1HQHA

Crystal structure of the binuclear manganese metalloenzyme arginase complexed with nor-n-hydroxy-l-arginine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE 1
publication title Mechanistic and metabolic inferences from the binding of substrate analogues and products to arginase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 106
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2000-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1hqhA00
3F80A 3LP4A 1T4PA 3SKKA 3KV2A 3RLAA 5CEVA 4IE3A 4IU5A 3PZLA 2EIVA 4MYKA 4Q3RA 4RLAA 1P8OA 4RHQA 4RHMA 1WOIA 1T5FA 4RHKA 3E8QA 4IU1A 4IU4A 2PLLA 1TBLA 1TBHA 3NIOA 1D3VA 3TH7A 1WOHA 3MFWA 4Q3QA 3NIPA 5RLAA 1HQFA 2ZAVA 2RLAA 4RHLA 4HWWA 1WVAA 4GWCA 2PHAA 3TF3A 2CEVA 3LP7A 4G3HA 1P8MA 2AEBA 4MYLA 4ITYA 4Q3UA 1T5GA 3E9BA 1WOGA 1GQ7A 4GWDA 1ZPEA 3MMRA 4IE1A 1TA1A 3E8ZA 2A0MA 3SJTA 4HXQA 3MJLA 3CEVA 1HQXA 1T4RA 3THHA 3M1RA 4IXVA 4HZEA 4IU0A 3THJA 4Q3PA 1P8SA 4MXRA 1T4TA 3E6VA 4GSMA 3THEA 2EF5A 3NIQA 1XFKA 3SL1A 1ZPGA 4Q40A 4RHIA 4IE2A 1HQHA 4Q3TA 4GSZA 1T4SA 4MYFA 4GSVA 1P8QA 2PHOA 3LHLA 3GMZA 1P8NA 4Q3VA 1P8PA 4DZ4A 1P8RA 1R1OA 3E6KA 1PQ3A 4IXUA 5HJAA 4FCIA 1RLAA 3GN0A 4CEVA 1GQ6A 4MYNA 1WVBA 4Q3SA 3MFVA 4RHJA 3DJ8A 4I06A 4Q3RC 1HQGA 1CEVA 4FCKA 2EF4A 3SL0A 4Q42A 1TBJA 4Q41A 5HJ9A 1HQ5A
chains in the Genus database with same CATH superfamily
3F80A 5G13A 1ZZ1A 3LP4A 5EFKB 3ZNSA 5G0HA 1T4PA 4BZ8A 4BZ7A 3SKKA 3KV2A 3RLAA 4CQFA 4IE3A 4IU5A 3PZLA 2EIVA 5CEVA 4MYKA 4Q3RA 1ZZ3A 4RLAA 5G0JA 1P8OA 4BZ5A 4RHQA 4RHMA 5EF8A 1WOIA 1T5FA 4RHKA 3E8QA 3SFHA 2V5WA 3Q9BA 5THSA 4IU1A 4IU4A 5G0IA 2PLLA 3EZPA 1TBLA 1TBHA 4CBYA 3NIOA 1D3VA 5EFGA 3TH7A 1WOHA 3MFWA 4Q3QA 3C0ZA 1C3RA 3NIPA 5RLAA 5LI3A 1HQFA 5DC8A 5EEKA 2ZAVA 2RLAA 3F0RA 4RHLA 4HWWA 1WVAA 5G0XA 4QA5A 4GWCA 5EF7A 2VQJA 2PHAA 3TF3A 2CEVA 3LP7A 4G3HA 1P8MA 5EFBD 2AEBA 5THUA 4MYLA 3RQDA 4ITYA 4Q3UA 1T5GA 5EFJD 5THTA 3E9BA 5IWGA 3SFFA 4QA3A 4ZUQA 1WOGA 5G12A 4ZUPA 1GQ7A 4GWDA 1ZPEA 3MMRA 4IE1A 1TA1A 3E8ZA 5EFNA 5DC7A 4BZ6A 2A0MA 4LXZA 3SJTA 4HXQA 3MJLA 1C3PA 3CEVA 1HQXA 1T4RA 4QA1A 3THHA 1C3SA 3M1RA 1VKGA 3MZ7A 3MZ4A 2GH6A 3ZNRA 4IXVA 5EEMA 4HZEA 4A69A 3EZTA 4ZURA 5G0GA 2VCGA 1T69A 4IU0A 2VQQA 3THJA 4BKXB 2VQOA 5BWZA 