2AEBA

Crystal structure of human arginase i at 1.29 a resolution and exploration of inhibition in immune response.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Crystal structure of human arginase I at 1.29 A resolution and exploration of inhibition in the immune response.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 106
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 2aebA00
3THEA 2PHAA 4IE1A 1P8QA 1WOGA 1XFKA 1WOIA 3MFWA 2EF4A 4GWDA 3NIPA 4DZ4A 4RLAA 3PZLA 1HQXA 1RLAA 1HQFA 5CEVA 3THHA 1WVAA 1P8MA 3NIOA 3SL1A 2AEBA 4RHKA 2ZAVA 3LP7A 1T4PA 3TF3A 4G3HA 2RLAA 1HQGA 1HQ5A 4IE3A 2PHOA 2EIVA 4Q40A 1TBJA 5RLAA 4IE2A 1T5GA 5HJ9A 1WVBA 1GQ6A 4IU5A 1P8PA 3E6VA 1TA1A 3GMZA 4CEVA 4HXQA 3F80A 4RHQA 4FCIA 3MFVA 4Q3QA 4Q3SA 1T4TA 3LP4A 4HZEA 4Q3RA 1P8OA 4IXUA 4GWCA 4RHLA 4Q3UA 1GQ7A 4IU0A 3SJTA 3SL0A 4MYKA 1T5FA 4MXRA 3M1RA 3E8ZA 4IU4A 2CEVA 3E6KA 3TH7A 3RLAA 4Q41A 1T4RA 3MJLA 1HQHA 1ZPGA 4HWWA 4Q42A 4GSZA 3THJA 4GSVA 4RHMA 4Q3PA 3SKKA 4ITYA 4I06A 1TBLA 3KV2A 3E8QA 3MMRA 2A0MA 4MYLA 2PLLA 3CEVA 1D3VA 1ZPEA 1R1OA 4MYNA 4Q3VA 4RHJA 1P8SA 4IU1A 3NIQA 3DJ8A 1WOHA 3E9BA 4FCKA 1TBHA 4RHIA 1T4SA 1P8NA 1P8RA 3GN0A 4Q3RC 1CEVA 4MYFA 4IXVA 4Q3TA 5HJAA 2EF5A 4GSMA 3LHLA 1PQ3A
chains in the Genus database with same CATH superfamily
5FCWA 3THEA 2PHAA 5BWZA 4RN1A 5EFBD 3LHLA 3C0YA 1C3SA 4IE1A 5EFJD 1P8QA 1WOGA 1XFKA 1WOIA 4ZUQA 3MFWA 5LI3A 2EF4A 4GWDA 4BZ8A 4QA5A 5THUA 3MZ4A 5EFNA 3NIPA 4DZ4A 4RLAA 5D1DA 3PZLA 1HQXA 4ZUPA 2VCGA 1HQFA 1RLAA 4BZ7A 5CEVA 1ZZ3A 4BZ9A 3THHA 5EFGA 1WVAA 1P8MA 1W22A 2VQMA 5EF7A 5D1BA 3F0RA 3NIOA 5A2SA 3Q9FA 3SL1A 2AEBA 4GSMA 3EWFA 4QA1A 4RHKA 5G1BA 2ZAVA 3LP7A 4QA0A 5IWGA 1T4PA 5G0YA 3EZPA 4A69A 4CQFA 3TF3A 5THVA 2RLAA 4G3HA 3MAXA 1HQGA 1T64A 3MENA 3F07A 1HQ5A 2V5XA 4IE3A 3EZTA 2PHOA 2EIVA 4BZ5A 3C10A 4Q40A 1TBJA 5G0GA 4IE2A 5RLAA 1T5GA 3Q9BA 5HJ9A 1WVBA 1GQ6A 4IU5A 1P8PA 3E6VA 5DC5A 1TA1A 5EEIA 1T69A 3GMZA 5JI5A 4CEVA 3ZNSA 4HXQA 3F80A 4ZUOA 4RHQA 4FCIA 5G1CA 3EW8A 5EEFA 2VQJA 3MFVA 4Q3QA 4Q3SA 5G12A 1T4TA 3LP4A 5D1CA 5THTA 4LY1A 5G13A 4QA3A 4HZEA 4LXZA 4Q3RA 1P8OA 2VQQA 4ZURA 4IXUA 1C3RA 4GWCA 3SFFA 5EEKA 4RHLA 4Q3UA 2V5WA 1GQ7A 4QA6A 5G0JA 4IU0A 4BKXB 5G0HA 3SJTA 