4HWWA

Crystal structure of human arginase-1 complexed with inhibitor 9
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Discovery of (R)-2-Amino-6-borono-2-(2-(piperidin-1-yl)ethyl)hexanoic Acid and Congeners As Highly Potent Inhibitors of Human Arginases I and II for Treatment of Myocardial Reperfusion Injury.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 119
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4hwwA00
1WOGA 5RLAA 4Q42A 4MYKA 1HQ5A 1TBJA 1T4PA 4IXVA 3THEA 3GMZA 1T4TA 3SJTA 3MFVA 2AEBA 4MYNA 4HZEA 4IU5A 3TH7A 1P8PA 1GQ7A 4Q40A 4Q3RA 4MYFA 1HQXA 4RHQA 4GWCA 3LP4A 1WOIA 4IXUA 3M1RA 5CEVA 1WVAA 4IE1A 1WOHA 1P8OA 1ZPEA 4RHMA 3LHLA 1HQHA 3F80A 4IE2A 2EF5A 3MMRA 4Q3VA 4Q3RC 1P8MA 3GN0A 4Q3QA 4G3HA 2EIVA 3E6VA 4IU1A 4HWWA 4Q41A 1CEVA 1T5FA 3NIQA 4IU4A 2PLLA 1TA1A 3E6KA 3RLAA 3SL0A 3CEVA 4MXRA 1P8RA 1TBHA 3MJLA 4FCIA 3THJA 4IE3A 4Q3SA 4CEVA 4RHJA 1ZPGA 1TBLA 4Q3TA 1RLAA 3NIPA 2PHOA 3SKKA 4ITYA 5HJAA 1T4SA 1P8SA 1WVBA 1XFKA 3E9BA 3THHA 3TF3A 1HQGA 4MYLA 4Q3UA 3KV2A 4GWDA 3MFWA 2RLAA 1PQ3A 2EF4A 4I06A 4HXQA 1D3VA 2ZAVA 1HQFA 2PHAA 4RHLA 4DZ4A 3LP7A 2A0MA 4RHKA 1T4RA 1P8NA 3PZLA 1R1OA 3DJ8A 3NIOA 4GSVA 4IU0A 3SL1A 1T5GA 3E8QA 2CEVA 1GQ6A 4Q3PA 4FCKA 5HJ9A 4RLAA 4GSZA 3E8ZA 1P8QA 4GSMA 4RHIA
chains in the Genus database with same CATH superfamily
4QA5A 1WOGA 5RLAA 4BKXB 4Q42A 5EEIA 4MYKA 1HQ5A 1TBJA 1T4PA 4IXVA 5G17A 3THEA 3GMZA 5LI3A 5G0YA 1VKGA 1T4TA 2VQMA 3SJTA 3RQDA 3MFVA 2AEBA 3MENA 5EEKA 5EFJD 3MZ3A 3MAXA 4MYNA 5EFKB 4HZEA 2VCGA 4IU5A 3SFFA 3TH7A 1P8PA 1GQ7A 1T67A 3MZ4A 4Q40A 3MZ6A 1HQXA 4MYFA 4Q3RA 5EFHA 4ZUNA 3Q9BA 1ZZ0A 4BZ8A 1C3SA 4RHQA 3C0YA 4GWCA 3LP4A 1WOIA 4IXUA 3EZPA 3M1RA 5D1DA 1WVAA 4IE1A 5CEVA 4LXZA 2V5WA 1WOHA 2VQVA 1P8OA 1ZPEA 3LHLA 4RHMA 5G0XA 1HQHA 3F80A 5G0GA 3ZNSA 4IE2A 5DC7A 4CQFA 2EF5A 4RN1A 2VQWG 3MMRA 4QA6A 4Q3VA 4Q3RC 1P8MA 1T64A 3GN0A 4ZUOA 4Q3QA 4CBYA 4G3HA 2GH6A 5G1CA 2EIVA 3E6VA 4IU1A 3C0ZA 3MZ7A 5EEFA 4HWWA 4ZUPA 4Q41A 1CEVA 1T5FA 2VQQA 3NIQA 5G0IA 4IU4A 2PLLA 5A2SA 1TA1A 3E6KA 5EENA 3RLAA 3SL0A 3CEVA 4MXRA 1P8RA 1C3PA 4GSMA 5EFNA 1TBHA 3MJLA 5IX0A 4FCIA 5D1BA 3THJA 4RN0A 3F0RA 5EFBD 4IE3A 5G0HA 2VQOA 1ZZ3A 4Q3SA 5G13A 4CEVA 4RHJA 1ZPGA 4QA2A 4RN2A 