1HQHA

Crystal structure of the binuclear manganese metalloenzyme arginase complexed with nor-n-hydroxy-l-arginine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
b'KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE 1
publication title Mechanistic and metabolic inferences from the binding of substrate analogues and products to arginase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 106
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2000-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1hqhA00
4IU1A 1PQ3A 4Q3PA 4IE2A 4RHJA 4FCIA 4GSMA 2EIVA 4DZ4A 1TBHA 1GQ6A 4MYNA 2EF4A 3MJLA 4HZEA 5HJ9A 2A0MA 4Q3RA 3THJA 4IU4A 3MMRA 3SL0A 1WVAA 4MYLA 1CEVA 2ZAVA 3NIOA 3E8ZA 3MFVA 1WVBA 3SL1A 1HQHA 4HXQA 3E9BA 4Q3VA 2PLLA 1XFKA 4Q42A 4HWWA 3TH7A 1T4SA 4CEVA 1GQ7A 1P8RA 3F80A 3NIQA 4MYKA 1WOHA 1P8QA 1HQ5A 1T4TA 3LP4A 4GSZA 4GWCA 1HQGA 1WOGA 4IXVA 3E8QA 3CEVA 4G3HA 1T4RA 4GWDA 3THHA 1D3VA 2EF5A 4RHIA 4Q3QA 1WOIA 2AEBA 2PHOA 4RHQA 5CEVA 1P8PA 3SJTA 1RLAA 2RLAA 4FCKA 1T5GA 3KV2A 3M1RA 4Q3RC 4Q3TA 4RLAA 1T4PA 1ZPEA 3GN0A 3SKKA 4MYFA 4Q40A 4IE1A 1ZPGA 1T5FA 5HJAA 5RLAA 1P8OA 4Q41A 4RHLA 3E6KA 2CEVA 3PZLA 1TA1A 3MFWA 4Q3SA 3NIPA 3DJ8A 4I06A 4IU5A 3TF3A 4RHMA 1R1OA 3GMZA 1P8NA 4ITYA 4GSVA 1P8MA 4IXUA 3LP7A 3E6VA 1HQXA 1HQFA 2PHAA 3THEA 3RLAA 4RHKA 1TBJA 4MXRA 4IU0A 4Q3UA 3LHLA 4IE3A 1P8SA 1TBLA
chains in the Genus database with same CATH superfamily
4IU1A 1PQ3A 4Q3PA 5EFHA 4IE2A 3MZ6A 5DC8A 3SFHA 3MZ7A 4RHJA 4BZ8A 4ZURA 4QA7A 5BWZA 4FCIA 3C0ZA 4GSMA 2EIVA 4DZ4A 1TBHA 1GQ6A 1T64A 4MYNA 5G1CA 4ZUNA 2EF4A 3MJLA 4HZEA 5HJ9A 2A0MA 5D1BA 4Q3RA 2VQVA 5FCWA 1C3RA 5EENA 3RQDA 3F0RA 3MAXA 2V5XA 3THJA 4IU4A 3MMRA 3SL0A 1WVAA 3Q9FA 4MYLA 5G0IA 1CEVA 2ZAVA 2VQWG 3NIOA 3E8ZA 4BKXB 3MFVA 1WVBA 3SL1A 1HQHA 4HXQA 3E9BA 4Q3VA 2PLLA 5EEIA 1XFKA 4Q42A 4ZUMA 3F06A 4HWWA 3TH7A 4BZ7A 5IWGA 1T4SA 1ZZ0A 4CEVA 5G0GA 1GQ7A 5IX0A 3MZ3A 1P8RA 3F80A 4A69A 3NIQA 5DC5A 4MYKA 5G0XA 1WOHA 1P8QA 5THTA 3EW8A 1HQ5A 5FUEA 5EF8A 1T4TA 5G12A 5D1CA 3LP4A 3F07A 4GSZA 1P8SA 4GWCA 5G1BA 5THVA 1HQGA 1T69A 4QA5A 4RN0A 1WOGA 3Q9CA 5D1DA 4IXVA 3E8QA 3CEVA 3Q9BA 4G3HA 1T4RA 2V5WA 5G0HA 5G3WA 3Q9EA 4GWDA 3THHA 5JI5A 1D3VA 3SFFA 3EWFA 2EF5A 4QA1A 4Q3QA 4RHIA 3ZNSA 4QA6A 