3DJ8A

Synthesis of (2s)-2-amino-7,8-epoxyoctanoic acid and structure of its metal-bridging complex with human arginase i
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
313
Chain Sequence
RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Synthesis of (2S)-2-amino-7,8-epoxyoctanoic acid and structure of its metal-bridging complex with human arginase I
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 113
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2008-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3dj8A00
1P8PA 3NIOA 4RHLA 1D3VA 1WOGA 1HQFA 4GSMA 4FCIA 4GSVA 5CEVA 4HXQA 1P8SA 4HZEA 5HJAA 4Q41A 4CEVA 4Q3RC 4DZ4A 4Q3UA 4GWDA 3MJLA 4Q3VA 4RHKA 5HJ9A 1GQ7A 3CEVA 4I06A 1HQHA 3NIQA 3SKKA 3MFVA 3KV2A 1ZPEA 4Q3SA 4Q3QA 4Q3TA 1P8QA 1R1OA 2EF4A 1TA1A 3E6VA 3THHA 3M1RA 1T5FA 4IXVA 4G3HA 2RLAA 4Q42A 3RLAA 3E6KA 2ZAVA 4IXUA 3NIPA 1T4TA 5RLAA 4RHMA 3F80A 1T4RA 2PLLA 3SJTA 2PHAA 3DJ8A 4Q40A 3SL0A 1XFKA 4RHJA 4MYNA 2PHOA 1P8RA 1ZPGA 1TBHA 4MYKA 3E8QA 3MFWA 4IU5A 3SL1A 2A0MA 1T5GA 4RHIA 1HQ5A 1WOHA 3LP7A 4HWWA 2EIVA 1P8NA 1GQ6A 4IU4A 4Q3RA 4GSZA 3MMRA 4MYFA 4IU0A 1P8OA 3TH7A 1P8MA 3LP4A 1TBJA 3GN0A 4FCKA 2EF5A 1HQXA 4IE1A 1WVBA 1WVAA 3GMZA 1PQ3A 3PZLA 4MXRA 4IE3A 1T4SA 4RLAA 3E9BA 1RLAA 4IE2A 2AEBA 3THEA 4Q3PA 3LHLA 3E8ZA 1CEVA 4IU1A 4MYLA 4GWCA 2CEVA 1T4PA 1HQGA 3TF3A 1TBLA 4RHQA 4ITYA 1WOIA 3THJA
chains in the Genus database with same CATH superfamily
1P8PA 3NIOA 2GH6A 1D3VA 4LXZA 4RHLA 1WOGA 1HQFA 4GSMA 1C3PA 4QA2A 5FUEA 4FCIA 5G12A 4GSVA 3MAXA 5CEVA 4HXQA 1P8SA 4HZEA 3Q9EA 2VQOA 4LY1A 5G0JA 5HJAA 4Q41A 3MZ6A 4QA3A 4QA7A 4CEVA 4CQFA 4Q3RC 4DZ4A 2VQWG 3EZPA 5EF8A 1ZZ0A 4Q3UA 3MZ3A 3MJLA 4GWDA 4Q3VA 4RHKA 5HJ9A 5A2SA 5EENA 1GQ7A 5DC5A 1ZZ3A 3CEVA 4I06A 5THTA 5G1CA 1HQHA 3NIQA 4QA6A 5G0XA 4BZ6A 5LI3A 3SKKA 3MFVA 3KV2A 1ZPEA 4Q3SA 3F0RA 4Q3QA 4BZ7A 4RN2A 4Q3TA 3RQDA 1P8QA 1R1OA 2EF4A 5G0GA 4ZUQA 1TA1A 2V5WA 3E6VA 5ICNB 3F06A 5G11A 3THHA 3M1RA 2VQQA 1T67A 4ZUNA 1T5FA 4QA5A 4IXVA 4G3HA 2RLAA 4Q42A 5EFHA 4ZUPA 3E6KA 2ZAVA 3MZ4A 3RLAA 3ZNSA 4IXUA 3ZNRA 3NIPA 4BZ9A 1W22A 1T4TA 4CBYA 5RLAA 4RHMA 3F80A 3MENA 5BWZA 1T4RA 2PLLA 3EZTA 1ZZ1A 3SJTA 2PHAA 3DJ8A 1T69A 4Q40A 5D1BA 5EF7A 3SL0A 3EW8A 4CBTA 1XFKA 4RHJA 5EEFA 4MYNA 