5DC5A 5EF8A 1ZZ1A 4BZ9A 1TBLA 4Q3TA 1RLAA 5ICNB 5FUEA 3NIPA 1T69A 2PHOA 5EFGA 3SKKA 4ITYA 5HJAA 1T4SA 1P8SA 5DC8A 5G11A 1WVBA 3EZTA 1XFKA 5THVA 3SFHA 3Q9CA 4QA3A 3E9BA 3EWFA 4QA7A 3THHA 3TF3A 1HQGA 4MYLA 4Q3UA 3F07A 3KV2A 4GWDA 4QA4A 3MFWA 3ZNRA 2RLAA 1PQ3A 4A69A 5JI5A 5IWGA 2EF4A 4I06A 5EF7A 4HXQA 5EEMA 4LY1A 5G1AA 1D3VA 2ZAVA 1HQFA 4ZUMA 3Q9FA 2PHAA 5FCWA 5THSA 4BZ6A 4RHLA 4QA1A 4DZ4A 3F06A 3LP7A 5G0JA 3EW8A 5BWZA 2A0MA 4QA0A 5G10A 4BZ5A 4RHKA 1W22A 4BZ7A 2VQJA 1P8NA 3PZLA 1R1OA 3DJ8A 5D1CA 4ZUQA 5G3WA 3NIOA 3Q9EA 4GSVA 5G1BA 5G12A 5THUA 4IU0A 1C3RA 5DC6A 3SL1A 1T5GA 3E8QA 2CEVA 1GQ6A 4Q3PA 4CBTA 4FCKA 4ZURA 5HJ9A 3C10A 4RLAA 4GSZA 3E8ZA 5THTA 1P8QA 1T4RA 2V5XA 4RHIA
chains in the Genus database with same CATH topology
1WOGA 5RLAA 4Q42A 4MYKA 1HQ5A 1TBJA 1T4PA 4IXVA 3THEA 3GMZA 1T4TA 3SJTA 3MFVA 2AEBA 4MYNA 4HZEA 4IU5A 3TH7A 1P8PA 1GQ7A 4Q40A 4Q3RA 4MYFA 1HQXA 4RHQA 4GWCA 3LP4A 1WOIA 4IXUA 3M1RA 5CEVA 1WVAA 4IE1A 1WOHA 1P8OA 1ZPEA 4RHMA 3LHLA 1HQHA 3F80A 4IE2A 2EF5A 3MMRA 4Q3VA 4Q3RC 1P8MA 3GN0A 4Q3QA 4G3HA 2EIVA 3E6VA 4IU1A 4HWWA 4Q41A 1CEVA 1T5FA 3NIQA 4IU4A 2PLLA 1TA1A 3E6KA 3RLAA 3SL0A 3CEVA 4MXRA 1P8RA 1TBHA 3MJLA 4FCIA 3THJA 4IE3A 4Q3SA 4CEVA 4RHJA 1ZPGA 1TBLA 4Q3TA 1RLAA 3NIPA 2PHOA 3SKKA 4ITYA 5HJAA 1T4SA 1P8SA 1WVBA 1XFKA 3E9BA 3THHA 3TF3A 1HQGA 4MYLA 4Q3UA 3KV2A 4GWDA 3MFWA 2RLAA 1PQ3A 2EF4A 4I06A 4HXQA 1D3VA 2ZAVA 1HQFA 2PHAA 4RHLA 4DZ4A 3LP7A 2A0MA 4RHKA 1T4RA 1P8NA 3PZLA 1R1OA 3DJ8A 3NIOA 4GSVA 4IU0A 3SL1A 1T5GA 3E8QA 2CEVA 1GQ6A 4Q3PA 4FCKA 5HJ9A 4RLAA 4GSZA 3E8ZA 1P8QA 4GSMA 4RHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOG A;  5RLA A;  4Q42 A;  4MYK A;  1HQ5 A;  1TBJ A;  1T4P A;  4IXV A;  3THE A;  3GMZ A;  1T4T A;  3SJT A;  3MFV A;  2AEB A;  4MYN A;  4HZE A;  4IU5 A;  3TH7 A;  1P8P A;  1GQ7 A;  4Q40 A;  4Q3R A;  4MYF A;  1HQX A;  4RHQ A;  4GWC A;  3LP4 A;  1WOI A;  4IXU A;  3M1R A;  5CEV A;  1WVA A;  4IE1 A;  1WOH A;  1P8O A;  1ZPE A;  4RHM A;  3LHL A;  1HQH A;  3F80 A;  4IE2 A;  2EF5 A;  3MMR A;  4Q3V A;  4Q3R C;  1P8M A;  3GN0 A;  4Q3Q A;  4G3H A;  2EIV A;  3E6V A;  4IU1 A;  4HWW A;  4Q41 A;  1CEV A;  1T5F A;  3NIQ A;  4IU4 A;  2PLL A;  1TA1 A;  3E6K A;  3RLA A;  3SL0 