  1X0F A;  3PX0 A;  4ZLN A;  4K2J A;  3J7A N;  1CPZ A;  5FDL A;  2GW8 A;  4KO0 B;  1SQF A;  4ECS A;  2W2N P;  4DQQ A;  3KFW X;  3MM6 A;  1BD6 A;  3HVR A;  3A3O B;  2DJW A;  2IJR A;  4P52 A;  3T1Y F;  1U6F A;  4Q7A A;  3MR2 A;  2ZWO A;  5AJ3 J;  1JJ2 R;  2R9L A;  2QLB B;  3KKF A;  5A8R A;  1RT3 B;  2AMC B;  3R5B A;  2XLJ A;  3HZG A;  4C48 A;  2Z57 B;  3VQT A;  5F0W A;  3HJV A;  1RZM A;  1TL7 A;  4ZPV R;  3CCQ S;  5JVG Q;  2KFN A;  3MEC A;  2M7S A;  3B78 A;  1CEZ A;  3EE3 A;  4FXV A;  1FES A;  2X1B A;  4QOT A;  4USM A;  2DNO A;  4WWS A;  4TQR A;  4DL6 A;  3V4I B;  4KGV B;  3DRS A;  4XO0 A;  2VQF F;  2GQQ A;  3NNH A;  4C8Y A;  3GR0 A;  1VIO A;  4A0U A;  4TLR A;  5ETP A;  5D8H B;  3KK2 B;  3SDE B;  2UUC F;  1QE1 A;  4LVO P;  2YKN A;  3JXO A;  2AWZ A;  1I94 J;  1FVQ A;  5HO4 A;  4F3O A;  2QYC A;  4KAI A;  5IM0 B;  2DXE A;  1C4C A;  3ITH B;  3LGM A;  1E6V B;  3OL6 A;  3R8Y A;  5DZ6 A;  2ADC A;  1Q8B A;  4DUY J;  4M5D A;  3KK3 B;  1KQF B;  4E2F B;  4LRC A;  1MML A;  4OZ5 A;  5H1S V;  2EW9 A;  3TEH B;  1FE0 A;  5H9F J;  4JV5 J;  4DEZ A;  2E5L F;  4ANC A;  5I4M A;  2VQE F;  5KG4 A;  4AE5 A;  4RW7 B;  4MJK A;  2POK A;  3RR7 A;  5LSR A;  1RAG B;  3IWN C;  5LSL A;  1UJ4 A;  3LAM A;  1M1H A;  2BZ2 A;  1PJ6 A;  4YR3 A;  1NXI A;  3VR1 A;  1MMN A;  1U02 A;  2LFV A;  2GJF A;  3MEE B;  2QV6 A;  4LRD A;  4CDI A;  1RKJ A;  1RAH B;  4LF1 A;  2OSQ A;  3MM8 B;  3BDE A;  4ZVO B;  5D4N A;  5A8W A;  4KGZ B;  1IBM F;  2ZD1 B;  1HQE B;  2GAH C;  3EZO A;  4PRF A;  4ER8 A;  2VV5 A;  4NLG A;  2MQP A;  3M4X A;  3G96 A;  4WE1 A;  2J0X A;  2UXD J;  3C14 B;  4IQX A;  4B3M J;  4B9V A;  2CVI A;  3BGO P;  9RUB A;  2V63 A;  1X4D A;  1KRP A;  3DRX A;  5ITH A;  3M8Y A;  4DR4 J;  5GVQ A;  4F04 B;  5CYQ A;  3FMB A;  1S0N A;  1HNW F;  4MT1 A;  2KHC A;  4OHZ A;  4O0N A;  2Z2Y B;  3C8Y A;  2ACM A;  1BGX T;  3GWC A;  4DV5 J;  1VQ9 S;  5D4P A;  4RUC A;  4LF6 F;  3QBC A;  4F4A A;  2OPR B;  2ZOG A;  1SI9 A;  2LCW A;  2HBR B;  4ZP9 A;  1S97 A;  5L46 A;  5LOQ A;  3S7R A;  4DR6 J;  2LDI A;  3DGV A;  1U1M A;  3DDN A;  1KOH A;  5HAT A;  4W90 B;  3VZH A;  