5IX0A 2PHOA 4QA4A 1P8RA 4BZ8A 1ZPGA 1TBHA 4ZURA 4MYKA 3E8QA 3MFWA 4IU5A 3SL1A 2VQVA 2A0MA 1T5GA 4RHIA 1HQ5A 1WOHA 3LP7A 4HWWA 5EEMA 2EIVA 1P8NA 1GQ6A 4IU4A 4Q3RA 4GSZA 3MMRA 5JI5A 4MYFA 4IU0A 1P8OA 3TH7A 5EFBD 1P8MA 5DC8A 5THVA 3LP4A 1TBJA 1C3SA 3SFFA 3GN0A 1T64A 4A69A 4FCKA 1VKGA 1HQXA 2EF5A 3MZ7A 4IE1A 5G10A 3SFHA 4BKXB 4QA1A 1WVBA 1C3RA 1WVAA 5EFKB 4BZ5A 3C0ZA 5THSA 5G0HA 3GMZA 5G1BA 3Q9CA 5EFJD 3F07A 1PQ3A 4ZUOA 5G3WA 3PZLA 4MXRA 4IE3A 5G17A 4RN1A 5DC6A 1T4SA 4RN0A 4RLAA 3E9BA 5D1DA 5G1AA 5G0YA 5G13A 3C10A 2VCGA 5EFGA 5THUA 1RLAA 5FCWA 4IE2A 2AEBA 3Q9FA 3THEA 4Q3PA 3LHLA 3E8ZA 1CEVA 4IU1A 4QA0A 4MYLA 5DC7A 5EEKA 5EEIA 1WOIA 5IWGA 4GWCA 5G0IA 2CEVA 1T4PA 1HQGA 3Q9BA 4ZUMA 3TF3A 1TBLA 5D1CA 4RHQA 4ITYA 2V5XA 3C0YA 2VQJA 2VQMA 3EWFA 3THJA 5EFNA
chains in the Genus database with same CATH topology
1P8PA 3NIOA 4RHLA 1D3VA 1WOGA 1HQFA 4GSMA 4FCIA 4GSVA 5CEVA 4HXQA 1P8SA 4HZEA 5HJAA 4Q41A 4CEVA 4Q3RC 4DZ4A 4Q3UA 4GWDA 3MJLA 4Q3VA 4RHKA 5HJ9A 1GQ7A 3CEVA 4I06A 1HQHA 3NIQA 3SKKA 3MFVA 3KV2A 1ZPEA 4Q3SA 4Q3QA 4Q3TA 1P8QA 1R1OA 2EF4A 1TA1A 3E6VA 3THHA 3M1RA 1T5FA 4IXVA 4G3HA 2RLAA 4Q42A 3RLAA 3E6KA 2ZAVA 4IXUA 3NIPA 1T4TA 5RLAA 4RHMA 3F80A 1T4RA 2PLLA 3SJTA 2PHAA 3DJ8A 4Q40A 3SL0A 1XFKA 4RHJA 4MYNA 2PHOA 1P8RA 1ZPGA 1TBHA 4MYKA 3E8QA 3MFWA 4IU5A 3SL1A 2A0MA 1T5GA 4RHIA 1HQ5A 1WOHA 3LP7A 4HWWA 2EIVA 1P8NA 1GQ6A 4IU4A 4Q3RA 4GSZA 3MMRA 4MYFA 4IU0A 1P8OA 3TH7A 1P8MA 3LP4A 1TBJA 3GN0A 4FCKA 2EF5A 1HQXA 4IE1A 1WVBA 1WVAA 3GMZA 1PQ3A 3PZLA 4MXRA 4IE3A 1T4SA 4RLAA 3E9BA 1RLAA 4IE2A 2AEBA 3THEA 4Q3PA 3LHLA 3E8ZA 1CEVA 4IU1A 4MYLA 4GWCA 2CEVA 1T4PA 1HQGA 3TF3A 1TBLA 4RHQA 4ITYA 1WOIA 3THJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8P A;  3NIO A;  4RHL A;  1D3V A;  1WOG A;  1HQF A;  4GSM A;  4FCI A;  4GSV A;  5CEV A;  4HXQ A;  1P8S A;  4HZE A;  5HJA A;  4Q41 A;  4CEV A;  4Q3R C;  4DZ4 A;  4Q3U A;  4GWD A;  3MJL A;  4Q3V A;  4RHK A;  5HJ9 A;  1GQ7 A;  3CEV A;  4I06 A;  1HQH A;  3NIQ A;  3SKK A;  3MFV A;  3KV2 A;  1ZPE A;  4Q3S A;  4Q3Q A;  4Q3T A;  1P8Q A;  1R1O A;  2EF4 A;  1TA1 A;  3E6V A;  3THH A;  3M1R A;  1T5F A;  4IXV A;  4G3H A;  2RLA A;  4Q42 A;  3RLA A;  3E6K A;  2ZAV A;  4IXU A;  3NIP A;  1T4T A;  5RLA A;  4RHM A;  3F80 