A;  3CEV A;  4MXR A;  1P8R A;  1TBH A;  3MJL A;  4FCI A;  3THJ A;  4IE3 A;  4Q3S A;  4CEV A;  4RHJ A;  1ZPG A;  1TBL A;  4Q3T A;  1RLA A;  3NIP A;  2PHO A;  3SKK A;  4ITY A;  5HJA A;  1T4S A;  1P8S A;  1WVB A;  1XFK A;  3E9B A;  3THH A;  3TF3 A;  1HQG A;  4MYL A;  4Q3U A;  3KV2 A;  4GWD A;  3MFW A;  2RLA A;  1PQ3 A;  2EF4 A;  4I06 A;  4HXQ A;  1D3V A;  2ZAV A;  1HQF A;  2PHA A;  4RHL A;  4DZ4 A;  3LP7 A;  2A0M A;  4RHK A;  1T4R A;  1P8N A;  3PZL A;  1R1O A;  3DJ8 A;  3NIO A;  4GSV A;  4IU0 A;  3SL1 A;  1T5G A;  3E8Q A;  2CEV A;  1GQ6 A;  4Q3P A;  4FCK A;  5HJ9 A;  4RLA A;  4GSZ A;  3E8Z A;  1P8Q A;  4GSM A;  4RHI A; 
#chains in the Genus database with same CATH topology
 4QA5 A;  1WOG A;  5RLA A;  4BKX B;  4Q42 A;  5EEI A;  4MYK A;  1HQ5 A;  1TBJ A;  1T4P A;  4IXV A;  5G17 A;  3THE A;  3GMZ A;  5LI3 A;  5G0Y A;  1VKG A;  1T4T A;  2VQM A;  3SJT A;  3RQD A;  3MFV A;  2AEB A;  3MEN A;  5EEK A;  5EFJ D;  3MZ3 A;  3MAX A;  4MYN A;  5EFK B;  4HZE A;  2VCG A;  4IU5 A;  3SFF A;  3TH7 A;  1P8P A;  1GQ7 A;  1T67 A;  3MZ4 A;  4Q40 A;  3MZ6 A;  1HQX A;  4MYF A;  4Q3R A;  5EFH A;  4ZUN A;  3Q9B A;  1ZZ0 A;  4BZ8 A;  1C3S A;  4RHQ A;  3C0Y A;  4GWC A;  3LP4 A;  1WOI A;  4IXU A;  3EZP A;  3M1R A;  5D1D A;  1WVA A;  4IE1 A;  5CEV A;  4LXZ A;  2V5W A;  1WOH A;  2VQV A;  1P8O A;  1ZPE A;  3LHL A;  4RHM A;  5G0X A;  1HQH A;  3F80 A;  5G0G A;  3ZNS A;  4IE2 A;  5DC7 A;  4CQF A;  2EF5 A;  4RN1 A;  2VQW G;  3MMR A;  4QA6 A;  4Q3V A;  4Q3R C;  1P8M A;  1T64 A;  3GN0 A;  4ZUO A;  4Q3Q A;  4CBY A;  4G3H A;  2GH6 A;  5G1C A;  2EIV A;  3E6V A;  4IU1 A;  3C0Z A;  3MZ7 A;  5EEF A;  4HWW A;  4ZUP A;  4Q41 A;  1CEV A;  1T5F A;  2VQQ A;  3NIQ A;  5G0I A;  4IU4 A;  2PLL A;  5A2S A;  1TA1 A;  3E6K A;  5EEN A;  3RLA A;  3SL0 A;  3CEV A;  4MXR A;  1P8R A;  1C3P A;  4GSM A;  5EFN A;  1TBH A;  3MJL A;  5IX0 A;  4FCI A;  5D1B A;  3THJ A;  4RN0 A;  3F0R A;  5EFB D;  4IE3 A;  5G0H A;  2VQO A;  1ZZ3 A;  4Q3S A;  5G13 A;  4CEV A;  4RHJ A;  1ZPG A;  4QA2 A;  4RN2 A;  5DC5 A;  5EF8 A;  1ZZ1 A;  4BZ9 A;  1TBL A;  4Q3T A;  1RLA A;  5ICN B;  5FUE A;  3NIP A;  1T69 A;  2PHO A;  5EFG A;  3SKK A;  4ITY A;  5HJA A;  1T4S A;  1P8S A;  5DC8 A;  5G11 