4IG6A

Crystal structure of a trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum bound to s-adenosylhomocysteine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
Knots found
sequence length
223
structure length
223
Chain Sequence
SMIFNVLTIFPQMFPGPLGVSNLGSALKKGLWTLNVFDIRAFANNKHNTVDDTPYGGGPGMLLRADVLGRCIDEVLSLHPNTKLMFTSPRGVSFTQDIARQTMNFDNITLLCGRFEGIDERVVDFYKLQEVSIGDYVLSGGELAAMVIIDTCVRMVPGVIGNAESLKQESMEGSLEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASLSITAARRPDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of a tRNA (guanine-N1)-methyltransferase from Anaplasma phagocytophilum bound to S-adenosylhomocysteine
rcsb
source organism Anaplasma phagocytophilum
total genus 66
structure length 223
sequence length 223
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2012-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4ig6A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4ig6A01
1ZJRA 2V3KA 4MCBA 2HA8A 4J3CA 4YQTA 3N4JA 1K3RA 3OIJA 4H3ZA 4YQRA 1O6DA 5CO4A 3O7BA 4YPXA 4YQKA 2EGVA 4CNEA 4YPZA 3BBDA 3GYQA 4YQPA 4PZKA 4YPWA 4YQ6A 4YQ4A 1TO0A 3BBHA 4YVGA 4YQ1A 4JALA 4YQCA 1UAKA 1UAMA 1GZ0A 4CNDA 4YQAA 3KNUA 4YQ3A 3E5YA 1NXZA 3L8UA 4L69A 4H3YA 2Z0YA 5GM8A 1UAJA 4YQ9A 3OINA 3KY7A 3NK6A 3ILKA 4JAKA 1V2XA 1X7PA 4YQ5A 1P9PA 1MXIA 2EGWA 3IEFA 4X3LA 4YQGA 4YPYA 4YQ0A 1IPAA 4YQ2A 4YQBA 2O3AA 3ONPA 2QMMA 5FAIA 2I6DA 1NS5A 4YQOA 3IC6A 1Z85A 4YQQA 3OIIA 2V3JA 4YVIA 4CNFA 4FAKA 4MCDA 5D9FA 1VHKA 4RG1A 3NK7A 4YQNA 4YQDA 1OY5A 4KGNA 4KDZA 1V6ZA 4XBOA 3QUVA 1UALA 4YQ8A 3KTYA 4YVJA 4YVKA 2YY8A 3N4KA 5GMBA 4MCCA 4CNGA 4YQ7A 4YQSA 4YQLA 2QWVA 4YQIA 3DCMX 3AIAA 4YVHA 4E8BA 3AI9X 2CX8A 1J85A 4X3MA 3KW2A 4IG6A 4YQJA 3BBEA 1VH0A 1X7OA 5GMCA 1VHYA 3AXZA
chains in the Genus database with same CATH superfamily
1ZJRA 1JHGA 3SSXN 2V3KA 4MCBA 2HA8A 4J3CA 4YQTA 3N4JA 1CO0A 1K3RA 3OIJA 4H3ZA 4FMWA 4YQRA 1O6DA 5CO4A 3O7BA 4YPXA 4YQKA 2EGVA 4CNEA 4YPZA 3G1CA 3BBDA 3GYQA 4YQPA 4PZKA 4YPWA 4YQ6A 3WRPA 4YQ4A 1TRRA 4YVGA 4YQ1A 1TO0A 3BBHA 4JALA 4YQCA 1UAKA 1UAMA 1GZ0A 1RCSA 4CNDA 4YQAA 3KNUA 4YQ3A 3E5YA 1NXZA 4JWHA 3L8UA 1ZT9A 4L69A 1WRSR 2OZ9R 4H3YA 2Z0YA 5GM8A 1UAJA 4YQ9A 3OINA 1WRPR 3SSWN 3KY7A 3NK6A 3ILKA 4JWJA 4JAKA 4JWGA 1V2XA 1X7PA 4YQ5A 1P9PA 1MXIA 2EGWA 3IEFA 4X3LA 4YQGA 2XDIA 4YPYA 4YQ0A 4YQ2A 4YQBA 1IPAA 2O3AA 3ONPA 1WRTR 2QMMA 5FAIA 2I6DA 1NS5A 4YQOA 1TROA 4JWFA 3IC6A 1Z85A 4YQQA 1MI7R 3OIIA 2V3JA 4YVIA 4CNFA 4FAKA 4MCDA 5D9FA 1VHKA 4RG1A 3NK7A 4YQNA 4YQDA 1OY5A 4KGNA 4KDZA 1V6ZA 4XBOA 3QUVA 1UALA 4YQ8A 3KTYA 4YVJA 4YVKA 2YY8A 3N4KA 5GMBA 4MCCA 4CNGA 4YQ7A 3FRWA 4YQSA 4YQLA 2QWVA 4YQIA 3DCMX 3AIAA 4YVHA 4E8BA 3AI9X 2CX8A 1J85A 4X3MA 3KW2A 4IG6A 4YQJA 3BBEA 1VH0A 1X7OA 3KORA 5GMCA 1VHYA 3AXZA