A;  1T4R A;  2PLL A;  3SJT A;  2PHA A;  3DJ8 A;  4Q40 A;  3SL0 A;  1XFK A;  4RHJ A;  4MYN A;  2PHO A;  1P8R A;  1ZPG A;  1TBH A;  4MYK A;  3E8Q A;  3MFW A;  4IU5 A;  3SL1 A;  2A0M A;  1T5G A;  4RHI A;  1HQ5 A;  1WOH A;  3LP7 A;  4HWW A;  2EIV A;  1P8N A;  1GQ6 A;  4IU4 A;  4Q3R A;  4GSZ A;  3MMR A;  4MYF A;  4IU0 A;  1P8O A;  3TH7 A;  1P8M A;  3LP4 A;  1TBJ A;  3GN0 A;  4FCK A;  2EF5 A;  1HQX A;  4IE1 A;  1WVB A;  1WVA A;  3GMZ A;  1PQ3 A;  3PZL A;  4MXR A;  4IE3 A;  1T4S A;  4RLA A;  3E9B A;  1RLA A;  4IE2 A;  2AEB A;  3THE A;  4Q3P A;  3LHL A;  3E8Z A;  1CEV A;  4IU1 A;  4MYL A;  4GWC A;  2CEV A;  1T4P A;  1HQG A;  3TF3 A;  1TBL A;  4RHQ A;  4ITY A;  1WOI A;  3THJ A; 
#chains in the Genus database with same CATH topology
 1P8P A;  3NIO A;  2GH6 A;  1D3V A;  4LXZ A;  4RHL A;  1WOG A;  1HQF A;  4GSM A;  1C3P A;  4QA2 A;  5FUE A;  4FCI A;  5G12 A;  4GSV A;  3MAX A;  5CEV A;  4HXQ A;  1P8S A;  4HZE A;  3Q9E A;  2VQO A;  4LY1 A;  5G0J A;  5HJA A;  4Q41 A;  3MZ6 A;  4QA3 A;  4QA7 A;  4CEV A;  4CQF A;  4Q3R C;  4DZ4 A;  2VQW G;  3EZP A;  5EF8 A;  1ZZ0 A;  4Q3U A;  3MZ3 A;  3MJL A;  4GWD A;  4Q3V A;  4RHK A;  5HJ9 A;  5A2S A;  5EEN A;  1GQ7 A;  5DC5 A;  1ZZ3 A;  3CEV A;  4I06 A;  5THT A;  5G1C A;  1HQH A;  3NIQ A;  4QA6 A;  5G0X A;  4BZ6 A;  5LI3 A;  3SKK A;  3MFV A;  3KV2 A;  1ZPE A;  4Q3S A;  3F0R A;  4Q3Q A;  4BZ7 A;  4RN2 A;  4Q3T A;  3RQD A;  1P8Q A;  1R1O A;  2EF4 A;  5G0G A;  4ZUQ A;  1TA1 A;  2V5W A;  3E6V A;  5ICN B;  3F06 A;  5G11 A;  3THH A;  3M1R A;  2VQQ A;  1T67 A;  4ZUN A;  1T5F A;  4QA5 A;  4IXV A;  4G3H A;  2RLA A;  4Q42 A;  5EFH A;  4ZUP A;  3E6K A;  2ZAV A;  3MZ4 A;  3RLA A;  3ZNS A;  4IXU A;  3ZNR A;  3NIP A;  4BZ9 A;  1W22 A;  1T4T A;  4CBY A;  5RLA A;  4RHM A;  3F80 A;  3MEN A;  5BWZ A;  1T4R A;  2PLL A;  3EZT A;  1ZZ1 A;  3SJT A;  2PHA A;  3DJ8 A;  1T69 A;  4Q40 A;  5D1B A;  5EF7 A;  3SL0 A;  3EW8 A;  4CBT A;  1XFK A;  4RHJ A;  5EEF A;  4MYN A;  5IX0 A;  2PHO A;  4QA4 A;  1P8R A;  4BZ8 A;  1ZPG A;  1TBH A;  4ZUR A;  4MYK A;  3E8Q A;  3MFW A;  4IU5 A;  3SL1 A;  2VQV A;  2A0M A;  1T5G A;  4RHI A;  1HQ5 A;  1WOH A;  3LP7 A;  4HWW A;  5EEM A;  2EIV A;  1P8N A;  1GQ6 A;  4IU4 A;  4Q3R A;  4GSZ A;  3MMR A;  5JI5 