4Q3PA 4CBTA 4RN0A 5ICNB 5G10A 5DC6A 1P8SA 3MZ3A 4MXRA 1T4TA 3E6VA 4GSMA 3THEA 2EF5A 3NIQA 1XFKA 4QA4A 1ZPGA 4Q40A 3C0YA 3SL1A 4BZ9A 3EW8A 3Q9FA 4RHIA 2V5XA 4IE2A 1HQHA 4Q3TA 4GSZA 5EEFA 4ZUMA 1T4SA 3F06A 4MYFA 5D1DA 2VQMA 4RN2A 4GSVA 1P8QA 5D1BA 4ZUNA 5EFHA 5THVA 2PHOA 5G17A 3LHLA 3MZ6A 3GMZA 3Q9EA 5DC5A 1P8NA 4Q3VA 3MENA 4ZUOA 4QA0A 5D1CA 1P8PA 4DZ4A 1P8RA 1R1OA 5IX0A 5A2SA 3E6KA 3EWFA 1PQ3A 4QA6A 4IXUA 5G1BA 5HJAA 5G1CA 4FCIA 4LY1A 1T64A 1RLAA 5JI5A 2VQVA 4QA2A 2VQWG 3GN0A 3F07A 4CEVA 1GQ6A 4MYNA 3C10A 1WVBA 5EENA 4Q3SA 5FCWA 3MFVA 5EEIA 3Q9CA 4RHJA 3DJ8A 4RN1A 4I06A 4Q3RC 1W22A 1HQGA 1CEVA 4FCKA 2EF4A 5G0YA 1T67A 1ZZ0A 5G3WA 3MAXA 5FUEA 3SL0A 4QA7A 4Q42A 1TBJA 5G1AA 4Q41A 5HJ9A 5G11A 1HQ5A
chains in the Genus database with same CATH topology
3F80A 3LP4A 1T4PA 3SKKA 3KV2A 3RLAA 5CEVA 4IE3A 4IU5A 3PZLA 2EIVA 4MYKA 4Q3RA 4RLAA 1P8OA 4RHQA 4RHMA 1WOIA 1T5FA 4RHKA 3E8QA 4IU1A 4IU4A 2PLLA 1TBLA 1TBHA 3NIOA 1D3VA 3TH7A 1WOHA 3MFWA 4Q3QA 3NIPA 5RLAA 1HQFA 2ZAVA 2RLAA 4RHLA 4HWWA 1WVAA 4GWCA 2PHAA 3TF3A 2CEVA 3LP7A 4G3HA 1P8MA 2AEBA 4MYLA 4ITYA 4Q3UA 1T5GA 3E9BA 1WOGA 1GQ7A 4GWDA 1ZPEA 3MMRA 4IE1A 1TA1A 3E8ZA 2A0MA 3SJTA 4HXQA 3MJLA 3CEVA 1HQXA 1T4RA 3THHA 3M1RA 4IXVA 4HZEA 4IU0A 3THJA 4Q3PA 1P8SA 4MXRA 1T4TA 3E6VA 4GSMA 3THEA 2EF5A 3NIQA 1XFKA 3SL1A 1ZPGA 4Q40A 4RHIA 4IE2A 1HQHA 4Q3TA 4GSZA 1T4SA 4MYFA 4GSVA 1P8QA 2PHOA 3LHLA 3GMZA 1P8NA 4Q3VA 1P8PA 4DZ4A 1P8RA 1R1OA 3E6KA 1PQ3A 4IXUA 5HJAA 4FCIA 1RLAA 3GN0A 4CEVA 1GQ6A 4MYNA 1WVBA 4Q3SA 3MFVA 4RHJA 3DJ8A 4I06A 4Q3RC 1HQGA 1CEVA 4FCKA 2EF4A 3SL0A 4Q42A 1TBJA 4Q41A 5HJ9A 1HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F80 A;  3LP4 A;  1T4P A;  3SKK A;  3KV2 A;  3RLA A;  5CEV A;  4IE3 A;  4IU5 A;  3PZL A;  2EIV A;  4MYK A;  4Q3R A;  4RLA A;  1P8O A;  4RHQ A;  4RHM A;  1WOI A;  1T5F A;  4RHK A;  3E8Q A;  4IU1 A;  4IU4 A;  2PLL A;  1TBL A;  1TBH A;  3NIO A;  1D3V A;  3TH7 A;  1WOH A;  3MFW A;  4Q3Q A;  3NIP A;  5RLA A;  1HQF A;  2ZAV A;  2RLA A;  4RHL A;  4HWW A;  1WVA A;  4GWC A;  2PHA A;  3TF3 A;  2CEV A;  3LP7 A;  4G3H A;  1P8M A;  2AEB A;  4MYL A;  4ITY A;  4Q3U A;  1T5G A;  3E9B A;  1WOG A;  1GQ7 A;  4GWD A;  1ZPE A;  3MMR A;  4IE1 A;  1TA1 A;  3E8Z