3Q9FA

Crystal structure of apah complexed with caps
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
341
structure length
341
Chain Sequence
MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVLKVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAISPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQRLLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAGAGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPDYITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylpolyamine amidohydrolase
publication title Structure of prokaryotic polyamine deacetylase reveals evolutionary functional relationships with eukaryotic histone deacetylases .
pubmed doi rcsb
source organism Mycoplana ramosa
molecule tags Hydrolase
total genus 113
structure length 341
sequence length 341
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.5.1.48: Acetylspermidine deacetylase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 3q9fA00
2VQWG 5G1BA 5G11A 4CBTA 5DC5A 5G0JA 2VCGA 4QA2A 3MENA 2VQQA 5JI5A 5D1DA 5G13A 3SFHA 1T67A 5G17A 3C10A 1T69A 1ZZ0A 1C3PA 3MZ3A 5D1CA 3MZ6A 5EENA 5THTA 2VQOA 4QA7A 5DC8A 5IWGA 4BZ8A 5ICNB 5EF8A 1ZZ3A 4QA1A 4ZUQA 2VQMA 4QA5A 3F06A 4ZUMA 5THVA 5G0HA 4CBYA 4RN2A 3C0ZA 5BWZA 5EFBD 4LXZA 5G0GA 3ZNRA 3ZNSA 3EW8A 3F0RA 5EFHA 5LI3A 5FUEA 3Q9EA 5EF7A 5G12A 3Q9CA 5EFGA 3EZTA 5G10A 1VKGA 5DC7A 5G1AA 4CQFA 4BKXB 4QA6A 4BZ6A 3Q9FA 5EFNA 4LY1A 5G3WA 5EEIA 2VQJA 3C0YA 5THSA 3RQDA 3EWFA 5G0IA 4QA4A 4ZUOA 3MZ4A 1T64A 4RN1A 5G1CA 2VQVA 3Q9BA 5EFKB 5EFJD 5G0YA 5A2SA 3MAXA 4ZUNA 3MZ7A 5EEFA 5DC6A 4QA0A 3EZPA 5EEKA 4QA3A 5D1BA 4BZ5A 1C3SA 1ZZ1A 5THUA 1C3RA 3F07A 4ZURA 2V5XA 4ZUPA 3SFFA 4BZ9A 2GH6A 4A69A 5IX0A 1W22A 4RN0A 5EEMA 4BZ7A 2V5WA 5FCWA 5G0XA
chains in the Genus database with same CATH superfamily
2VQWG 2EF5A 5G1BA 1P8OA 3NIOA 4RLAA 5G11A 1TBHA 2PHOA 1PQ3A 1T5FA 5DC5A 2ZAVA 4CBTA 5G0JA 1XFKA 1TA1A 2VCGA 3SJTA 4MYNA 1R1OA 4QA2A 3MENA 5CEVA 2VQQA 1ZPGA 5D1DA 5G13A 4FCKA 4IU0A 5HJ9A 4Q3UA 3SFHA 1T67A 1WOIA 5G17A 1TBLA 3C10A 1HQXA 1P8QA 4Q3QA 1T69A 1ZZ0A 3LHLA 1C3PA 3MZ3A 5D1CA 3MZ6A 1HQHA 4Q3VA 5EENA 5THTA 2VQOA 4QA7A 2CEVA 4Q3RA 5DC8A 5IWGA 4DZ4A 3E9BA 3THEA 3GN0A 4IU1A 4Q3SA 4BZ8A 5EF8A 1T4RA 5ICNB 1ZZ3A 1P8PA 4HWWA 4QA1A 4ZUQA 4MXRA 3F80A 2VQMA 