chains in the Genus database with same CATH topology
1ZJRA 2V3KA 4MCBA 2HA8A 4J3CA 4YQTA 3N4JA 1K3RA 3OIJA 4H3ZA 4FMWA 4YQRA 1O6DA 5CO4A 3O7BA 4YPXA 4YQKA 2EGVA 4CNEA 4YPZA 3BBDA 3GYQA 4YQPA 4PZKA 4YPWA 4YQ6A 4YQ4A 1TO0A 3BBHA 4YVGA 4YQ1A 4JALA 4YQCA 1UAKA 1UAMA 1GZ0A 4CNDA 4YQAA 3KNUA 4YQ3A 3E5YA 1NXZA 4JWHA 3L8UA 4L69A 4H3YA 2Z0YA 5GM8A 1UAJA 4YQ9A 3OINA 3KY7A 3NK6A 3ILKA 4JWJA 4JAKA 4JWGA 1V2XA 1X7PA 4YQ5A 1P9PA 1MXIA 2EGWA 3IEFA 4X3LA 4YQGA 4YPYA 4YQ0A 1IPAA 4YQ2A 4YQBA 2O3AA 3ONPA 2QMMA 5FAIA 2I6DA 1NS5A 4YQOA 4JWFA 3IC6A 1Z85A 4YQQA 3OIIA 2V3JA 4YVIA 4CNFA 4FAKA 4MCDA 5D9FA 1VHKA 4RG1A 3NK7A 4YQNA 4YQDA 1OY5A 4KGNA 4KDZA 1V6ZA 4XBOA 3QUVA 1UALA 4YQ8A 3KTYA 4YVJA 4YVKA 2YY8A 3N4KA 5GMBA 4MCCA 4CNGA 4YQ7A 4YQSA 4YQLA 2QWVA 4YQIA 3DCMX 3AIAA 4YVHA 4E8BA 3AI9X 2CX8A 1J85A 4X3MA 3KW2A 4IG6A 4YQJA 3BBEA 1VH0A 1X7OA 5GMCA 1VHYA 3AXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJR A;  2V3K A;  4MCB A;  2HA8 A;  4J3C A;  4YQT A;  3N4J A;  1K3R A;  3OIJ A;  4H3Z A;  4YQR A;  1O6D A;  5CO4 A;  3O7B A;  4YPX A;  4YQK A;  2EGV A;  4CNE A;  4YPZ A;  3BBD A;  3GYQ A;  4YQP A;  4PZK A;  4YPW A;  4YQ6 A;  4YQ4 A;  1TO0 A;  3BBH A;  4YVG A;  4YQ1 A;  4JAL A;  4YQC A;  1UAK A;  1UAM A;  1GZ0 A;  4CND A;  4YQA A;  3KNU A;  4YQ3 A;  3E5Y A;  1NXZ A;  3L8U A;  4L69 A;  4H3Y A;  2Z0Y A;  5GM8 A;  1UAJ A;  4YQ9 A;  3OIN A;  3KY7 A;  3NK6 A;  3ILK A;  4JAK A;  1V2X A;  1X7P A;  4YQ5 A;  1P9P A;  1MXI A;  2EGW A;  3IEF A;  4X3L A;  4YQG A;  4YPY A;  4YQ0 A;  1IPA A;  4YQ2 A;  4YQB A;  2O3A A;  3ONP A;  2QMM A;  5FAI A;  2I6D A;  1NS5 A;  4YQO A;  3IC6 A;  1Z85 A;  4YQQ A;  3OII A;  2V3J A;  4YVI A;  4CNF A;  4FAK A;  4MCD A;  5D9F A;  1VHK A;  4RG1 A;  3NK7 A;  4YQN A;  4YQD A;  1OY5 A;  4KGN A;  4KDZ A;  1V6Z A;  4XBO A;  3QUV A;  1UAL A;  4YQ8 A;  3KTY A;  4YVJ A;  4YVK A;  2YY8 A;  3N4K A;  5GMB A;  4MCC A;  4CNG A;  4YQ7 A;  4YQS A;  4YQL A;  2QWV A;  4YQI A;  3DCM X;  3AIA A;  4YVH A;  4E8B A;  3AI9 X;  2CX8 A;  1J85 A;  4X3M A;  3KW2 A;  4IG6 A;  4YQJ A;  3BBE A;  1VH0 A;  1X7O A;  5GMC A;  1VHY A;  3AXZ A; 
#chains in the Genus database with same CATH topology