A;  2A0M A;  3SJT A;  4HXQ A;  3MJL A;  3CEV A;  1HQX A;  1T4R A;  3THH A;  3M1R A;  4IXV A;  4HZE A;  4IU0 A;  3THJ A;  4Q3P A;  1P8S A;  4MXR A;  1T4T A;  3E6V A;  4GSM A;  3THE A;  2EF5 A;  3NIQ A;  1XFK A;  3SL1 A;  1ZPG A;  4Q40 A;  4RHI A;  4IE2 A;  1HQH A;  4Q3T A;  4GSZ A;  1T4S A;  4MYF A;  4GSV A;  1P8Q A;  2PHO A;  3LHL A;  3GMZ A;  1P8N A;  4Q3V A;  1P8P A;  4DZ4 A;  1P8R A;  1R1O A;  3E6K A;  1PQ3 A;  4IXU A;  5HJA A;  4FCI A;  1RLA A;  3GN0 A;  4CEV A;  1GQ6 A;  4MYN A;  1WVB A;  4Q3S A;  3MFV A;  4RHJ A;  3DJ8 A;  4I06 A;  4Q3R C;  1HQG A;  1CEV A;  4FCK A;  2EF4 A;  3SL0 A;  4Q42 A;  1TBJ A;  4Q41 A;  5HJ9 A;  1HQ5 A; 
#chains in the Genus database with same CATH topology
 3F80 A;  5G13 A;  1ZZ1 A;  3LP4 A;  5EFK B;  3ZNS A;  5G0H A;  1T4P A;  4BZ8 A;  4BZ7 A;  3SKK A;  3KV2 A;  3RLA A;  4CQF A;  4IE3 A;  4IU5 A;  3PZL A;  2EIV A;  5CEV A;  4MYK A;  4Q3R A;  1ZZ3 A;  4RLA A;  5G0J A;  1P8O A;  4BZ5 A;  4RHQ A;  4RHM A;  5EF8 A;  1WOI A;  1T5F A;  4RHK A;  3E8Q A;  3SFH A;  2V5W A;  3Q9B A;  5THS A;  4IU1 A;  4IU4 A;  5G0I A;  2PLL A;  3EZP A;  1TBL A;  1TBH A;  4CBY A;  3NIO A;  1D3V A;  5EFG A;  3TH7 A;  1WOH A;  3MFW A;  4Q3Q A;  3C0Z A;  1C3R A;  3NIP A;  5RLA A;  5LI3 A;  1HQF A;  5DC8 A;  5EEK A;  2ZAV A;  2RLA A;  3F0R A;  4RHL A;  4HWW A;  1WVA A;  5G0X A;  4QA5 A;  4GWC A;  5EF7 A;  2VQJ A;  2PHA A;  3TF3 A;  2CEV A;  3LP7 A;  4G3H A;  1P8M A;  5EFB D;  2AEB A;  5THU A;  4MYL A;  3RQD A;  4ITY A;  4Q3U A;  1T5G A;  5EFJ D;  5THT A;  3E9B A;  5IWG A;  3SFF A;  4QA3 A;  4ZUQ A;  1WOG A;  5G12 A;  4ZUP A;  1GQ7 A;  4GWD A;  1ZPE A;  3MMR A;  4IE1 A;  1TA1 A;  3E8Z A;  5EFN A;  5DC7 A;  4BZ6 A;  2A0M A;  4LXZ A;  3SJT A;  4HXQ A;  3MJL A;  1C3P A;  3CEV A;  1HQX A;  1T4R A;  4QA1 A;  3THH A;  1C3S A;  3M1R A;  1VKG A;  3MZ7 A;  3MZ4 A;  2GH6 A;  3ZNR A;  4IXV A;  5EEM A;  4HZE A;  4A69 A;  3EZT A;  4ZUR A;  5G0G A;  2VCG A;  1T69 A;  4IU0 A;  2VQQ A;  3THJ A;  4BKX B;  2VQO A;  5BWZ A;  4Q3P A;  4CBT A;  4RN0 A;  5ICN B;  5G10 A;  5DC6 A;  1P8S A;  3MZ3 A;  4MXR A;  1T4T A;  3E6V A;  4GSM A;  3THE A;  2EF5 A;  3NIQ A;  1XFK A;  4QA4 A;  1ZPG A;  4Q40 A;  3C0Y A;  3SL1 A;  4BZ9 A;  3EW8 