5G0XA

Pseudomonas aeruginosa hdah bound to acetate.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
370
structure length
370
Chain Sequence
b'TRRTAFFFDELCLWHAAGPHALTLPVGGWVQPPAAAGHAESPETKRRLKSLLDVSGLTARLQLRSAPPASDEDLLRVHPAHYLERFKALSDAGGGSLGQDAPIGPGSYEIARLSAGLAIAALDAVLAGEADNAYSLSRPPGHHCLPDQAMGFCFFANIAVAIEAAKARHGVERVAVLDWDVHHGNGTQAIYYRRDDVLSISLHQDGCFPPGYSGAEDIGEDRGRGFNLNVPLLPGGGHDAYMQAMQRIVLPALERFRPQLIVVASGFDANAVDPLARMQLHSDSFRAMTAMVRDAAERHAGGRLVVVHEGGYSEAYVPFCGLAVIEELSGVRSAVRDPLRDFIELQQPNAAFRDFQRQRLEELAAQFGLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HDAH
publication title Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 142
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5g0xA00
5EF8A 3ZNRA 1C3SA 4QA4A 4QA0A 5G0HA 3Q9CA 5G0XA 2V5WA 1ZZ0A 3F07A 4LY1A 5EFNA 4BZ6A 5G12A 4RN1A 3SFFA 2VQJA 2GH6A 3MZ6A 2V5XA 2VQVA 3MZ4A 5IX0A 2VQOA 1T64A 5DC7A 5D1DA 3MAXA 5DC8A 4QA7A 5EFGA 2VQWG 3Q9EA 5G11A 2VQMA 5G0JA 4QA2A 5G0IA 2VQQA 5EEKA 5G13A 5IWGA 5FUEA 5D1BA 1W22A 5D1CA 5THVA 5THUA 5EFHA 3C0ZA 5JI5A 1ZZ1A 4CQFA 5THSA 5EFJD 3C10A 3EZTA 3F0RA 1ZZ3A 5DC5A 5G1CA 5DC6A 3MENA 3MZ7A 5EFKB 3SFHA 4CBYA 4ZUPA 3Q9FA 1VKGA 4A69A 4QA6A 4LXZA 3ZNSA 4RN0A 4BZ7A 4ZUNA 4BZ5A 5EF7A 5LI3A 4ZURA 5G0YA 3MZ3A 5G0GA 5ICNB 4RN2A 5EEFA 3RQDA 1C3RA 5EFBD 5BWZA 5EENA 5G10A 4QA5A 4ZUMA 5G1AA 5EEMA 4ZUQA 5EEIA 5THTA 5FCWA 1T69A 4BZ8A 1C3PA 5G17A 3EW8A 5G1BA 4ZUOA 5A2SA 5G3WA 4BZ9A 4QA1A 4QA3A 3C0YA 1T67A 4CBTA 3EWFA 3EZPA 3F06A 2VCGA 4BKXB 3Q9BA
chains in the Genus database with same CATH superfamily
5EF8A 2A0MA 3ZNRA 1P8PA 1C3SA 2ZAVA 3SKKA 4MYNA 4FCIA 4QA4A 4QA0A 5G0HA 3CEVA 1P8OA 3Q9CA 1WOIA 1D3VA 5G0XA 2V5WA 1ZZ0A 3SL1A 3E6KA 3F07A 1P8SA 4LY1A 4RHIA 5EFNA 4GWDA 4Q3QA 1P8MA 5G12A 4BZ6A 5HJAA 4RN1A 3SFFA 3M1RA 2EIVA 2VQJA 2GH6A 3MZ6A 3GMZA 2V5XA 2VQVA 2AEBA 3MZ4A 4Q3UA 5IX0A 2VQOA 3LP4A 1T64A 2CEVA 4Q3TA 5DC7A 5D1DA 3MAXA 4IU1A 2PHAA 3DJ8A 5DC8A 1GQ7A 2PLLA 3NIPA 4Q42A 4QA7A 5CEVA 5EFGA 2VQWG 3Q9EA 5G11A 2VQMA 1ZPGA 3MMRA 5G0JA 4GWCA 4QA2A 5G0IA 4HXQA 2VQQA 5EEKA 3LHLA 5G13A 5FUEA 5IWGA 5D1BA 1W22A 5D1CA 1WOGA 1TA1A 3SL0A 3TH7A 5THVA 1WOHA 4HZEA 5THUA 4BKXB 4Q3VA 5EFHA 4HWWA 1P8NA 4Q3SA 3C0ZA 4GSVA 1ZZ1A 1T4TA 5JI5A 