5LI3A 1WOIA 2AEBA 5DC7A 2PHOA 5ICNB 4RHQA 5G0JA 4CQFA 4ZUOA 5CEVA 1C3PA 1P8PA 3SJTA 1RLAA 3C10A 4QA4A 5G1AA 5EFJD 2RLAA 5G17A 4FCKA 5EFKB 4RN1A 5THSA 1T5GA 3KV2A 1T67A 3M1RA 5G11A 4Q3RC 5EEMA 4Q3TA 2VQMA 4RLAA 1T4PA 1ZPEA 4BZ9A 1ZZ1A 4CBTA 3GN0A 3SKKA 4MYFA 4QA3A 4Q40A 4IE1A 1C3SA 1ZPGA 1T5FA 4LXZA 4ZUQA 5HJAA 3ZNRA 4RN2A 1P8OA 5RLAA 3C0YA 4RHLA 4Q41A 3E6KA 2CEVA 4BZ5A 3PZLA 4QA2A 5G10A 1TA1A 4CBYA 3MFWA 3EZTA 2VCGA 1ZZ3A 4Q3SA 5EFNA 3NIPA 5THUA 3DJ8A 4I06A 4IU5A 5DC6A 3TF3A 4RHMA 3MZ4A 5EFGA 4ZUPA 1R1OA 3GMZA 1VKGA 5EFBD 4LY1A 1P8NA 2GH6A 5EEKA 3EZPA 4ITYA 4GSVA 4QA0A 1P8MA 4IXUA 5A2SA 3LP7A 3MENA 1W22A 2VQOA 3E6VA 1HQXA 1HQFA 5G13A 2PHAA 3THEA 3RLAA 4BZ6A 5EEFA 4RHKA 1TBJA 4MXRA 4IU0A 4Q3UA 5EF7A 3LHLA 4IE3A 2VQJA 5G0YA 2VQQA 1TBLA
chains in the Genus database with same CATH topology
4IU1A 1PQ3A 4Q3PA 4IE2A 4RHJA 4FCIA 4GSMA 2EIVA 4DZ4A 1TBHA 1GQ6A 4MYNA 2EF4A 3MJLA 4HZEA 5HJ9A 2A0MA 4Q3RA 3THJA 4IU4A 3MMRA 3SL0A 1WVAA 4MYLA 1CEVA 2ZAVA 3NIOA 3E8ZA 3MFVA 1WVBA 3SL1A 1HQHA 4HXQA 3E9BA 4Q3VA 2PLLA 1XFKA 4Q42A 4HWWA 3TH7A 1T4SA 4CEVA 1GQ7A 1P8RA 3F80A 3NIQA 4MYKA 1WOHA 1P8QA 1HQ5A 1T4TA 3LP4A 4GSZA 4GWCA 1HQGA 1WOGA 4IXVA 3E8QA 3CEVA 4G3HA 1T4RA 4GWDA 3THHA 1D3VA 2EF5A 4RHIA 4Q3QA 1WOIA 2AEBA 2PHOA 4RHQA 5CEVA 1P8PA 3SJTA 1RLAA 2RLAA 4FCKA 1T5GA 3KV2A 3M1RA 4Q3RC 4Q3TA 4RLAA 1T4PA 1ZPEA 3GN0A 3SKKA 4MYFA 4Q40A 4IE1A 1ZPGA 1T5FA 5HJAA 5RLAA 1P8OA 4Q41A 4RHLA 3E6KA 2CEVA 3PZLA 1TA1A 3MFWA 4Q3SA 3NIPA 3DJ8A 4I06A 4IU5A 3TF3A 4RHMA 1R1OA 3GMZA 1P8NA 4ITYA 4GSVA 1P8MA 4IXUA 3LP7A 3E6VA 1HQXA 1HQFA 2PHAA 3THEA 3RLAA 4RHKA 1TBJA 4MXRA 4IU0A 4Q3UA 3LHLA 4IE3A 1P8SA 1TBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU1 A;  1PQ3 A;  4Q3P A;  4IE2 A;  4RHJ A;  4FCI A;  4GSM A;  2EIV A;  4DZ4 A;  1TBH A;  1GQ6 A;  4MYN A;  2EF4 A;  3MJL A;  4HZE A;  5HJ9 A;  2A0M A;  4Q3R A;  3THJ A;  4IU4 A;  3MMR A;  3SL0 A;  1WVA A;  4MYL A;  1CEV A;  2ZAV A;  3NIO A;  3E8Z A;  3MFV A;  1WVB A;  3SL1 A;  1HQH A;  4HXQ A;  3E9B A;  4Q3V A;  2PLL A;  1XFK A;  4Q42 A;  4HWW A;  3TH7 A;  1T4S A;  4CEV A;  1GQ7 A;  1P8R A;  3F80 A;  3NIQ A;  4MYK A;  1WOH A;  1P8Q A;  1HQ5 A;  1T4T A;  3LP4 A;  4GSZ A;  4GWC A;  1HQG A;  1WOG A;  4IXV A;  3E8Q