4HZEA 4IXVA 4QA5A 3F06A 4ZUMA 1P8MA 5HJAA 1TBJA 5THVA 5G0HA 1P8SA 1T4TA 3THHA 4CBYA 4RN2A 3C0ZA 5BWZA 5EFBD 4LXZA 1WVAA 1WOGA 5G0GA 3ZNRA 2RLAA 3THJA 3ZNSA 3EW8A 3F0RA 1P8RA 4IXUA 4MYKA 5EFHA 5LI3A 5FUEA 4RHQA 3Q9EA 3TF3A 5EF7A 2A0MA 3E6KA 3SL0A 1HQFA 2PLLA 5G12A 4GSMA 4RHMA 3SL1A 3Q9CA 4G3HA 4GWCA 3EZTA 5EFGA 3M1RA 4FCIA 4IU4A 1VKGA 1GQ6A 5G10A 2EF4A 5DC7A 5G1AA 1ZPEA 4BKXB 4QA6A 4CQFA 4BZ6A 3PZLA 3LP4A 3KV2A 3NIQA 3Q9FA 5EFNA 3E6VA 5RLAA 4LY1A 3SKKA 5JI5A 5G3WA 1RLAA 4Q42A 4GSZA 2VQJA 5EEIA 1WVBA 3TH7A 3C0YA 5THSA 3RQDA 3EWFA 4I06A 4Q40A 5G0IA 1HQ5A 4QA4A 4ZUOA 4RHLA 3MZ4A 1WOHA 2PHAA 1T64A 4RN1A 5G1CA 2VQVA 2AEBA 1T4PA 1D3VA 4ITYA 3Q9BA 3GMZA 5EFKB 5EFJD 1GQ7A 5G0YA 5A2SA 4MYLA 3MAXA 4ZUNA 3MZ7A 5EEFA 5DC6A 4QA0A 3EZPA 5EEKA 1T5GA 3MMRA 3DJ8A 4IE2A 4QA3A 5D1BA 4BZ5A 3CEVA 4HXQA 1C3SA 4IE1A 3MJLA 1ZZ1A 5THUA 1C3RA 1P8NA 4IE3A 3F07A 4ZURA 4RHKA 3NIPA 4Q3RC 3E8ZA 1CEVA 2V5XA 2EIVA 4RHIA 3MFWA 3E8QA 4ZUPA 1HQGA 4MYFA 3RLAA 3SFFA 4BZ9A 2GH6A 4A69A 4CEVA 4GSVA 3MFVA 4Q41A 3LP7A 1T4SA 1W22A 4GWDA 4Q3PA 4Q3TA 4RHJA 4RN0A 5EEMA 5IX0A 4IU5A 2V5WA 4BZ7A 5FCWA 5G0XA
chains in the Genus database with same CATH topology
2VQWG 5G1BA 5G11A 4CBTA 5DC5A 5G0JA 2VCGA 4QA2A 3MENA 2VQQA 5JI5A 5D1DA 5G13A 3SFHA 1T67A 5G17A 3C10A 1T69A 1ZZ0A 1C3PA 3MZ3A 5D1CA 3MZ6A 5EENA 5THTA 2VQOA 4QA7A 5DC8A 5IWGA 4BZ8A 5ICNB 5EF8A 1ZZ3A 4QA1A 4ZUQA 2VQMA 4QA5A 3F06A 4ZUMA 5THVA 5G0HA 4CBYA 4RN2A 3C0ZA 5BWZA 5EFBD 4LXZA 5G0GA 3ZNRA 3ZNSA 3EW8A 3F0RA 5EFHA 5LI3A 5FUEA 3Q9EA 5EF7A 5G12A 3Q9CA 5EFGA 3EZTA 5G10A 1VKGA 5DC7A 5G1AA 4CQFA 4BKXB 4QA6A 4BZ6A 3Q9FA 5EFNA 4LY1A 5G3WA 5EEIA 2VQJA 3C0YA 5THSA 3RQDA 3EWFA 5G0IA 4QA4A 4ZUOA 3MZ4A 1T64A 4RN1A 5G1CA 2VQVA 3Q9BA 5EFKB 5EFJD 5G0YA 5A2SA 3MAXA 4ZUNA 3MZ7A 5EEFA 5DC6A 4QA0A 3EZPA 5EEKA 4QA3A 5D1BA 4BZ5A 1C3SA 1ZZ1A 5THUA 1C3RA 3F07A 4ZURA 2V5XA 4ZUPA 3SFFA 4BZ9A 2GH6A 4A69A 5IX0A 1W22A 4RN0A 5EEMA 4BZ7A 2V5WA 5FCWA 5G0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQW G;  5G1B A;  5G11 A;  4CBT A;  5DC5 A;  5G0J A;  2VCG A;  4QA2 A;  3MEN A;  2VQQ A;  5JI5 A;  5D1D A;  5G13 A;  3SFH A;  1T67 A;  5G17 A;  3C10 A;  1T69 A;  1ZZ0 A;  1C3P A;  3MZ3 A;  5D1C A;  3MZ6 A;  5EEN A;  5THT A;  2VQO A;  4QA7 A;  5DC8 A;  5IWG A;  4BZ8 A;  5ICN B;  