2EF5A 4MYKA 4IE1A 4CQFA 5RLAA 5THSA 5EFJD 4Q40A 3C10A 3EZTA 3F0RA 4IXVA 4MXRA 1GQ6A 1TBLA 1ZZ3A 4RHLA 4RLAA 5DC5A 4GSZA 4IE3A 1T5FA 4CEVA 5G1CA 5DC6A 3LP7A 1WVAA 3TF3A 4RHJA 3MENA 3MZ7A 5EFKB 3SFHA 4CBYA 4Q3RC 1RLAA 4Q3RA 4RHQA 4ZUPA 3Q9FA 1VKGA 4IU0A 2PHOA 4QA6A 4A69A 3E8ZA 4LXZA 3ZNSA 1T4PA 4RN0A 4BZ7A 4RHMA 1ZPEA 3MFWA 4ZUNA 4RHKA 1PQ3A 3E6VA 4BZ5A 5EF7A 4MYFA 3THJA 1HQHA 5LI3A 3RLAA 4ZURA 5G0YA 1HQFA 3MZ3A 5G0GA 4ITYA 5ICNB 4RN2A 5EEFA 1HQXA 3MFVA 3RQDA 1P8QA 1C3RA 3KV2A 1TBHA 2EF4A 3GN0A 5EFBD 5BWZA 1R1OA 1T4RA 3E9BA 1T4SA 4IXUA 5EENA 5G10A 4QA5A 1HQGA 4MYLA 3NIOA 4ZUMA 4I06A 5EEMA 5G1AA 4ZUQA 4IU5A 4FCKA 5EEIA 5THTA 1WVBA 5FCWA 3THHA 1T69A 4G3HA 4BZ8A 1TBJA 3MJLA 3NIQA 3PZLA 1C3PA 5G17A 3E8QA 3EW8A 3SJTA 4DZ4A 5G1BA 4ZUOA 5A2SA 1XFKA 5G3WA 4Q3PA 5HJ9A 4IU4A 1P8RA 4BZ9A 4QA1A 4QA3A 2RLAA 3THEA 4IE2A 3C0YA 1T5GA 4GSMA 1T67A 4CBTA 3EWFA 3EZPA 3F06A 2VCGA 4Q41A 1HQ5A 1CEVA 3Q9BA 3F80A
chains in the Genus database with same CATH topology
5EF8A 3ZNRA 1C3SA 4QA4A 4QA0A 5G0HA 3Q9CA 5G0XA 2V5WA 1ZZ0A 3F07A 4LY1A 5EFNA 4BZ6A 5G12A 4RN1A 3SFFA 2VQJA 2GH6A 3MZ6A 2V5XA 2VQVA 3MZ4A 5IX0A 2VQOA 1T64A 5DC7A 5D1DA 3MAXA 5DC8A 4QA7A 5EFGA 2VQWG 3Q9EA 5G11A 2VQMA 5G0JA 4QA2A 5G0IA 2VQQA 5EEKA 5G13A 5IWGA 5FUEA 5D1BA 1W22A 5D1CA 5THVA 5THUA 5EFHA 3C0ZA 5JI5A 1ZZ1A 4CQFA 5THSA 5EFJD 3C10A 3EZTA 3F0RA 1ZZ3A 5DC5A 5G1CA 5DC6A 3MENA 3MZ7A 5EFKB 3SFHA 4CBYA 4ZUPA 3Q9FA 1VKGA 4A69A 4QA6A 4LXZA 3ZNSA 4RN0A 4BZ7A 4ZUNA 4BZ5A 5EF7A 5LI3A 4ZURA 5G0YA 3MZ3A 5G0GA 5ICNB 4RN2A 5EEFA 3RQDA 1C3RA 5EFBD 5BWZA 5EENA 5G10A 4QA5A 4ZUMA 5G1AA 5EEMA 4ZUQA 5EEIA 5THTA 5FCWA 1T69A 4BZ8A 1C3PA 5G17A 3EW8A 5G1BA 4ZUOA 5A2SA 5G3WA 4BZ9A 4QA1A 4QA3A 3C0YA 1T67A 4CBTA 3EWFA 3EZPA 3F06A 2VCGA 4BKXB 3Q9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EF8 A;  3ZNR A;  1C3S A;  4QA4 A;  4QA0 A;  5G0H A;  3Q9C A;  5G0X A;  2V5W A;  1ZZ0 A;  3F07 A;  4LY1 A;  5EFN A;  4BZ6 A;  5G12 A;  4RN1 A;  3SFF A;  2VQJ A;  2GH6 A;  3MZ6 A;  2V5X A;  2VQV A;  3MZ4 A;  5IX0 A;  2VQO A;  1T64 A;  5DC7 A;  5D1D A;  3MAX A;  5DC8 A;  4QA7 A;  5EFG A;  2VQW G;  3Q9E A;  5G11 A;  2VQM A;  5G0J A;  4QA2 A;  5G0I A;  2VQQ A;  5EEK A;  5G13 A;  5IWG A;  5FUE A;  