3SL0A 2VQWG 3F06A 4MYKA 4RN2A 5DC6A 5G1AA 3ZNRA 5G11A 5G3WA 1T5FA 3Q9CA 2VQOA 5EFHA 4ZUMA 4MXRA 3M1RA 1C3PA 2GH6A 3E8ZA 5G10A 4IU4A 2CEVA 3E6KA 3TH7A 5EENA 3RLAA 4Q41A 4ZUNA 1T4RA 3MJLA 5EF8A 4CBYA 1HQHA 1ZPGA 4HWWA 4Q42A 4QA4A 4GSZA 3THJA 3MZ6A 4GSVA 5EEMA 4RHMA 4Q3PA 4BZ6A 3SKKA 4ITYA 4RN0A 4I06A 5DC8A 1TBLA 1VKGA 5ICNB 5DC7A 3KV2A 3MZ7A 3SFHA 4QA2A 3E8QA 3MMRA 5EFKB 2A0MA 4MYLA 2VQVA 2PLLA 3CEVA 1D3VA 1ZPEA 1R1OA 4MYNA 5THSA 4Q3VA 4QA7A 4RHJA 1ZZ1A 1P8SA 4IU1A 3NIQA 3DJ8A 1WOHA 3E9BA 3Q9EA 5FUEA 5IX0A 4FCKA 1TBHA 4RHIA 1T4SA 3RQDA 4CBTA 5G0XA 3MZ3A 1P8RA 3GN0A 4Q3RC 1CEVA 4MYFA 1T67A 4IXVA 4Q3TA 5HJAA 1ZZ0A 2EF5A 5G0IA 3C0ZA 1P8NA 5G17A 1PQ3A
chains in the Genus database with same CATH topology
3THEA 2PHAA 4IE1A 1P8QA 1WOGA 1XFKA 1WOIA 3MFWA 2EF4A 4GWDA 3NIPA 4DZ4A 4RLAA 3PZLA 1HQXA 1RLAA 1HQFA 5CEVA 3THHA 1WVAA 1P8MA 3NIOA 3SL1A 2AEBA 4RHKA 2ZAVA 3LP7A 1T4PA 3TF3A 4G3HA 2RLAA 1HQGA 1HQ5A 4IE3A 2PHOA 2EIVA 4Q40A 1TBJA 5RLAA 4IE2A 1T5GA 5HJ9A 1WVBA 1GQ6A 4IU5A 1P8PA 3E6VA 1TA1A 3GMZA 4CEVA 4HXQA 3F80A 4RHQA 4FCIA 3MFVA 4Q3QA 4Q3SA 1T4TA 3LP4A 4HZEA 4Q3RA 1P8OA 4IXUA 4GWCA 4RHLA 4Q3UA 1GQ7A 4IU0A 3SJTA 3SL0A 4MYKA 1T5FA 4MXRA 3M1RA 3E8ZA 4IU4A 2CEVA 3E6KA 3TH7A 3RLAA 4Q41A 1T4RA 3MJLA 1HQHA 1ZPGA 4HWWA 4Q42A 4GSZA 3THJA 4GSVA 4RHMA 4Q3PA 3SKKA 4ITYA 4I06A 1TBLA 3KV2A 3E8QA 3MMRA 2A0MA 4MYLA 2PLLA 3CEVA 1D3VA 1ZPEA 1R1OA 4MYNA 4Q3VA 4RHJA 1P8SA 4IU1A 3NIQA 3DJ8A 1WOHA 3E9BA 4FCKA 1TBHA 4RHIA 1T4SA 1P8NA 1P8RA 3GN0A 4Q3RC 1CEVA 4MYFA 4IXVA 4Q3TA 5HJAA 2EF5A 4GSMA 3LHLA 1PQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THE A;  2PHA A;  4IE1 A;  1P8Q A;  1WOG A;  1XFK A;  1WOI A;  3MFW A;  2EF4 A;  4GWD A;  3NIP A;  4DZ4 A;  4RLA A;  3PZL A;  1HQX A;  1RLA A;  1HQF A;  5CEV A;  3THH A;  1WVA A;  1P8M A;  3NIO A;  3SL1 A;  2AEB A;  4RHK A;  2ZAV A;  3LP7 A;  1T4P A;  3TF3 A;  4G3H A;  2RLA A;  1HQG A;  1HQ5 A;  4IE3 A;  2PHO A;  2EIV A;  4Q40 A;  1TBJ A;  5RLA A;  4IE2 A;  1T5G A;  5HJ9 A;  1WVB A;  1GQ6 A;  4IU5 A;  1P8P A;  3E6V A;  1TA1 A;  3GMZ A;  4CEV A;  4HXQ A;  3F80 A;  4RHQ A;  4FCI A;  3MFV A;  4Q3Q A;  4Q3S A;  1T4T A;  3LP4 A;  4HZE A;  4Q3R A;  1P8O A;  4IXU A;  4GWC A;  4RHL