5EF8 A;  1ZZ3 A;  4QA1 A;  4ZUQ A;  2VQM A;  4QA5 A;  3F06 A;  4ZUM A;  5THV A;  5G0H A;  4CBY A;  4RN2 A;  3C0Z A;  5BWZ A;  5EFB D;  4LXZ A;  5G0G A;  3ZNR A;  3ZNS A;  3EW8 A;  3F0R A;  5EFH A;  5LI3 A;  5FUE A;  3Q9E A;  5EF7 A;  5G12 A;  3Q9C A;  5EFG A;  3EZT A;  5G10 A;  1VKG A;  5DC7 A;  5G1A A;  4CQF A;  4BKX B;  4QA6 A;  4BZ6 A;  3Q9F A;  5EFN A;  4LY1 A;  5G3W A;  5EEI A;  2VQJ A;  3C0Y A;  5THS A;  3RQD A;  3EWF A;  5G0I A;  4QA4 A;  4ZUO A;  3MZ4 A;  1T64 A;  4RN1 A;  5G1C A;  2VQV A;  3Q9B A;  5EFK B;  5EFJ D;  5G0Y A;  5A2S A;  3MAX A;  4ZUN A;  3MZ7 A;  5EEF A;  5DC6 A;  4QA0 A;  3EZP A;  5EEK A;  4QA3 A;  5D1B A;  4BZ5 A;  1C3S A;  1ZZ1 A;  5THU A;  1C3R A;  3F07 A;  4ZUR A;  2V5X A;  4ZUP A;  3SFF A;  4BZ9 A;  2GH6 A;  4A69 A;  5IX0 A;  1W22 A;  4RN0 A;  5EEM A;  4BZ7 A;  2V5W A;  5FCW A;  5G0X A; 
#chains in the Genus database with same CATH topology
 2VQW G;  2EF5 A;  5G1B A;  1P8O A;  3NIO A;  4RLA A;  5G11 A;  1TBH A;  2PHO A;  1PQ3 A;  1T5F A;  5DC5 A;  2ZAV A;  4CBT A;  5G0J A;  1XFK A;  1TA1 A;  2VCG A;  3SJT A;  4MYN A;  1R1O A;  4QA2 A;  3MEN A;  5CEV A;  2VQQ A;  1ZPG A;  5D1D A;  5G13 A;  4FCK A;  4IU0 A;  5HJ9 A;  4Q3U A;  3SFH A;  1T67 A;  1WOI A;  5G17 A;  1TBL A;  3C10 A;  1HQX A;  1P8Q A;  4Q3Q A;  1T69 A;  1ZZ0 A;  3LHL A;  1C3P A;  3MZ3 A;  5D1C A;  3MZ6 A;  1HQH A;  4Q3V A;  5EEN A;  5THT A;  2VQO A;  4QA7 A;  2CEV A;  4Q3R A;  5DC8 A;  5IWG A;  4DZ4 A;  3E9B A;  3THE A;  3GN0 A;  4IU1 A;  4Q3S A;  4BZ8 A;  5EF8 A;  1T4R A;  5ICN B;  1ZZ3 A;  1P8P A;  4HWW A;  4QA1 A;  4ZUQ A;  4MXR A;  3F80 A;  2VQM A;  4HZE A;  4IXV A;  4QA5 A;  3F06 A;  4ZUM A;  1P8M A;  5HJA A;  1TBJ A;  5THV A;  5G0H A;  1P8S A;  1T4T A;  3THH A;  4CBY A;  4RN2 A;  3C0Z A;  5BWZ A;  5EFB D;  4LXZ A;  1WVA A;  1WOG A;  5G0G A;  3ZNR A;  2RLA A;  3THJ A;  3ZNS A;  3EW8 A;  3F0R A;  1P8R A;  4IXU A;  4MYK A;  5EFH A;  5LI3 A;  5FUE A;  4RHQ A;  3Q9E A;  3TF3 A;  5EF7 A;  2A0M A;  3E6K A;  3SL0 A;  1HQF A;  2PLL A;  5G12 A;  4GSM A;  4RHM A;  3SL1 A;  3Q9C A;  4G3H A;  4GWC A;  3EZT A;  5EFG A;  3M1R A;  4FCI A;  4IU4 A;  1VKG A;  1GQ6 A;  5G10 A;  2EF4 A;  5DC7 A;  5G1A A;  1ZPE A;  4BKX B;  4QA6 A;  4CQF A;  4BZ6 A;  3PZL A;  3LP4 A;  3KV2 A;  3NIQ A;  