5D1B A;  1W22 A;  5D1C A;  5THV A;  5THU A;  5EFH A;  3C0Z A;  5JI5 A;  1ZZ1 A;  4CQF A;  5THS A;  5EFJ D;  3C10 A;  3EZT A;  3F0R A;  1ZZ3 A;  5DC5 A;  5G1C A;  5DC6 A;  3MEN A;  3MZ7 A;  5EFK B;  3SFH A;  4CBY A;  4ZUP A;  3Q9F A;  1VKG A;  4A69 A;  4QA6 A;  4LXZ A;  3ZNS A;  4RN0 A;  4BZ7 A;  4ZUN A;  4BZ5 A;  5EF7 A;  5LI3 A;  4ZUR A;  5G0Y A;  3MZ3 A;  5G0G A;  5ICN B;  4RN2 A;  5EEF A;  3RQD A;  1C3R A;  5EFB D;  5BWZ A;  5EEN A;  5G10 A;  4QA5 A;  4ZUM A;  5G1A A;  5EEM A;  4ZUQ A;  5EEI A;  5THT A;  5FCW A;  1T69 A;  4BZ8 A;  1C3P A;  5G17 A;  3EW8 A;  5G1B A;  4ZUO A;  5A2S A;  5G3W A;  4BZ9 A;  4QA1 A;  4QA3 A;  3C0Y A;  1T67 A;  4CBT A;  3EWF A;  3EZP A;  3F06 A;  2VCG A;  4BKX B;  3Q9B A; 
#chains in the Genus database with same CATH topology
 5EF8 A;  2A0M A;  3ZNR A;  1P8P A;  1C3S A;  2ZAV A;  3SKK A;  4MYN A;  4FCI A;  4QA4 A;  4QA0 A;  5G0H A;  3CEV A;  1P8O A;  3Q9C A;  1WOI A;  1D3V A;  5G0X A;  2V5W A;  1ZZ0 A;  3SL1 A;  3E6K A;  3F07 A;  1P8S A;  4LY1 A;  4RHI A;  5EFN A;  4GWD A;  4Q3Q A;  1P8M A;  5G12 A;  4BZ6 A;  5HJA A;  4RN1 A;  3SFF A;  3M1R A;  2EIV A;  2VQJ A;  2GH6 A;  3MZ6 A;  3GMZ A;  2V5X A;  2VQV A;  2AEB A;  3MZ4 A;  4Q3U A;  5IX0 A;  2VQO A;  3LP4 A;  1T64 A;  2CEV A;  4Q3T A;  5DC7 A;  5D1D A;  3MAX A;  4IU1 A;  2PHA A;  3DJ8 A;  5DC8 A;  1GQ7 A;  2PLL A;  3NIP A;  4Q42 A;  4QA7 A;  5CEV A;  5EFG A;  2VQW G;  3Q9E A;  5G11 A;  2VQM A;  1ZPG A;  3MMR A;  5G0J A;  4GWC A;  4QA2 A;  5G0I A;  4HXQ A;  2VQQ A;  5EEK A;  3LHL A;  5G13 A;  5FUE A;  5IWG A;  5D1B A;  1W22 A;  5D1C A;  1WOG A;  1TA1 A;  3SL0 A;  3TH7 A;  5THV A;  1WOH A;  4HZE A;  5THU A;  4BKX B;  4Q3V A;  5EFH A;  4HWW A;  1P8N A;  4Q3S A;  3C0Z A;  4GSV A;  1ZZ1 A;  1T4T A;  5JI5 A;  2EF5 A;  4MYK A;  4IE1 A;  4CQF A;  5RLA A;  5THS A;  5EFJ D;  4Q40 A;  3C10 A;  3EZT A;  3F0R A;  4IXV A;  4MXR A;  1GQ6 A;  1TBL A;  1ZZ3 A;  4RHL A;  4RLA A;  5DC5 A;  4GSZ A;  4IE3 A;  1T5F A;  4CEV A;  5G1C A;  5DC6 A;  3LP7 A;  1WVA A;  3TF3 A;  4RHJ A;  3MEN A;  3MZ7 A;  5EFK B;  3SFH A;  4CBY A;  4Q3R C;  1RLA A;  4Q3R A;  4RHQ A;  4ZUP A;  3Q9F A;  1VKG A;  4IU0 A;  2PHO A;  4QA6 A;  4A69 A;  3E8Z A;  4LXZ A;  3ZNS