2AEBA

Crystal structure of human arginase i at 1.29 a resolution and exploration of inhibition in immune response.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
b'SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Crystal structure of human arginase I at 1.29 A resolution and exploration of inhibition in the immune response.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 106
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 2aebA00
1P8RA 4I06A 1P8NA 1T4PA 3CEVA 4IU0A 1PQ3A 4ITYA 2AEBA 1R1OA 3MFVA 4GSVA 5HJAA 3GN0A 1P8MA 3E6VA 4IXUA 1HQFA 1RLAA 3SKKA 1WOIA 1HQXA 3THEA 4HZEA 1P8QA 3SJTA 4RHMA 3E8QA 1XFKA 1ZPEA 4MYLA 3M1RA 2EF4A 1T5GA 4IU1A 3GMZA 4CEVA 4GSZA 3SL1A 2EIVA 4Q3RA 4IXVA 3TH7A 3E9BA 1HQ5A 1P8SA 2ZAVA 1HQHA 2PLLA 3DJ8A 4IU5A 4Q40A 1CEVA 4GWDA 4IE1A 3RLAA 4FCKA 1HQGA 1P8OA 4RHQA 4Q3SA 2PHAA 3NIOA 4IU4A 4HXQA 4Q3UA 3LHLA 4GSMA 1GQ7A 1P8PA 4MXRA 1D3VA 4RHIA 4Q3RC 4Q3PA 4MYNA 4RHKA 4RHLA 2EF5A 3LP4A 4RHJA 3THJA 3NIPA 4FCIA 3THHA 3KV2A 3MMRA 4Q41A 1T4TA 1WVBA 3E6KA 4G3HA 4RLAA 1WVAA 2A0MA 4Q42A 1TA1A 3SL0A 4MYKA 4MYFA 4Q3TA 4Q3QA 3MJLA 1T4RA 3F80A 2CEVA 3LP7A 4Q3VA 2PHOA 1WOGA 5RLAA 5HJ9A 5CEVA 1WOHA 1ZPGA 4HWWA 1T4SA 4DZ4A 3PZLA 2RLAA 1TBHA 1GQ6A 4IE3A 1T5FA 3E8ZA 1TBJA 3NIQA 4IE2A 3TF3A 4GWCA 1TBLA 3MFWA
chains in the Genus database with same CATH superfamily
4BZ9A 1P8RA 4I06A 1P8NA 5EEKA 1T4PA 4LXZA 3CEVA 4IU0A 5DC6A 3EZTA 4QA3A 3C0YA 1PQ3A 4ZUQA 4ITYA 5EFGA 5EENA 1ZZ3A 5G10A 4BZ5A 5A2SA 2AEBA 3MAXA 1R1OA 3MFVA 5EF7A 3F0RA 4GSVA 5G0HA 5HJAA 5ICNB 2VQOA 3GN0A 1P8MA 3E6VA 4IXUA 1HQFA 5G0XA 1RLAA 3SKKA 1WOIA 1T69A 1HQXA 1T67A 3THEA 4RN2A 4ZUOA 4HZEA 4A69A 4ZURA 1C3PA 1P8QA 3SJTA 4RHMA 3E8QA 1XFKA 1ZPEA 4MYLA 2EF4A 3M1RA 4RN1A 5FCWA 5FUEA 1T5GA 5THTA 4IU1A 3GMZA 4QA5A 5EFHA 2V5XA 5EFKB 4CEVA 3EWFA 4GSZA 5EFNA 5EEIA 3MZ4A 1C3SA 3SL1A 2EIVA 4ZUMA 4ZUNA 4Q3RA 4IXVA 3TH7A 4BKXB 2VQWG 1HQ5A 1P8SA 3E9BA 5DC8A 3C0ZA 2ZAVA 1HQHA 2VQMA 2PLLA 3DJ8A 4IU5A 3Q9EA 5G1BA 4Q40A 1CEVA 2V5WA 4GWDA 3MENA 3MZ6A 4BZ7A 3EW8A 3F06A 4IE1A 3RLAA 5LI3A 4FCKA 3EZPA 5D1CA 5IWGA 5G17A 1VKGA 1HQGA 1P8OA 2VQQA 3C10A 4RHQA 5DC5A 4QA6A 4Q3SA 2PHAA 3NIOA 4IU4A 4HXQA 4Q3UA 3LHLA 4GSMA 1GQ7A 3SFFA 1C3RA 1P8PA 3ZNRA 