2R2U A;  5KOW A;  4CM0 A;  1R3N A;  3M8Z A;  2GHP A;  2VFS A;  1RWW B;  2IIH A;  2DH9 A;  3LAN A;  1WHW A;  1ULR A;  5I3Q A;  4LFA J;  4C8M A;  1LFP A;  3EVM A;  2EG2 A;  3KWM A;  2RQC A;  2FB0 A;  4OYB A;  2IC3 A;  4PG8 A;  4HHU A;  3C66 A;  2W8K A;  1V9O A;  1EKR A;  1YJ7 A;  2I5J B;  1RCO B;  4LFB J;  3JTP A;  1FO1 A;  2ZVS A;  4O3P A;  3B6B A;  4ZLJ A;  4OZ0 A;  1TZ0 A;  3GIL A;  1U25 A;  2ZH8 A;  2L41 A;  4N8N A;  4FVM A;  1H72 C;  5C42 A;  1RAO A;  1VOM A;  2AJF E;  5E41 A;  1R6Y A;  1VQL S;  1N33 J;  1S77 D;  2ZJR Q;  5KFX A;  4O4R A;  3SCK E;  3R7S B;  4C9D A;  2YWG A;  1OYE A;  3SXL A;  1OMS A;  1T02 A;  4NMX A;  3HHE A;  3M9N B;  2O01 C;  5HL7 Q;  3BYP A;  1OPZ A;  3TW0 A;  5HQ8 A;  2H54 B;  4YDD B;  2ALZ A;  2FQQ B;  4Y6I A;  5JVH Q;  4PEO A;  4TXS A;  4JI6 F;  1KWM A;  3A1Y G;  2WSF C;  3DRP B;  3I5C A;  1XMQ J;  1X5O A;  3NWR A;  1VC6 A;  2N4C A;  4CH1 A;  2IA0 A;  3M30 B;  2K2P A;  1YSJ A;  4OZL A;  4NLD A;  1XBW A;  4DOZ A;  1B99 A;  2Q43 A;  5T7L B;  2NXU A;  5KFM A;  1QAX A;  3T1A A;  2CQ3 A;  3MCO A;  1VFJ A;  4ECQ A;  1QAJ A;  4G3I A;  2ZHB A;  2MQ8 A;  2IYI A;  1SCJ B;  1FX4 A;  1TKT A;  4TN2 A;  3CE8 A;  1GMV A;  4IFY B;  2ZBQ A;  1TKX A;  2GML A;  2KVQ E;  2OIH A;  2YWF A;  3PDN A;  1DTQ B;  3MM9 B;  2ASD A;  2RE1 A;  3VQS A;  2GJI A;  1S7H A;  1KS2 A;  1BHN A;  2X3D A;  4RW9 A;  2HQC A;  3DOL A;  3R2D J;  1DUR A;  4X65 F;  4JI7 J;  2DCL A;  1RHJ B;  4X4N A;  4NLT A;  3M2U B;  4DUZ J;  3DHX A;  4RO0 A;  3TP2 A;  1GH8 A;  2EFO A;  1HW9 A;  3QAE A;  3OXF A;  2BE9 B;  1JXE A;  4C3K A;  2ZOF A;  3BEG B;  3TJ8 A;  1N5Q A;  4G6V B;  3R6L B;  3ZZ0 A;  4YB1 P;  3TUJ C;  2UVU A;  1FDB A;  3BN7 A;  1IJE B;  4NLO A;  3H25 A;  2FLP A;  3M8Q B;  1P6T A;  4JI8 F;  3G4S S;  1RWU A;  4NX9 A;  4AXJ A;  3KLG B;  4HI2 A;  2Q6B A;  5ETO A;  3U27 A;  5F8L A;  4LSZ B;  3QMQ A;  1OWX A;  2ATL A;  4P75 A;  4RL1 A;  2IY5 B;  2BVZ A;  3DOM B;  4K2X A;  5CQG A;  2V9K A;  5H9F K;  3HCX A;  3LGH A;  1S9G A;  1VRU B;  4O4G A;  5E3A A;  3HFK A;  2HGM A;  2IDE A;  3LUY A;  4CT9 A;  2YQ0 A;  2A2C A;  3W9J A;  