A;  4Q3U A;  1GQ7 A;  4IU0 A;  3SJT A;  3SL0 A;  4MYK A;  1T5F A;  4MXR A;  3M1R A;  3E8Z A;  4IU4 A;  2CEV A;  3E6K A;  3TH7 A;  3RLA A;  4Q41 A;  1T4R A;  3MJL A;  1HQH A;  1ZPG A;  4HWW A;  4Q42 A;  4GSZ A;  3THJ A;  4GSV A;  4RHM A;  4Q3P A;  3SKK A;  4ITY A;  4I06 A;  1TBL A;  3KV2 A;  3E8Q A;  3MMR A;  2A0M A;  4MYL A;  2PLL A;  3CEV A;  1D3V A;  1ZPE A;  1R1O A;  4MYN A;  4Q3V A;  4RHJ A;  1P8S A;  4IU1 A;  3NIQ A;  3DJ8 A;  1WOH A;  3E9B A;  4FCK A;  1TBH A;  4RHI A;  1T4S A;  1P8N A;  1P8R A;  3GN0 A;  4Q3R C;  1CEV A;  4MYF A;  4IXV A;  4Q3T A;  5HJA A;  2EF5 A;  4GSM A;  3LHL A;  1PQ3 A; 
#chains in the Genus database with same CATH topology
 5FCW A;  3THE A;  2PHA A;  5BWZ A;  4RN1 A;  5EFB D;  3LHL A;  3C0Y A;  1C3S A;  4IE1 A;  5EFJ D;  1P8Q A;  1WOG A;  1XFK A;  1WOI A;  4ZUQ A;  3MFW A;  5LI3 A;  2EF4 A;  4GWD A;  4BZ8 A;  4QA5 A;  5THU A;  3MZ4 A;  5EFN A;  3NIP A;  4DZ4 A;  4RLA A;  5D1D A;  3PZL A;  1HQX A;  4ZUP A;  2VCG A;  1HQF A;  1RLA A;  4BZ7 A;  5CEV A;  1ZZ3 A;  4BZ9 A;  3THH A;  5EFG A;  1WVA A;  1P8M A;  1W22 A;  2VQM A;  5EF7 A;  5D1B A;  3F0R A;  3NIO A;  5A2S A;  3Q9F A;  3SL1 A;  2AEB A;  4GSM A;  3EWF A;  4QA1 A;  4RHK A;  5G1B A;  2ZAV A;  3LP7 A;  4QA0 A;  5IWG A;  1T4P A;  5G0Y A;  3EZP A;  4A69 A;  4CQF A;  3TF3 A;  5THV A;  2RLA A;  4G3H A;  3MAX A;  1HQG A;  1T64 A;  3MEN A;  3F07 A;  1HQ5 A;  2V5X A;  4IE3 A;  3EZT A;  2PHO A;  2EIV A;  4BZ5 A;  3C10 A;  4Q40 A;  1TBJ A;  5G0G A;  4IE2 A;  5RLA A;  1T5G A;  3Q9B A;  5HJ9 A;  1WVB A;  1GQ6 A;  4IU5 A;  1P8P A;  3E6V A;  5DC5 A;  1TA1 A;  5EEI A;  1T69 A;  3GMZ A;  5JI5 A;  4CEV A;  3ZNS A;  4HXQ A;  3F80 A;  4ZUO A;  4RHQ A;  4FCI A;  5G1C A;  3EW8 A;  5EEF A;  2VQJ A;  3MFV A;  4Q3Q A;  4Q3S A;  5G12 A;  1T4T A;  3LP4 A;  5D1C A;  5THT A;  4LY1 A;  5G13 A;  4QA3 A;  4HZE A;  4LXZ A;  4Q3R A;  1P8O A;  2VQQ A;  4ZUR A;  4IXU A;  1C3R A;  4GWC A;  3SFF A;  5EEK A;  4RHL A;  4Q3U A;  2V5W A;  1GQ7 A;  4QA6 A;  5G0J A;  4IU0 A;  4BKX B;  5G0H A;  3SJT A;  3SL0 A;  2VQW G;  3F06 A;  4MYK A;  4RN2 A;  5DC6 A;  5G1A A;  3ZNR A;  5G11 A;  5G3W A;  1T5F A;  3Q9C A;  2VQO A;  5EFH A;  4ZUM A;  4MXR A;  3M1R