4BZ6A 4MXRA 1D3VA 4RHIA 5G11A 4Q3RC 4Q3PA 4LY1A 3RQDA 4MYNA 4RHKA 4CBYA 4RHLA 3ZNSA 2EF5A 5G0IA 3F07A 5THVA 3LP4A 4RHJA 3THJA 5EFJD 3NIPA 2VCGA 5G1AA 5G0YA 4CBTA 4FCIA 3THHA 1W22A 3KV2A 3MMRA 2GH6A 5G0GA 2VQVA 4CQFA 4Q41A 5G3WA 1T4TA 1WVBA 3E6KA 5EEFA 5THUA 5G12A 4G3HA 4RLAA 3Q9BA 1WVAA 3SFHA 5D1BA 2A0MA 4Q42A 1TA1A 3SL0A 4MYKA 4QA1A 4MYFA 4Q3TA 5EEMA 4Q3QA 3MJLA 4ZUPA 1T4RA 5D1DA 3F80A 2CEVA 3LP7A 4QA7A 5DC7A 3Q9FA 5G1CA 4Q3VA 5BWZA 2PHOA 3MZ7A 1ZZ0A 4BZ8A 2VQJA 3MZ3A 1WOGA 5RLAA 5HJ9A 5CEVA 1WOHA 1ZZ1A 5IX0A 1ZPGA 4HWWA 4RN0A 5G13A 1T4SA 4DZ4A 3PZLA 4QA2A 2RLAA 1TBHA 4QA4A 5THSA 1GQ6A 4IE3A 1T5FA 3E8ZA 1T64A 1TBJA 3NIQA 4IE2A 5EF8A 5EFBD 3Q9CA 5G0JA 5JI5A 3TF3A 4GWCA 1TBLA 3MFWA 4QA0A
chains in the Genus database with same CATH topology
1P8RA 4I06A 1P8NA 1T4PA 3CEVA 4IU0A 1PQ3A 4ITYA 2AEBA 1R1OA 3MFVA 4GSVA 5HJAA 3GN0A 1P8MA 3E6VA 4IXUA 1HQFA 1RLAA 3SKKA 1WOIA 1HQXA 3THEA 4HZEA 1P8QA 3SJTA 4RHMA 3E8QA 1XFKA 1ZPEA 4MYLA 3M1RA 2EF4A 1T5GA 4IU1A 3GMZA 4CEVA 4GSZA 3SL1A 2EIVA 4Q3RA 4IXVA 3TH7A 3E9BA 1HQ5A 1P8SA 2ZAVA 1HQHA 2PLLA 3DJ8A 4IU5A 4Q40A 1CEVA 4GWDA 4IE1A 3RLAA 4FCKA 1HQGA 1P8OA 4RHQA 4Q3SA 2PHAA 3NIOA 4IU4A 4HXQA 4Q3UA 3LHLA 4GSMA 1GQ7A 1P8PA 4MXRA 1D3VA 4RHIA 4Q3RC 4Q3PA 4MYNA 4RHKA 4RHLA 2EF5A 3LP4A 4RHJA 3THJA 3NIPA 4FCIA 3THHA 3KV2A 3MMRA 4Q41A 1T4TA 1WVBA 3E6KA 4G3HA 4RLAA 1WVAA 2A0MA 4Q42A 1TA1A 3SL0A 4MYKA 4MYFA 4Q3TA 4Q3QA 3MJLA 1T4RA 3F80A 2CEVA 3LP7A 4Q3VA 2PHOA 1WOGA 5RLAA 5HJ9A 5CEVA 1WOHA 1ZPGA 4HWWA 1T4SA 4DZ4A 3PZLA 2RLAA 1TBHA 1GQ6A 4IE3A 1T5FA 3E8ZA 1TBJA 3NIQA 4IE2A 3TF3A 4GWCA 1TBLA 3MFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8R A;  4I06 A;  1P8N A;  1T4P A;  3CEV A;  4IU0 A;  1PQ3 A;  4ITY A;  2AEB A;  1R1O A;  3MFV A;  4GSV A;  5HJA A;  3GN0 A;  1P8M A;  3E6V A;  4IXU A;  1HQF A;  1RLA A;  3SKK A;  1WOI A;  1HQX A;  3THE A;  4HZE A;  1P8Q A;  3SJT A;  4RHM A;  3E8Q A;  1XFK A;  1ZPE A;  4MYL A;  3M1R A;  2EF4 A;  1T5G A;  4IU1 A;  3GMZ A;  4CEV A;  4GSZ A;  3SL1 A;  2EIV A;  4Q3R A;  4IXV A;  3TH7 A;  3E9B A;  1HQ5 A;  1P8S A;  2ZAV A;  1HQH A;  2PLL A;  3DJ8 A;  4IU5 A;  4Q40 A;  1CEV A;  4GWD A;  4IE1 A;  3RLA A;  4FCK A;  1HQG A;  1P8O A;  4RHQ A;  4Q3S A;  