5DLG A;  4B9T A;  3IXQ A;  3HO1 A;  3FC9 A;  3R9L A;  3X3U A;  2A2D A;  4P9S A;  1NPR A;  4ZLL A;  4ZVR B;  2A1B A;  4JI4 J;  5EX3 A;  2MLY A;  2ZC3 A;  2WOM B;  3DRR B;  3IAM 9;  1FFG B;  4RW4 B;  3CJR A;  2HLT A;  3GIR A;  1CBK A;  3G6V A;  4IR1 A;  2MZS A;  3OTD A;  3MPV A;  2BKO A;  5ADZ A;  1IWG A;  3TZZ A;  2VKR A;  2JFD A;  2RNE A;  2NSC A;  2QSF A;  2RKI A;  2MZQ A;  2KG0 A;  2B8Q A;  3FBE A;  3CF5 Q;  1NJI T;  2XMT A;  5HAO A;  1T94 A;  4IUF A;  1SJF A;  5GAD U;  2M9K A;  3N01 A;  3HVT B;  5K9F A;  2R7U A;  5H9E J;  2WCX A;  1N36 F;  2V68 A;  4F8R A;  5KG2 A;  5EX0 A;  1X4E A;  4G1P A;  5SUH A;  2ZH4 A;  1ZAX A;  4ECY A;  3C6U A;  2ZNY A;  3UN3 A;  4F50 A;  2RH3 A;  1FRL A;  5HP1 A;  4Z2X A;  4RNF A;  1A6L A;  2JDJ A;  2B5J A;  1TUV A;  4XDD A;  4DR3 F;  1NND A;  2HUR A;  2AEF A;  2UUA F;  1JWW A;  2IA6 A;  2V6A A;  4CI0 B;  2BA9 A;  4EZ9 A;  1LNQ A;  4YHH F;  4DV3 J;  3TX0 A;  3UVJ A;  1N34 F;  5IQ6 A;  2KB2 A;  1LW2 B;  3I9Z A;  5AE1 A;  1VHI A;  4CRJ A;  2AP6 A;  3ZTO A;  1CC7 A;  5LXY A;  3I0R A;  2LEP A;  4DR2 J;  1FK9 B;  2FHJ D;  3ET6 A;  4NCA A;  3BGU A;  2MMY A;  3ELH A;  3M8P B;  5A6P A;  2HQF A;  4PXB A;  1QTN B;  4KH1 B;  3RBE A;  2M2B A;  2CQ2 A;  5E3P A;  2E7W A;  4IG3 A;  2P6S A;  4FBU A;  1FJG J;  3MOZ A;  1N0U A;  4USH A;  4OQJ A;  5K8P A;  1U2R A;  1XWL A;  4PWD B;  3BKF A;  2B9Y A;  1XNQ F;  4PCQ A;  1RT3 A;  5EN1 A;  3ENA A;  2JJ4 D;  1TVR B;  3KLF A;  2RS8 A;  1TKD A;  1S57 A;  2BJ8 A;  1MN7 A;  3N6M A;  1RU2 A;  2C3M A;  3DXS X;  4EBE A;  4N8O A;  4JI3 F;  2VU5 A;  3TO8 A;  4M5L A;  2B9X A;  1RWO B;  3OXG A;  2ASL A;  3AD9 C;  3G6Y A;  2LU1 A;  3V4I A;  1HHT P;  2CRL A;  1K0V A;  1YGY A;  1VS3 A;  2OAU A;  1Z1Z A;  1SJ1 A;  2F8E X;  5LMU F;  4OZJ A;  2AW0 A;  1FT8 A;  2W7A A;  2LYV A;  2HFZ A;  1YZ7 A;  4F3M A;  1KFS A;  4ED6 A;  2YY3 A;  3MAH A;  2PEH A;  4KY3 A;  2CKW A;  3ITH A;  5AE3 A;  1HBM B;  4NLY A;  1E6V A;  1IR2 A;  3H90 A;  5DDR C;  2H5I B;  4CZC A;  2VBZ A;  2FYX A;  2M8H A;  2MZR A;  2VIH A;  1DLO B;  1Z2L A;  5KFS A;  1N48 A;  3W5X A;  4I64 A;  4WII A;  