A;  3CEV A;  4G3H A;  1T4R A;  4GWD A;  3THH A;  1D3V A;  2EF5 A;  4RHI A;  4Q3Q A;  1WOI A;  2AEB A;  2PHO A;  4RHQ A;  5CEV A;  1P8P A;  3SJT A;  1RLA A;  2RLA A;  4FCK A;  1T5G A;  3KV2 A;  3M1R A;  4Q3R C;  4Q3T A;  4RLA A;  1T4P A;  1ZPE A;  3GN0 A;  3SKK A;  4MYF A;  4Q40 A;  4IE1 A;  1ZPG A;  1T5F A;  5HJA A;  5RLA A;  1P8O A;  4Q41 A;  4RHL A;  3E6K A;  2CEV A;  3PZL A;  1TA1 A;  3MFW A;  4Q3S A;  3NIP A;  3DJ8 A;  4I06 A;  4IU5 A;  3TF3 A;  4RHM A;  1R1O A;  3GMZ A;  1P8N A;  4ITY A;  4GSV A;  1P8M A;  4IXU A;  3LP7 A;  3E6V A;  1HQX A;  1HQF A;  2PHA A;  3THE A;  3RLA A;  4RHK A;  1TBJ A;  4MXR A;  4IU0 A;  4Q3U A;  3LHL A;  4IE3 A;  1P8S A;  1TBL A; 
#chains in the Genus database with same CATH topology
 4IU1 A;  1PQ3 A;  4Q3P A;  5EFH A;  4IE2 A;  3MZ6 A;  5DC8 A;  3SFH A;  3MZ7 A;  4RHJ A;  4BZ8 A;  4ZUR A;  4QA7 A;  5BWZ A;  4FCI A;  3C0Z A;  4GSM A;  2EIV A;  4DZ4 A;  1TBH A;  1GQ6 A;  1T64 A;  4MYN A;  5G1C A;  4ZUN A;  2EF4 A;  3MJL A;  4HZE A;  5HJ9 A;  2A0M A;  5D1B A;  4Q3R A;  2VQV A;  5FCW A;  1C3R A;  5EEN A;  3RQD A;  3F0R A;  3MAX A;  2V5X A;  3THJ A;  4IU4 A;  3MMR A;  3SL0 A;  1WVA A;  3Q9F A;  4MYL A;  5G0I A;  1CEV A;  2ZAV A;  2VQW G;  3NIO A;  3E8Z A;  4BKX B;  3MFV A;  1WVB A;  3SL1 A;  1HQH A;  4HXQ A;  3E9B A;  4Q3V A;  2PLL A;  5EEI A;  1XFK A;  4Q42 A;  4ZUM A;  3F06 A;  4HWW A;  3TH7 A;  4BZ7 A;  5IWG A;  1T4S A;  1ZZ0 A;  4CEV A;  5G0G A;  1GQ7 A;  5IX0 A;  3MZ3 A;  1P8R A;  3F80 A;  4A69 A;  3NIQ A;  5DC5 A;  4MYK A;  5G0X A;  1WOH A;  1P8Q A;  5THT A;  3EW8 A;  1HQ5 A;  5FUE A;  5EF8 A;  1T4T A;  5G12 A;  5D1C A;  3LP4 A;  3F07 A;  4GSZ A;  1P8S A;  4GWC A;  5G1B A;  5THV A;  1HQG A;  1T69 A;  4QA5 A;  4RN0 A;  1WOG A;  3Q9C A;  5D1D A;  4IXV A;  3E8Q A;  3CEV A;  3Q9B A;  4G3H A;  1T4R A;  2V5W A;  5G0H A;  5G3W A;  3Q9E A;  4GWD A;  3THH A;  5JI5 A;  1D3V A;  3SFF A;  3EWF A;  2EF5 A;  4QA1 A;  4Q3Q A;  4RHI A;  3ZNS A;  4QA6 A;  5LI3 A;  1WOI A;  2AEB A;  5DC7 A;  2PHO A;  5ICN B;  4RHQ A;  5G0J A;  4CQF A;  4ZUO A;  5CEV A;  1C3P A;  1P8P A;  3SJT A;  1RLA A;  3C10 A;  4QA4 A;  5G1A A;  5EFJ D;  2RLA A;  5G17 A;  4FCK A;  5EFK B;  4RN1 A;  5THS A;  1T5G A;  3KV2 A;  1T67 A;  