A;  1C3P A;  2GH6 A;  3E8Z A;  5G10 A;  4IU4 A;  2CEV A;  3E6K A;  3TH7 A;  5EEN A;  3RLA A;  4Q41 A;  4ZUN A;  1T4R A;  3MJL A;  5EF8 A;  4CBY A;  1HQH A;  1ZPG A;  4HWW A;  4Q42 A;  4QA4 A;  4GSZ A;  3THJ A;  3MZ6 A;  4GSV A;  5EEM A;  4RHM A;  4Q3P A;  4BZ6 A;  3SKK A;  4ITY A;  4RN0 A;  4I06 A;  5DC8 A;  1TBL A;  1VKG A;  5ICN B;  5DC7 A;  3KV2 A;  3MZ7 A;  3SFH A;  4QA2 A;  3E8Q A;  3MMR A;  5EFK B;  2A0M A;  4MYL A;  2VQV A;  2PLL A;  3CEV A;  1D3V A;  1ZPE A;  1R1O A;  4MYN A;  5THS A;  4Q3V A;  4QA7 A;  4RHJ A;  1ZZ1 A;  1P8S A;  4IU1 A;  3NIQ A;  3DJ8 A;  1WOH A;  3E9B A;  3Q9E A;  5FUE A;  5IX0 A;  4FCK A;  1TBH A;  4RHI A;  1T4S A;  3RQD A;  4CBT A;  5G0X A;  3MZ3 A;  1P8R A;  3GN0 A;  4Q3R C;  1CEV A;  4MYF A;  1T67 A;  4IXV A;  4Q3T A;  5HJA A;  1ZZ0 A;  2EF5 A;  5G0I A;  3C0Z A;  1P8N A;  5G17 A;  1PQ3 A; 
#chains in the Genus database with same CATH homology
 3THE A;  2PHA A;  4IE1 A;  1P8Q A;  1WOG A;  1XFK A;  1WOI A;  3MFW A;  2EF4 A;  4GWD A;  3NIP A;  4DZ4 A;  4RLA A;  3PZL A;  1HQX A;  1RLA A;  1HQF A;  5CEV A;  3THH A;  1WVA A;  1P8M A;  3NIO A;  3SL1 A;  2AEB A;  4RHK A;  2ZAV A;  3LP7 A;  1T4P A;  3TF3 A;  4G3H A;  2RLA A;  1HQG A;  1HQ5 A;  4IE3 A;  2PHO A;  2EIV A;  4Q40 A;  1TBJ A;  5RLA A;  4IE2 A;  1T5G A;  5HJ9 A;  1WVB A;  1GQ6 A;  4IU5 A;  1P8P A;  3E6V A;  1TA1 A;  3GMZ A;  4CEV A;  4HXQ A;  3F80 A;  4RHQ A;  4FCI A;  3MFV A;  4Q3Q A;  4Q3S A;  1T4T A;  3LP4 A;  4HZE A;  4Q3R A;  1P8O A;  4IXU A;  4GWC A;  4RHL A;  4Q3U A;  1GQ7 A;  4IU0 A;  3SJT A;  3SL0 A;  4MYK A;  1T5F A;  4MXR A;  3M1R A;  3E8Z A;  4IU4 A;  2CEV A;  3E6K A;  3TH7 A;  3RLA A;  4Q41 A;  1T4R A;  3MJL A;  1HQH A;  1ZPG A;  4HWW A;  4Q42 A;  4GSZ A;  3THJ A;  4GSV A;  4RHM A;  4Q3P A;  3SKK A;  4ITY A;  4I06 A;  1TBL A;  3KV2 A;  3E8Q A;  3MMR A;  2A0M A;  4MYL A;  2PLL A;  3CEV A;  1D3V A;  1ZPE A;  1R1O A;  4MYN A;  4Q3V A;  4RHJ A;  1P8S A;  4IU1 A;  3NIQ A;  3DJ8 A;  1WOH A;  3E9B A;  4FCK A;  1TBH A;  4RHI A;  1T4S A;  1P8N A;  1P8R A;  3GN0 A;  4Q3R C;  1CEV A;  4MYF A;  4IXV A;  4Q3T A;  5HJA A;  2EF5 A;  4GSM A;  3LHL A;  1PQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...