4FS1 A;  3CD5 A;  5IT9 Y;  2FLL A;  3BH6 B;  5D0R A;  1JLG B;  3ZTS A;  2BAN B;  1R8H A;  4PXD A;  4RW7 A;  3W60 A;  1FJ7 A;  1U1O A;  4FVC A;  2YNG B;  3SIP B;  3LW5 C;  2ILZ A;  4LF9 J;  4LR9 A;  4M5G A;  4HT7 A;  3MEE A;  3L95 X;  1S76 D;  4A8X A;  1TQL A;  3IBF B;  4FZV A;  4AYB D;  2DR6 A;  2XMM A;  3D1H A;  3MM8 A;  4QIG A;  2N4D A;  1RCX B;  2NYH A;  4LBH A;  1JLQ B;  4E8U A;  4CLF A;  4X62 F;  3IM9 A;  1JLA B;  3M2R A;  2JEI A;  4DPT A;  4A8Y A;  2M3D A;  5BYR A;  1PC5 A;  4WP9 A;  3PX6 A;  2YKP A;  1HQE A;  3B4M A;  4OI6 A;  1TL3 B;  1U8W A;  3D3B J;  2FDN A;  3MPD A;  5E7O B;  3C14 A;  1JQG A;  4A0T A;  2DY9 A;  1SJ3 P;  2ACY A;  4WBF A;  1HHQ A;  3JSM B;  3NOG A;  2ZJQ Q;  1RSC A;  3ZNJ 1;  4ZIW A;  4HLB A;  3VGS A;  2HPU A;  1U49 A;  4LRF A;  1YHQ S;  3NGT A;  4P2F A;  2GVD B;  4QIV A;  3ZTP A;  4B08 A;  2FTR A;  1ZYQ A;  2JEF A;  2IDL A;  1LW0 B;  1WDD A;  1NDC A;  4KQZ A;  1V3S A;  5IWA F;  3HMJ G;  3MUR P;  3MMJ A;  2KYZ A;  2MKJ A;  5KFK A;  1LWF B;  1Z4U A;  1ZA1 B;  2BQ3 A;  1RI7 A;  5AXK A;  1NBE B;  2DR8 A;  1S9F A;  3M6U A;  3NG8 A;  2PDA A;  3MEG B;  1LOU A;  3GJQ B;  5HK4 A;  1IR0 A;  2EWH A;  3PKY A;  4HVZ A;  2W9B A;  2HRY A;  4J90 A;  5ETV A;  2Z2M A;  2XWY A;  2V8G A;  4Y0F A;  5HAN A;  4Y65 A;  1I1G A;  4LVN P;  1NJX A;  1Q79 A;  4ZJL A;  4ZHR B;  5MAO A;  4W98 A;  2BM0 A;  3QGG A;  2I5J A;  3GTY X;  2RUG A;  4JOU A;  2FVR A;  3UNY A;  3DI6 B;  4OYA A;  4K4Z A;  2CG4 A;  4I68 A;  3N28 A;  3MOJ B;  3NXZ A;  1YLX A;  4BWJ A;  3T41 A;  3HT0 A;  2WAQ D;  4DX7 A;  2CXE A;  4B9U A;  2P8I A;  4N76 A;  4FF1 A;  3EXC X;  3K57 A;  4I0W A;  4HH0 A;  2HK2 A;  3KG1 A;  2NXC A;  4ZPC A;  1N32 F;  1M5V C;  3AY0 A;  2DNL A;  2JRS A;  5KFP A;  1KSP A;  4P2X A;  7FD1 A;  3JSY A;  2GVZ B;  5ETQ A;  3WDO A;  4EUV A;  7FDR A;  2YBV A;  3ISZ A;  2WSC C;  3DRP A;  5BYQ A;  2W25 A;  5IFM A;  2M70 A;  4DF4 A;  3F56 A;  2XZW A;  3M30 A;  2BEF A;  1GX5 A;  5L9X A;  2Z58 B;  3PW4 A;  4Q5V A;  1SQG A;  5T7L A;  1RWP B;  3MAQ A;  4GVB B;  1VCT A;  3GR1 A;  3AT1 B;  2JHE A;  3BSN A;  4YQW A;  4ES1 A;  