A;  1T4P A;  4RN0 A;  4BZ7 A;  4RHM A;  1ZPE A;  3MFW A;  4ZUN A;  4RHK A;  1PQ3 A;  3E6V A;  4BZ5 A;  5EF7 A;  4MYF A;  3THJ A;  1HQH A;  5LI3 A;  3RLA A;  4ZUR A;  5G0Y A;  1HQF A;  3MZ3 A;  5G0G A;  4ITY A;  5ICN B;  4RN2 A;  5EEF A;  1HQX A;  3MFV A;  3RQD A;  1P8Q A;  1C3R A;  3KV2 A;  1TBH A;  2EF4 A;  3GN0 A;  5EFB D;  5BWZ A;  1R1O A;  1T4R A;  3E9B A;  1T4S A;  4IXU A;  5EEN A;  5G10 A;  4QA5 A;  1HQG A;  4MYL A;  3NIO A;  4ZUM A;  4I06 A;  5EEM A;  5G1A A;  4ZUQ A;  4IU5 A;  4FCK A;  5EEI A;  5THT A;  1WVB A;  5FCW A;  3THH A;  1T69 A;  4G3H A;  4BZ8 A;  1TBJ A;  3MJL A;  3NIQ A;  3PZL A;  1C3P A;  5G17 A;  3E8Q A;  3EW8 A;  3SJT A;  4DZ4 A;  5G1B A;  4ZUO A;  5A2S A;  1XFK A;  5G3W A;  4Q3P A;  5HJ9 A;  4IU4 A;  1P8R A;  4BZ9 A;  4QA1 A;  4QA3 A;  2RLA A;  3THE A;  4IE2 A;  3C0Y A;  1T5G A;  4GSM A;  1T67 A;  4CBT A;  3EWF A;  3EZP A;  3F06 A;  2VCG A;  4Q41 A;  1HQ5 A;  1CEV A;  3Q9B A;  3F80 A; 
#chains in the Genus database with same CATH homology
 5EF8 A;  3ZNR A;  1C3S A;  4QA4 A;  4QA0 A;  5G0H A;  3Q9C A;  5G0X A;  2V5W A;  1ZZ0 A;  3F07 A;  4LY1 A;  5EFN A;  4BZ6 A;  5G12 A;  4RN1 A;  3SFF A;  2VQJ A;  2GH6 A;  3MZ6 A;  2V5X A;  2VQV A;  3MZ4 A;  5IX0 A;  2VQO A;  1T64 A;  5DC7 A;  5D1D A;  3MAX A;  5DC8 A;  4QA7 A;  5EFG A;  2VQW G;  3Q9E A;  5G11 A;  2VQM A;  5G0J A;  4QA2 A;  5G0I A;  2VQQ A;  5EEK A;  5G13 A;  5IWG A;  5FUE A;  5D1B A;  1W22 A;  5D1C A;  5THV A;  5THU A;  5EFH A;  3C0Z A;  5JI5 A;  1ZZ1 A;  4CQF A;  5THS A;  5EFJ D;  3C10 A;  3EZT A;  3F0R A;  1ZZ3 A;  5DC5 A;  5G1C A;  5DC6 A;  3MEN A;  3MZ7 A;  5EFK B;  3SFH A;  4CBY A;  4ZUP A;  3Q9F A;  1VKG A;  4A69 A;  4QA6 A;  4LXZ A;  3ZNS A;  4RN0 A;  4BZ7 A;  4ZUN A;  4BZ5 A;  5EF7 A;  5LI3 A;  4ZUR A;  5G0Y A;  3MZ3 A;  5G0G A;  5ICN B;  4RN2 A;  5EEF A;  3RQD A;  1C3R A;  5EFB D;  5BWZ A;  5EEN A;  5G10 A;  4QA5 A;  4ZUM A;  5G1A A;  5EEM A;  4ZUQ A;  5EEI A;  5THT A;  5FCW A;  1T69 A;  4BZ8 A;  1C3P A;  5G17 A;  3EW8 A;  5G1B A;  4ZUO A;  5A2S A;  5G3W A;  4BZ9 A;  4QA1 A;  4QA3 A;  3C0Y A;  1T67 A;  4CBT A;  3EWF A;  3EZP A;  3F06 A;  2VCG A;  4BKX B;  3Q9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...