A;  1WVB A;  3EZT A;  1XFK A;  5THV A;  3SFH A;  3Q9C A;  4QA3 A;  3E9B A;  3EWF A;  4QA7 A;  3THH A;  3TF3 A;  1HQG A;  4MYL A;  4Q3U A;  3F07 A;  3KV2 A;  4GWD A;  4QA4 A;  3MFW A;  3ZNR A;  2RLA A;  1PQ3 A;  4A69 A;  5JI5 A;  5IWG A;  2EF4 A;  4I06 A;  5EF7 A;  4HXQ A;  5EEM A;  4LY1 A;  5G1A A;  1D3V A;  2ZAV A;  1HQF A;  4ZUM A;  3Q9F A;  2PHA A;  5FCW A;  5THS A;  4BZ6 A;  4RHL A;  4QA1 A;  4DZ4 A;  3F06 A;  3LP7 A;  5G0J A;  3EW8 A;  5BWZ A;  2A0M A;  4QA0 A;  5G10 A;  4BZ5 A;  4RHK A;  1W22 A;  4BZ7 A;  2VQJ A;  1P8N A;  3PZL A;  1R1O A;  3DJ8 A;  5D1C A;  4ZUQ A;  5G3W A;  3NIO A;  3Q9E A;  4GSV A;  5G1B A;  5G12 A;  5THU A;  4IU0 A;  1C3R A;  5DC6 A;  3SL1 A;  1T5G A;  3E8Q A;  2CEV A;  1GQ6 A;  4Q3P A;  4CBT A;  4FCK A;  4ZUR A;  5HJ9 A;  3C10 A;  4RLA A;  4GSZ A;  3E8Z A;  5THT A;  1P8Q A;  1T4R A;  2V5X A;  4RHI A; 
#chains in the Genus database with same CATH homology
 1WOG A;  5RLA A;  4Q42 A;  4MYK A;  1HQ5 A;  1TBJ A;  1T4P A;  4IXV A;  3THE A;  3GMZ A;  1T4T A;  3SJT A;  3MFV A;  2AEB A;  4MYN A;  4HZE A;  4IU5 A;  3TH7 A;  1P8P A;  1GQ7 A;  4Q40 A;  4Q3R A;  4MYF A;  1HQX A;  4RHQ A;  4GWC A;  3LP4 A;  1WOI A;  4IXU A;  3M1R A;  5CEV A;  1WVA A;  4IE1 A;  1WOH A;  1P8O A;  1ZPE A;  4RHM A;  3LHL A;  1HQH A;  3F80 A;  4IE2 A;  2EF5 A;  3MMR A;  4Q3V A;  4Q3R C;  1P8M A;  3GN0 A;  4Q3Q A;  4G3H A;  2EIV A;  3E6V A;  4IU1 A;  4HWW A;  4Q41 A;  1CEV A;  1T5F A;  3NIQ A;  4IU4 A;  2PLL A;  1TA1 A;  3E6K A;  3RLA A;  3SL0 A;  3CEV A;  4MXR A;  1P8R A;  1TBH A;  3MJL A;  4FCI A;  3THJ A;  4IE3 A;  4Q3S A;  4CEV A;  4RHJ A;  1ZPG A;  1TBL A;  4Q3T A;  1RLA A;  3NIP A;  2PHO A;  3SKK A;  4ITY A;  5HJA A;  1T4S A;  1P8S A;  1WVB A;  1XFK A;  3E9B A;  3THH A;  3TF3 A;  1HQG A;  4MYL A;  4Q3U A;  3KV2 A;  4GWD A;  3MFW A;  2RLA A;  1PQ3 A;  2EF4 A;  4I06 A;  4HXQ A;  1D3V A;  2ZAV A;  1HQF A;  2PHA A;  4RHL A;  4DZ4 A;  3LP7 A;  2A0M A;  4RHK A;  1T4R A;  1P8N A;  3PZL A;  1R1O A;  3DJ8 A;  3NIO A;  4GSV A;  4IU0 A;  3SL1 A;  1T5G A;  3E8Q A;  2CEV A;  1GQ6 A;  4Q3P A;  4FCK A;  5HJ9 A;  4RLA A;  4GSZ A;  3E8Z A;  1P8Q A;  4GSM A;  4RHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...