4ZMM A;  2LEC A;  2JSX A;  5MLC V;  4LMZ A;  1RAJ A;  4QR0 A;  3OLA A;  4DLE A;  3MF5 A;  1EQ0 A;  5DG7 A;  2R8G A;  5KFZ A;  4IFY A;  3KLH B;  2OFH X;  3NBP B;  1H6K X;  1ZM2 A;  3GFZ A;  3MPU B;  4RKU C;  4HTI A;  5LMN F;  1XR7 A;  4URG A;  2LMI A;  1DTQ A;  1BQM A;  3MM9 A;  1QSY A;  5IT0 A;  3SQG A;  5D4L A;  1WC1 A;  1HQ2 A;  1FD2 A;  1RAD B;  4ZJQ A;  1T05 B;  4OX6 A;  3T1Y J;  2NUH A;  4BHQ A;  1CLF A;  1HNX F;  4FN5 A;  1VMB A;  1QAY A;  3M2U A;  1FKO B;  4IDK B;  2AIR B;  3OFG A;  4ELT A;  1VGY A;  4OI3 A;  2VG7 B;  3RW7 A;  2MGZ A;  2AF6 A;  3L7P A;  3G71 S;  3G87 A;  2KZM A;  1O6X A;  1MU2 B;  4EI2 A;  2K7J A;  3VGV A;  1SUQ B;  1VJQ A;  4L74 A;  1MW7 A;  2P5V A;  4R0J A;  1M5O C;  2XSJ B;  4CTA B;  3HPO A;  3Q8V A;  2VQF J;  3PJW A;  1SC3 B;  4JI1 F;  1PC4 A;  3BGF A;  2YWK A;  2E1A A;  2DNR A;  1VBK A;  3TUI C;  1LQ9 A;  2UUC J;  1RBA A;  2XG8 A;  4J5O A;  3J80 U;  3UO0 A;  1YBT A;  3TVZ A;  3DOM A;  2ZZM A;  4F4X A;  4OL8 A;  3BPS P;  1BQN B;  4L3N A;  2NXJ A;  2OLW A;  1VRU A;  2BV3 A;  2ZHA A;  4RNH A;  5SZT A;  2DGO A;  2FGC A;  1SH3 A;  4ZP6 A;  3GV8 B;  2E5L J;  1NZ8 A;  2VQE J;  1RA7 A;  1IKV B;  3NWG A;  3GPA A;  4MKA A;  3UCZ P;  1VRQ C;  1REV B;  4DDF A;  1N54 B;  2WOM A;  2NZC A;  4B9L A;  2GS8 A;  2OJ3 A;  3TJ9 A;  1UET A;  5F8G A;  1EZZ B;  1LKZ A;  3PRV A;  1HA1 A;  2KHD A;  1S1W B;  3BO2 A;  4H54 A;  2SXL A;  3AB2 B;  2EKN A;  4LUB A;  3IRW P;  3NCQ A;  2W01 A;  5GMK a;  1UJ5 A;  1B0P A;  2X1A A;  1UPP A;  2XCP A;  1VQM S;  3BSA A;  3TJA A;  5K8O A;  3PYF A;  1IBM J;  3X1L B;  3M32 B;  4I69 A;  2DXF A;  4Y2M A;  3VAM A;  3PCO B;  3H5U A;  5KT3 A;  3D67 A;  2YKA A;  4ZVT B;  2XLI A;  3QGI A;  3UCG A;  1YTY A;  2O3D A;  2MST A;  5FLX Y;  4M5K A;  1NK9 A;  3NGD A;  1HNW J;  3QRP A;  3DLK A;  4KHM A;  2XO6 A;  2HSE B;  1YRX A;  2V34 A;  4AQY F;  3DFE A;  3FUY A;  3Q8Y A;  2BJE A;  4G1Q B;  1NK5 A;  4PWW A;  3SSQ A;  3SCI E;  2W7P A;  4LF6 J;  2VKZ G;  3RW6 A;  4HR2 A;  1SXL A;  3TZY A;  3R5G A;  1Y11 A;  2XLK A;  2HAI A;  2F3J A;  1QLN A;  4NA1 A;  4AFF A;  3CCM S;  2IFX A;  2VPX