2PHA A;  3NIO A;  4IU4 A;  4HXQ A;  4Q3U A;  3LHL A;  4GSM A;  1GQ7 A;  1P8P A;  4MXR A;  1D3V A;  4RHI A;  4Q3R C;  4Q3P A;  4MYN A;  4RHK A;  4RHL A;  2EF5 A;  3LP4 A;  4RHJ A;  3THJ A;  3NIP A;  4FCI A;  3THH A;  3KV2 A;  3MMR A;  4Q41 A;  1T4T A;  1WVB A;  3E6K A;  4G3H A;  4RLA A;  1WVA A;  2A0M A;  4Q42 A;  1TA1 A;  3SL0 A;  4MYK A;  4MYF A;  4Q3T A;  4Q3Q A;  3MJL A;  1T4R A;  3F80 A;  2CEV A;  3LP7 A;  4Q3V A;  2PHO A;  1WOG A;  5RLA A;  5HJ9 A;  5CEV A;  1WOH A;  1ZPG A;  4HWW A;  1T4S A;  4DZ4 A;  3PZL A;  2RLA A;  1TBH A;  1GQ6 A;  4IE3 A;  1T5F A;  3E8Z A;  1TBJ A;  3NIQ A;  4IE2 A;  3TF3 A;  4GWC A;  1TBL A;  3MFW A; 
#chains in the Genus database with same CATH topology
 4BZ9 A;  1P8R A;  4I06 A;  1P8N A;  5EEK A;  1T4P A;  4LXZ A;  3CEV A;  4IU0 A;  5DC6 A;  3EZT A;  4QA3 A;  3C0Y A;  1PQ3 A;  4ZUQ A;  4ITY A;  5EFG A;  5EEN A;  1ZZ3 A;  5G10 A;  4BZ5 A;  5A2S A;  2AEB A;  3MAX A;  1R1O A;  3MFV A;  5EF7 A;  3F0R A;  4GSV A;  5G0H A;  5HJA A;  5ICN B;  2VQO A;  3GN0 A;  1P8M A;  3E6V A;  4IXU A;  1HQF A;  5G0X A;  1RLA A;  3SKK A;  1WOI A;  1T69 A;  1HQX A;  1T67 A;  3THE A;  4RN2 A;  4ZUO A;  4HZE A;  4A69 A;  4ZUR A;  1C3P A;  1P8Q A;  3SJT A;  4RHM A;  3E8Q A;  1XFK A;  1ZPE A;  4MYL A;  2EF4 A;  3M1R A;  4RN1 A;  5FCW A;  5FUE A;  1T5G A;  5THT A;  4IU1 A;  3GMZ A;  4QA5 A;  5EFH A;  2V5X A;  5EFK B;  4CEV A;  3EWF A;  4GSZ A;  5EFN A;  5EEI A;  3MZ4 A;  1C3S A;  3SL1 A;  2EIV A;  4ZUM A;  4ZUN A;  4Q3R A;  4IXV A;  3TH7 A;  4BKX B;  2VQW G;  1HQ5 A;  1P8S A;  3E9B A;  5DC8 A;  3C0Z A;  2ZAV A;  1HQH A;  2VQM A;  2PLL A;  3DJ8 A;  4IU5 A;  3Q9E A;  5G1B A;  4Q40 A;  1CEV A;  2V5W A;  4GWD A;  3MEN A;  3MZ6 A;  4BZ7 A;  3EW8 A;  3F06 A;  4IE1 A;  3RLA A;  5LI3 A;  4FCK A;  3EZP A;  5D1C A;  5IWG A;  5G17 A;  1VKG A;  1HQG A;  1P8O A;  2VQQ A;  3C10 A;  4RHQ A;  5DC5 A;  4QA6 A;  4Q3S A;  2PHA A;  3NIO A;  4IU4 A;  4HXQ A;  4Q3U A;  3LHL A;  4GSM A;  1GQ7 A;  3SFF A;  1C3R A;  1P8P A;  3ZNR A;  4BZ6 A;  4MXR A;  1D3V A;  4RHI A;  5G11 A;  4Q3R C;  4Q3P A;  4LY1 A;  3RQD A;  4MYN A;  4RHK A;  4CBY A;  4RHL A;  3ZNS A;  2EF5 A;  5G0I A;  3F07 A;  5THV A;  3LP4 A;  4RHJ A;  3THJ A;  5EFJ D;  