3Q9F A;  5EFN A;  3E6V A;  5RLA A;  4LY1 A;  3SKK A;  5JI5 A;  5G3W A;  1RLA A;  4Q42 A;  4GSZ A;  2VQJ A;  5EEI A;  1WVB A;  3TH7 A;  3C0Y A;  5THS A;  3RQD A;  3EWF A;  4I06 A;  4Q40 A;  5G0I A;  1HQ5 A;  4QA4 A;  4ZUO A;  4RHL A;  3MZ4 A;  1WOH A;  2PHA A;  1T64 A;  4RN1 A;  5G1C A;  2VQV A;  2AEB A;  1T4P A;  1D3V A;  4ITY A;  3Q9B A;  3GMZ A;  5EFK B;  5EFJ D;  1GQ7 A;  5G0Y A;  5A2S A;  4MYL A;  3MAX A;  4ZUN A;  3MZ7 A;  5EEF A;  5DC6 A;  4QA0 A;  3EZP A;  5EEK A;  1T5G A;  3MMR A;  3DJ8 A;  4IE2 A;  4QA3 A;  5D1B A;  4BZ5 A;  3CEV A;  4HXQ A;  1C3S A;  4IE1 A;  3MJL A;  1ZZ1 A;  5THU A;  1C3R A;  1P8N A;  4IE3 A;  3F07 A;  4ZUR A;  4RHK A;  3NIP A;  4Q3R C;  3E8Z A;  1CEV A;  2V5X A;  2EIV A;  4RHI A;  3MFW A;  3E8Q A;  4ZUP A;  1HQG A;  4MYF A;  3RLA A;  3SFF A;  4BZ9 A;  2GH6 A;  4A69 A;  4CEV A;  4GSV A;  3MFV A;  4Q41 A;  3LP7 A;  1T4S A;  1W22 A;  4GWD A;  4Q3P A;  4Q3T A;  4RHJ A;  4RN0 A;  5EEM A;  5IX0 A;  4IU5 A;  2V5W A;  4BZ7 A;  5FCW A;  5G0X A; 
#chains in the Genus database with same CATH homology
 2VQW G;  5G1B A;  5G11 A;  4CBT A;  5DC5 A;  5G0J A;  2VCG A;  4QA2 A;  3MEN A;  2VQQ A;  5JI5 A;  5D1D A;  5G13 A;  3SFH A;  1T67 A;  5G17 A;  3C10 A;  1T69 A;  1ZZ0 A;  1C3P A;  3MZ3 A;  5D1C A;  3MZ6 A;  5EEN A;  5THT A;  2VQO A;  4QA7 A;  5DC8 A;  5IWG A;  4BZ8 A;  5ICN B;  5EF8 A;  1ZZ3 A;  4QA1 A;  4ZUQ A;  2VQM A;  4QA5 A;  3F06 A;  4ZUM A;  5THV A;  5G0H A;  4CBY A;  4RN2 A;  3C0Z A;  5BWZ A;  5EFB D;  4LXZ A;  5G0G A;  3ZNR A;  3ZNS A;  3EW8 A;  3F0R A;  5EFH A;  5LI3 A;  5FUE A;  3Q9E A;  5EF7 A;  5G12 A;  3Q9C A;  5EFG A;  3EZT A;  5G10 A;  1VKG A;  5DC7 A;  5G1A A;  4CQF A;  4BKX B;  4QA6 A;  4BZ6 A;  3Q9F A;  5EFN A;  4LY1 A;  5G3W A;  5EEI A;  2VQJ A;  3C0Y A;  5THS A;  3RQD A;  3EWF A;  5G0I A;  4QA4 A;  4ZUO A;  3MZ4 A;  1T64 A;  4RN1 A;  5G1C A;  2VQV A;  3Q9B A;  5EFK B;  5EFJ D;  5G0Y A;  5A2S A;  3MAX A;  4ZUN A;  3MZ7 A;  5EEF A;  5DC6 A;  4QA0 A;  3EZP A;  5EEK A;  4QA3 A;  5D1B A;  4BZ5 A;  1C3S A;  1ZZ1 A;  5THU A;  1C3R A;  3F07 A;  4ZUR A;  2V5X A;  4ZUP A;  3SFF A;  4BZ9 A;  2GH6 A;  4A69 A;  5IX0 A;  1W22 A;  4RN0 A;  5EEM A;  4BZ7 A;  2V5W A;  5FCW A;  5G0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...