B;  1T7P A;  1D8Z A;  2HFN A;  2IJF A;  4Y2C A;  4ETX A;  1M1K T;  3MEK A;  3CIM A;  1QJH A;  4QR1 A;  1FXL A;  3TA1 A;  2YX7 A;  1LW2 A;  1MN9 A;  1RWM B;  4K4T A;  1T9W A;  2HMI B;  2AGQ A;  1OSD A;  4ID5 B;  4NL5 A;  2VOO A;  2BUN A;  2YNH A;  1FRI A;  1FK9 A;  3BSC A;  3HI9 A;  2DHA A;  3FEY B;  2ZBC A;  2B43 A;  2BR0 A;  5DQI A;  2B7B B;  4NYZ A;  4PQU B;  2OEK A;  2AKW B;  2PEB A;  1VQP S;  3FGV A;  1KN6 A;  1F9H A;  4WTY A;  4ECW A;  5EWG A;  3W9I A;  1IM4 A;  1YK9 A;  4MK9 A;  1FFS B;  3OQ2 A;  1U24 A;  2JWN A;  3CDU A;  3FCH A;  2MKH A;  4PWD A;  3QRQ A;  3PJ9 A;  5C25 B;  1VDH A;  1XR6 A;  2AD9 A;  4P2M A;  1U47 A;  1X5S A;  3ILJ A;  3D5M A;  2HVE A;  2KG1 A;  1U2C A;  2XHC A;  2OEL A;  4NEY A;  4ZCK A;  4DUY F;  4ZVP B;  1ZTT A;  2LQ5 A;  2IAJ B;  2HS3 A;  1FRK A;  1JKH A;  4Q2L A;  4JI6 J;  3ENQ A;  2EPI A;  3K7R A;  1S48 A;  4M5M A;  2FJX A;  3K89 A;  4MH8 A;  5G4D A;  4WTO B;  2EFV A;  3KJN B;  4H4O B;  5D0E A;  1U26 A;  2V8P A;  3H4D A;  2IM2 A;  2YKM B;  1T9Y A;  2PN6 A;  1RK8 A;  3Q8U A;  5LXR A;  4OZ3 A;  1URR A;  3PHE A;  4JYA F;  3M9M B;  4AL5 A;  2XMW A;  3K8W A;  2DIS A;  5E33 A;  5K8N A;  2I0X A;  5J2P A;  5M2R A;  4OZN A;  2PFD A;  5F9L A;  1S12 A;  5IQQ A;  4QYZ J;  4C2M A;  5EWE A;  1F0X A;  4Y3C A;  2IRY A;  2VUG A;  3VZI A;  4QU6 A;  1C0U B;  1IVZ A;  1KBR A;  5JUM A;  3UD3 P;  3IFE A;  1JXL A;  4X65 J;  2DNH A;  1JLG A;  4QJV A;  2BAN A;  2ILY A;  4Y2A A;  2B9W A;  2YNG A;  4F7V A;  4Y28 C;  1EET B;  2BJ7 A;  4KFB B;  4Q0B B;  3SSS A;  1B70 B;  2HHH J;  2B4U A;  3MMA B;  1UAW A;  1M5S A;  1ROF A;  3MHY A;  1RYR A;  1BLU A;  3BYR A;  1CG2 A;  3CVK A;  3PRD A;  3NL0 A;  3PR5 B;  1S10 A;  4OX9 F;  1JLA A;  3T5H A;  4UZB A;  1KQS R;  3ZZR A;  2V2K A;  3KLV A;  4CLU A;  2EC2 A;  2HW3 A;  4FF2 A;  1FWK A;  1WHY A;  1N5V A;  3WBZ A;  2GGP A;  5KT5 A;  5C24 B;  3OUY A;  3ZZU A;  2UV8 A;  2B4P A;  1IBC B;  3JSM A;  1WF1 A;  2CQ4 A;  1EIY B;  2CPD A;  4Y00 A;  3TZX A;  1FVS A;  4FDF A;  2GVD A;  1ZET A;  3NMA A;  1XNR F;  3D9B A;  1HWI A;  3RAQ A;  1LW0 A;  1Q5V A;  1M1G A;  2V94 