3NIP A;  2VCG A;  5G1A A;  5G0Y A;  4CBT A;  4FCI A;  3THH A;  1W22 A;  3KV2 A;  3MMR A;  2GH6 A;  5G0G A;  2VQV A;  4CQF A;  4Q41 A;  5G3W A;  1T4T A;  1WVB A;  3E6K A;  5EEF A;  5THU A;  5G12 A;  4G3H A;  4RLA A;  3Q9B A;  1WVA A;  3SFH A;  5D1B A;  2A0M A;  4Q42 A;  1TA1 A;  3SL0 A;  4MYK A;  4QA1 A;  4MYF A;  4Q3T A;  5EEM A;  4Q3Q A;  3MJL A;  4ZUP A;  1T4R A;  5D1D A;  3F80 A;  2CEV A;  3LP7 A;  4QA7 A;  5DC7 A;  3Q9F A;  5G1C A;  4Q3V A;  5BWZ A;  2PHO A;  3MZ7 A;  1ZZ0 A;  4BZ8 A;  2VQJ A;  3MZ3 A;  1WOG A;  5RLA A;  5HJ9 A;  5CEV A;  1WOH A;  1ZZ1 A;  5IX0 A;  1ZPG A;  4HWW A;  4RN0 A;  5G13 A;  1T4S A;  4DZ4 A;  3PZL A;  4QA2 A;  2RLA A;  1TBH A;  4QA4 A;  5THS A;  1GQ6 A;  4IE3 A;  1T5F A;  3E8Z A;  1T64 A;  1TBJ A;  3NIQ A;  4IE2 A;  5EF8 A;  5EFB D;  3Q9C A;  5G0J A;  5JI5 A;  3TF3 A;  4GWC A;  1TBL A;  3MFW A;  4QA0 A; 
#chains in the Genus database with same CATH homology
 1P8R A;  4I06 A;  1P8N A;  1T4P A;  3CEV A;  4IU0 A;  1PQ3 A;  4ITY A;  2AEB A;  1R1O A;  3MFV A;  4GSV A;  5HJA A;  3GN0 A;  1P8M A;  3E6V A;  4IXU A;  1HQF A;  1RLA A;  3SKK A;  1WOI A;  1HQX A;  3THE A;  4HZE A;  1P8Q A;  3SJT A;  4RHM A;  3E8Q A;  1XFK A;  1ZPE A;  4MYL A;  3M1R A;  2EF4 A;  1T5G A;  4IU1 A;  3GMZ A;  4CEV A;  4GSZ A;  3SL1 A;  2EIV A;  4Q3R A;  4IXV A;  3TH7 A;  3E9B A;  1HQ5 A;  1P8S A;  2ZAV A;  1HQH A;  2PLL A;  3DJ8 A;  4IU5 A;  4Q40 A;  1CEV A;  4GWD A;  4IE1 A;  3RLA A;  4FCK A;  1HQG A;  1P8O A;  4RHQ A;  4Q3S A;  2PHA A;  3NIO A;  4IU4 A;  4HXQ A;  4Q3U A;  3LHL A;  4GSM A;  1GQ7 A;  1P8P A;  4MXR A;  1D3V A;  4RHI A;  4Q3R C;  4Q3P A;  4MYN A;  4RHK A;  4RHL A;  2EF5 A;  3LP4 A;  4RHJ A;  3THJ A;  3NIP A;  4FCI A;  3THH A;  3KV2 A;  3MMR A;  4Q41 A;  1T4T A;  1WVB A;  3E6K A;  4G3H A;  4RLA A;  1WVA A;  2A0M A;  4Q42 A;  1TA1 A;  3SL0 A;  4MYK A;  4MYF A;  4Q3T A;  4Q3Q A;  3MJL A;  1T4R A;  3F80 A;  2CEV A;  3LP7 A;  4Q3V A;  2PHO A;  1WOG A;  5RLA A;  5HJ9 A;  5CEV A;  1WOH A;  1ZPG A;  4HWW A;  1T4S A;  4DZ4 A;  3PZL A;  2RLA A;  1TBH A;  1GQ6 A;  4IE3 A;  1T5F A;  3E8Z A;  1TBJ A;  3NIQ A;  4IE2 A;  3TF3 A;  4GWC A;  1TBL A;  3MFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...