 1ZJR A;  1JHG A;  3SSX N;  2V3K A;  4MCB A;  2HA8 A;  4J3C A;  4YQT A;  3N4J A;  1CO0 A;  1K3R A;  3OIJ A;  4H3Z A;  4FMW A;  4YQR A;  1O6D A;  5CO4 A;  3O7B A;  4YPX A;  4YQK A;  2EGV A;  4CNE A;  4YPZ A;  3G1C A;  3BBD A;  3GYQ A;  4YQP A;  4PZK A;  4YPW A;  4YQ6 A;  3WRP A;  4YQ4 A;  1TRR A;  4YVG A;  4YQ1 A;  1TO0 A;  3BBH A;  4JAL A;  4YQC A;  1UAK A;  1UAM A;  1GZ0 A;  1RCS A;  4CND A;  4YQA A;  3KNU A;  4YQ3 A;  3E5Y A;  1NXZ A;  4JWH A;  3L8U A;  1ZT9 A;  4L69 A;  1WRS R;  2OZ9 R;  4H3Y A;  2Z0Y A;  5GM8 A;  1UAJ A;  4YQ9 A;  3OIN A;  1WRP R;  3SSW N;  3KY7 A;  3NK6 A;  3ILK A;  4JWJ A;  4JAK A;  4JWG A;  1V2X A;  1X7P A;  4YQ5 A;  1P9P A;  1MXI A;  2EGW A;  3IEF A;  4X3L A;  4YQG A;  2XDI A;  4YPY A;  4YQ0 A;  4YQ2 A;  4YQB A;  1IPA A;  2O3A A;  3ONP A;  1WRT R;  2QMM A;  5FAI A;  2I6D A;  1NS5 A;  4YQO A;  1TRO A;  4JWF A;  3IC6 A;  1Z85 A;  4YQQ A;  1MI7 R;  3OII A;  2V3J A;  4YVI A;  4CNF A;  4FAK A;  4MCD A;  5D9F A;  1VHK A;  4RG1 A;  3NK7 A;  4YQN A;  4YQD A;  1OY5 A;  4KGN A;  4KDZ A;  1V6Z A;  4XBO A;  3QUV A;  1UAL A;  4YQ8 A;  3KTY A;  4YVJ A;  4YVK A;  2YY8 A;  3N4K A;  5GMB A;  4MCC A;  4CNG A;  4YQ7 A;  3FRW A;  4YQS A;  4YQL A;  2QWV A;  4YQI A;  3DCM X;  3AIA A;  4YVH A;  4E8B A;  3AI9 X;  2CX8 A;  1J85 A;  4X3M A;  3KW2 A;  4IG6 A;  4YQJ A;  3BBE A;  1VH0 A;  1X7O A;  3KOR A;  5GMC A;  1VHY A;  3AXZ A; 
#chains in the Genus database with same CATH homology
 1ZJR A;  2V3K A;  4MCB A;  2HA8 A;  4J3C A;  4YQT A;  3N4J A;  1K3R A;  3OIJ A;  4H3Z A;  4FMW A;  4YQR A;  1O6D A;  5CO4 A;  3O7B A;  4YPX A;  4YQK A;  2EGV A;  4CNE A;  4YPZ A;  3BBD A;  3GYQ A;  4YQP A;  4PZK A;  4YPW A;  4YQ6 A;  4YQ4 A;  1TO0 A;  3BBH A;  4YVG A;  4YQ1 A;  4JAL A;  4YQC A;  1UAK A;  1UAM A;  1GZ0 A;  4CND A;  4YQA A;  3KNU A;  4YQ3 A;  3E5Y A;  1NXZ A;  4JWH A;  3L8U A;  4L69 A;  4H3Y A;  2Z0Y A;  5GM8 A;  1UAJ A;  4YQ9 A;  3OIN A;  3KY7 A;  3NK6 A;  3ILK A;  4JWJ A;  4JAK A;  4JWG A;  1V2X A;  1X7P A;  4YQ5 A;  1P9P A;  1MXI A;  2EGW A;  3IEF A;  4X3L A;  4YQG A;  4YPY A;  4YQ0 A;  1IPA A;  4YQ2 A;  4YQB A;  2O3A A;  3ONP A;  2QMM A;  5FAI A;  2I6D A;  1NS5 A;  4YQO A;  4JWF A;  3IC6 A;  1Z85 A;  4YQQ A;  3OII A;  2V3J A;  4YVI A;  4CNF A;  4FAK A;  4MCD A;  5D9F A;  1VHK A;  4RG1 A;  3NK7 A;  4YQN A;  4YQD A;  1OY5 A;  4KGN A;  4KDZ A;  1V6Z A;  4XBO A;  3QUV A;  1UAL A;  4YQ8 A;  3KTY A;  4YVJ A;  4YVK A;  2YY8 A;  3N4K A;  5GMB A;  4MCC A;  4CNG A;  4YQ7 A;  4YQS A;  4YQL A;  2QWV A;  4YQI A;  3DCM X;  3AIA A;  4YVH A;  4E8B A;  3AI9 X;  2CX8 A;  1J85 A;  4X3M A;  3KW2 A;  4IG6 A;  4YQJ A;  3BBE A;  1VH0 A;  1X7O A;  5GMC A;  1VHY A;  3AXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...