A;  4P2S A;  2CQB A;  3W2W B;  2F4V F;  3ETM A;  1LWF A;  1F9E B;  1IN0 A;  1HNI B;  3HK2 A;  1SKU B;  4USU A;  3FFI B;  1T9U A;  3MEG A;  2HQ3 A;  1Q1K A;  3V4M A;  2NXN A;  2FJD B;  3C2P A;  5DLF A;  5DQH A;  2AEM A;  3DN9 A;  2AQ4 A;  3UDC A;  2PMW A;  1T3N A;  2A18 A;  1NB7 A;  4ZPT R;  3MXH P;  3F41 A;  1RT7 B;  4ZHR A;  3DLJ A;  3HF5 A;  4A46 A;  3HHL B;  1P9Q C;  3EZ5 A;  3BO4 A;  1Q95 G;  2XCA A;  2WW8 A;  1XMQ F;  3DI6 A;  1Y4Z B;  3QQC D;  2DEI A;  2CA9 A;  1N36 J;  3HSD A;  2DR7 A;  1WOP A;  1J5E F;  4XIU A;  3GFH A;  2IM3 A;  2Y1I A;  2CQ1 A;  1VHF A;  4K5R A;  4RX6 A;  3CIZ A;  4DV7 F;  3EPI A;  2V2Q A;  2C42 A;  4DFM A;  2MHN A;  2HYI B;  1YI2 S;  2E9R X;  3NGR A;  5KG5 A;  2GAG C;  2LQ8 A;  1GMW A;  4ZVF A;  4DR3 J;  5L9N A;  2V2Z A;  1FCA A;  2GVZ A;  4JI0 F;  3S01 A;  2I1R A;  1U1Q A;  2UUA J;  1N88 A;  2F9D A;  5EWF A;  3PVX A;  1NZA A;  3PEH A;  1TL1 B;  1CC8 A;  3WZ0 A;  1V3Z A;  2ZOM A;  3D1O A;  1NKE A;  3T5L A;  4QIW D;  4CWB A;  4KBI A;  3FZ2 A;  2BKP A;  3O6Q A;  3GQC A;  1VC0 A;  4YHH J;  2KM8 B;  4FPR A;  1N34 J;  5A2Q Y;  2YNI A;  3KHR A;  1H38 A;  1T03 B;  2B0G A;  2GIR A;  4GVB A;  2FY8 A;  1HWU A;  3GMG A;  3RRH A;  4ED5 A;  1WOO A;  1KLM B;  2J7U A;  4DQI A;  4M95 A;  4H4K C;  2BJD A;  3KLH A;  3NBP A;  4OI1 A;  3AAW B;  2ZE2 A;  3SSR A;  3EGZ A;  2ROG A;  3W8G A;  1QSS A;  1UKU A;  3OHA A;  1M5P C;  1LXN A;  2E7V A;  2CG8 A;  3UCU P;  2FLO A;  2JH3 A;  2LQJ A;  4U96 A;  3UI3 A;  1N5S A;  1HBN B;  3UW1 A;  4OV6 A;  4DPO A;  4NEZ A;  1U1K A;  1T05 A;  1HNZ J;  2FY1 A;  3P6Y C;  4Z7C A;  1YBA A;  1S1X B;  5KT7 A;  1XNQ J;  3O1L A;  4K8R A;  4DU7 A;  1FKO A;  3PAC A;  4IDK A;  2FGO A;  2OPQ B;  1HWL A;  2VG7 A;  4FYW B;  3BDP A;  4RU2 A;  1NK6 A;  1HQU B;  3V81 B;  1UJ6 A;  5DGA A;  4JI3 J;  1RAF B;  1QTM A;  4WJB A;  1WI6 A;  2J9E A;  5DM6 Q;  1HNV B;  1SUQ A;  3JB9 k;  3UNG C;  2AZ1 A;  2JLE A;  2XSJ A;  3OL7 A;  2RQ4 A;  3JYT B;  3CDA A;  4PPZ A;  4LQ3 A;  4KGM A;  2CZ9 A;  3HT3 A;  4R8U B;  1F5C A;  2W2Q P;  3SYZ A;  2IYG A;  2YVS A;  3TUZ C;  1VQ7 S;  5LMU J;  3CJ8 