3M1R A;  5G11 A;  4Q3R C;  5EEM A;  4Q3T A;  2VQM A;  4RLA A;  1T4P A;  1ZPE A;  4BZ9 A;  1ZZ1 A;  4CBT A;  3GN0 A;  3SKK A;  4MYF A;  4QA3 A;  4Q40 A;  4IE1 A;  1C3S A;  1ZPG A;  1T5F A;  4LXZ A;  4ZUQ A;  5HJA A;  3ZNR A;  4RN2 A;  1P8O A;  5RLA A;  3C0Y A;  4RHL A;  4Q41 A;  3E6K A;  2CEV A;  4BZ5 A;  3PZL A;  4QA2 A;  5G10 A;  1TA1 A;  4CBY A;  3MFW A;  3EZT A;  2VCG A;  1ZZ3 A;  4Q3S A;  5EFN A;  3NIP A;  5THU A;  3DJ8 A;  4I06 A;  4IU5 A;  5DC6 A;  3TF3 A;  4RHM A;  3MZ4 A;  5EFG A;  4ZUP A;  1R1O A;  3GMZ A;  1VKG A;  5EFB D;  4LY1 A;  1P8N A;  2GH6 A;  5EEK A;  3EZP A;  4ITY A;  4GSV A;  4QA0 A;  1P8M A;  4IXU A;  5A2S A;  3LP7 A;  3MEN A;  1W22 A;  2VQO A;  3E6V A;  1HQX A;  1HQF A;  5G13 A;  2PHA A;  3THE A;  3RLA A;  4BZ6 A;  5EEF A;  4RHK A;  1TBJ A;  4MXR A;  4IU0 A;  4Q3U A;  5EF7 A;  3LHL A;  4IE3 A;  2VQJ A;  5G0Y A;  2VQQ A;  1TBL A; 
#chains in the Genus database with same CATH homology
 4IU1 A;  1PQ3 A;  4Q3P A;  4IE2 A;  4RHJ A;  4FCI A;  4GSM A;  2EIV A;  4DZ4 A;  1TBH A;  1GQ6 A;  4MYN A;  2EF4 A;  3MJL A;  4HZE A;  5HJ9 A;  2A0M A;  4Q3R A;  3THJ A;  4IU4 A;  3MMR A;  3SL0 A;  1WVA A;  4MYL A;  1CEV A;  2ZAV A;  3NIO A;  3E8Z A;  3MFV A;  1WVB A;  3SL1 A;  1HQH A;  4HXQ A;  3E9B A;  4Q3V A;  2PLL A;  1XFK A;  4Q42 A;  4HWW A;  3TH7 A;  1T4S A;  4CEV A;  1GQ7 A;  1P8R A;  3F80 A;  3NIQ A;  4MYK A;  1WOH A;  1P8Q A;  1HQ5 A;  1T4T A;  3LP4 A;  4GSZ A;  4GWC A;  1HQG A;  1WOG A;  4IXV A;  3E8Q A;  3CEV A;  4G3H A;  1T4R A;  4GWD A;  3THH A;  1D3V A;  2EF5 A;  4RHI A;  4Q3Q A;  1WOI A;  2AEB A;  2PHO A;  4RHQ A;  5CEV A;  1P8P A;  3SJT A;  1RLA A;  2RLA A;  4FCK A;  1T5G A;  3KV2 A;  3M1R A;  4Q3R C;  4Q3T A;  4RLA A;  1T4P A;  1ZPE A;  3GN0 A;  3SKK A;  4MYF A;  4Q40 A;  4IE1 A;  1ZPG A;  1T5F A;  5HJA A;  5RLA A;  1P8O A;  4Q41 A;  4RHL A;  3E6K A;  2CEV A;  3PZL A;  1TA1 A;  3MFW A;  4Q3S A;  3NIP A;  3DJ8 A;  4I06 A;  4IU5 A;  3TF3 A;  4RHM A;  1R1O A;  3GMZ A;  1P8N A;  4ITY A;  4GSV A;  1P8M A;  4IXU A;  3LP7 A;  3E6V A;  1HQX A;  1HQF A;  2PHA A;  3THE A;  3RLA A;  4RHK A;  1TBJ A;  4MXR A;  4IU0 A;  4Q3U A;  3LHL A;  4IE3 A;  1P8S A;  1TBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...