A;  4MYF A;  4IU0 A;  1P8O A;  3TH7 A;  5EFB D;  1P8M A;  5DC8 A;  5THV A;  3LP4 A;  1TBJ A;  1C3S A;  3SFF A;  3GN0 A;  1T64 A;  4A69 A;  4FCK A;  1VKG A;  1HQX A;  2EF5 A;  3MZ7 A;  4IE1 A;  5G10 A;  3SFH A;  4BKX B;  4QA1 A;  1WVB A;  1C3R A;  1WVA A;  5EFK B;  4BZ5 A;  3C0Z A;  5THS A;  5G0H A;  3GMZ A;  5G1B A;  3Q9C A;  5EFJ D;  3F07 A;  1PQ3 A;  4ZUO A;  5G3W A;  3PZL A;  4MXR A;  4IE3 A;  5G17 A;  4RN1 A;  5DC6 A;  1T4S A;  4RN0 A;  4RLA A;  3E9B A;  5D1D A;  5G1A A;  5G0Y A;  5G13 A;  3C10 A;  2VCG A;  5EFG A;  5THU A;  1RLA A;  5FCW A;  4IE2 A;  2AEB A;  3Q9F A;  3THE A;  4Q3P A;  3LHL A;  3E8Z A;  1CEV A;  4IU1 A;  4QA0 A;  4MYL A;  5DC7 A;  5EEK A;  5EEI A;  1WOI A;  5IWG A;  4GWC A;  5G0I A;  2CEV A;  1T4P A;  1HQG A;  3Q9B A;  4ZUM A;  3TF3 A;  1TBL A;  5D1C A;  4RHQ A;  4ITY A;  2V5X A;  3C0Y A;  2VQJ A;  2VQM A;  3EWF A;  3THJ A;  5EFN A; 
#chains in the Genus database with same CATH homology
 1P8P A;  3NIO A;  4RHL A;  1D3V A;  1WOG A;  1HQF A;  4GSM A;  4FCI A;  4GSV A;  5CEV A;  4HXQ A;  1P8S A;  4HZE A;  5HJA A;  4Q41 A;  4CEV A;  4Q3R C;  4DZ4 A;  4Q3U A;  4GWD A;  3MJL A;  4Q3V A;  4RHK A;  5HJ9 A;  1GQ7 A;  3CEV A;  4I06 A;  1HQH A;  3NIQ A;  3SKK A;  3MFV A;  3KV2 A;  1ZPE A;  4Q3S A;  4Q3Q A;  4Q3T A;  1P8Q A;  1R1O A;  2EF4 A;  1TA1 A;  3E6V A;  3THH A;  3M1R A;  1T5F A;  4IXV A;  4G3H A;  2RLA A;  4Q42 A;  3RLA A;  3E6K A;  2ZAV A;  4IXU A;  3NIP A;  1T4T A;  5RLA A;  4RHM A;  3F80 A;  1T4R A;  2PLL A;  3SJT A;  2PHA A;  3DJ8 A;  4Q40 A;  3SL0 A;  1XFK A;  4RHJ A;  4MYN A;  2PHO A;  1P8R A;  1ZPG A;  1TBH A;  4MYK A;  3E8Q A;  3MFW A;  4IU5 A;  3SL1 A;  2A0M A;  1T5G A;  4RHI A;  1HQ5 A;  1WOH A;  3LP7 A;  4HWW A;  2EIV A;  1P8N A;  1GQ6 A;  4IU4 A;  4Q3R A;  4GSZ A;  3MMR A;  4MYF A;  4IU0 A;  1P8O A;  3TH7 A;  1P8M A;  3LP4 A;  1TBJ A;  3GN0 A;  4FCK A;  2EF5 A;  1HQX A;  4IE1 A;  1WVB A;  1WVA A;  3GMZ A;  1PQ3 A;  3PZL A;  4MXR A;  4IE3 A;  1T4S A;  4RLA A;  3E9B A;  1RLA A;  4IE2 A;  2AEB A;  3THE A;  4Q3P A;  3LHL A;  3E8Z A;  1CEV A;  4IU1 A;  4MYL A;  4GWC A;  2CEV A;  1T4P A;  1HQG A;  3TF3 A;  1TBL A;  4RHQ A;  4ITY A;  1WOI A;  3THJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...