A;  1S1T B;  5J1P A;  4OYI A;  1Q8I A;  3AXK A;  3MCN A;  4CNZ A;  2FPH X;  4QWE A;  1I6J A;  3EDR B;  1LXJ A;  4YFU A;  1SV5 B;  4Q44 A;  3UDV A;  3DKD A;  2HGN A;  2G0C A;  2DGV A;  2ASJ A;  2YKQ A;  5B0B A;  1VQS A;  3A4T A;  1Q5Y A;  3K5L A;  4NRU A;  3DGP B;  3GIM A;  2BBE A;  3QGH A;  4QBU A;  2PI4 A;  2OKQ A;  2I8E A;  4ED2 A;  1U4B A;  3IG1 A;  4WFA Q;  2AZ3 A;  3TAM B;  3CED A;  2CPJ A;  2LXU A;  4YB5 A;  3AJD A;  2RQK A;  3AHP A;  1HIY A;  1H73 A;  1IUJ A;  3WIU A;  3RUB L;  3GIK A;  1PYS B;  1P8G A;  2XMK A;  1REV A;  4L72 B;  5LSO A;  5F41 A;  2CZV C;  3P49 B;  4LF7 F;  4FPI A;  4OFZ A;  1VJW A;  2QL5 B;  1SB6 A;  4FS2 A;  1S5Z A;  1VR6 A;  4K4X A;  4O44 A;  3HFZ B;  1UWA A;  2OSR A;  4GVL A;  2XYH B;  2FZC B;  4LSN B;  2MJU A;  2IVF B;  1S1W A;  3CNQ P;  1FI4 A;  2MQL A;  3KOA A;  3Q2S C;  5BXI A;  2DGU A;  1YIT S;  3D4J A;  4DR5 F;  1S6P B;  4X62 J;  3DOK B;  2LKZ A;  1HW8 A;  1S6Q B;  3GON A;  4NI2 B;  3H2V E;  1QVF R;  2EFG A;  4OYP A;  3RBZ A;  3M32 A;  1NUE A;  2MY8 A;  2N7C A;  3BS9 A;  2R2T A;  4DL4 A;  2P6T A;  4YB6 A;  3BZQ A;  1SKR A;  3J81 U;  2UU9 F;  4A8K A;  4TY8 B;  2CQP A;  4EBD A;  4K59 A;  1HAR A;  1Y7P A;  5HJX A;  3ZFV A;  3MWB A;  3CO0 P;  2JEJ A;  1CJT B;  4Q45 A;  4O3O A;  2Y0S D;  1O0P A;  4G1Q A;  1R0C B;  4I2Q B;  5IWA J;  2JC0 A;  1T9T A;  1QDU B;  2RJZ A;  1N5Y B;  3W5Y A;  1VBX A;  3NNC A;  4EYI B;  3KDN A;  1CJK A;  2AEJ A;  3PW0 A;  2WB4 A;  2YPY A;  1WEX A;  1UA0 A;  3B54 A;  4KJI A;  4DR1 F;  2B56 A;  2OHD A;  1NHK L;  2R2S A;  4JBC A;  1PBU A;  3D54 A;  5I42 B;  1FE4 A;  3THT A;  1HPZ A;  2HMI A;  1D3W A;  3HKW A;  1UVI A;  4RUA A;  4ID5 A;  2YX1 A;  4J9M A;  4JI2 F;  2KRB A;  1B7Y B;  4TYA A;  1PIL A;  2XMV A;  2YXL A;  3OVA A;  2QLJ B;  2DNP A;  3PYG A;  2D69 A; 
#chains in the Genus database with same CATH homology
 4ESN A;  1NPP A;  3LPE A;  2OUG A;  3H7H B;  1NZ8 A;  2LQ8 A;  1M1G A;  3LD7 A;  2XHC A;  3QQC D;  4ZN3 A;  3P8B B;  1NPR A;  1M1H A;  2K06 A;  4ZN1 A;  4OBI A;  2EXU A;  3EWG A;  2KPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...