A;  3Q9F A;  4RHI A;  2V5X A;  4IE2 A;  1HQH A;  4Q3T A;  4GSZ A;  5EEF A;  4ZUM A;  1T4S A;  3F06 A;  4MYF A;  5D1D A;  2VQM A;  4RN2 A;  4GSV A;  1P8Q A;  5D1B A;  4ZUN A;  5EFH A;  5THV A;  2PHO A;  5G17 A;  3LHL A;  3MZ6 A;  3GMZ A;  3Q9E A;  5DC5 A;  1P8N A;  4Q3V A;  3MEN A;  4ZUO A;  4QA0 A;  5D1C A;  1P8P A;  4DZ4 A;  1P8R A;  1R1O A;  5IX0 A;  5A2S A;  3E6K A;  3EWF A;  1PQ3 A;  4QA6 A;  4IXU A;  5G1B A;  5HJA A;  5G1C A;  4FCI A;  4LY1 A;  1T64 A;  1RLA A;  5JI5 A;  2VQV A;  4QA2 A;  2VQW G;  3GN0 A;  3F07 A;  4CEV A;  1GQ6 A;  4MYN A;  3C10 A;  1WVB A;  5EEN A;  4Q3S A;  5FCW A;  3MFV A;  5EEI A;  3Q9C A;  4RHJ A;  3DJ8 A;  4RN1 A;  4I06 A;  4Q3R C;  1W22 A;  1HQG A;  1CEV A;  4FCK A;  2EF4 A;  5G0Y A;  1T67 A;  1ZZ0 A;  5G3W A;  3MAX A;  5FUE A;  3SL0 A;  4QA7 A;  4Q42 A;  1TBJ A;  5G1A A;  4Q41 A;  5HJ9 A;  5G11 A;  1HQ5 A; 
#chains in the Genus database with same CATH homology
 3F80 A;  3LP4 A;  1T4P A;  3SKK A;  3KV2 A;  3RLA A;  5CEV A;  4IE3 A;  4IU5 A;  3PZL A;  2EIV A;  4MYK A;  4Q3R A;  4RLA A;  1P8O A;  4RHQ A;  4RHM A;  1WOI A;  1T5F A;  4RHK A;  3E8Q A;  4IU1 A;  4IU4 A;  2PLL A;  1TBL A;  1TBH A;  3NIO A;  1D3V A;  3TH7 A;  1WOH A;  3MFW A;  4Q3Q A;  3NIP A;  5RLA A;  1HQF A;  2ZAV A;  2RLA A;  4RHL A;  4HWW A;  1WVA A;  4GWC A;  2PHA A;  3TF3 A;  2CEV A;  3LP7 A;  4G3H A;  1P8M A;  2AEB A;  4MYL A;  4ITY A;  4Q3U A;  1T5G A;  3E9B A;  1WOG A;  1GQ7 A;  4GWD A;  1ZPE A;  3MMR A;  4IE1 A;  1TA1 A;  3E8Z A;  2A0M A;  3SJT A;  4HXQ A;  3MJL A;  3CEV A;  1HQX A;  1T4R A;  3THH A;  3M1R A;  4IXV A;  4HZE A;  4IU0 A;  3THJ A;  4Q3P A;  1P8S A;  4MXR A;  1T4T A;  3E6V A;  4GSM A;  3THE A;  2EF5 A;  3NIQ A;  1XFK A;  3SL1 A;  1ZPG A;  4Q40 A;  4RHI A;  4IE2 A;  1HQH A;  4Q3T A;  4GSZ A;  1T4S A;  4MYF A;  4GSV A;  1P8Q A;  2PHO A;  3LHL A;  3GMZ A;  1P8N A;  4Q3V A;  1P8P A;  4DZ4 A;  1P8R A;  1R1O A;  3E6K A;  1PQ3 A;  4IXU A;  5HJA A;  4FCI A;  1RLA A;  3GN0 A;  4CEV A;  1GQ6 A;  4MYN A;  1WVB A;  4Q3S A;  3MFV A;  4RHJ A;  3DJ8 A;  4I06 A;  4Q3R C;  1HQG A;  1CEV A;  4FCK A;  2EF4 A;  3SL0 A;  4Q42 A;  1TBJ A;  4Q41 A;  5HJ9 A;  1HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...