5G13A

Pseudomonas aeruginosa hdah (h143a) unliganded.
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
370
structure length
370
Chain Sequence
TRRTAFFFDELCLWHAAGPHALTLPVGGWVQPPAAAGHAESPETKRRLKSLLDVSGLTARLQLRSAPPASDEDLLRVHPAHYLERFKALSDAGGGSLGQDAPIGPGSYEIARLSAGLAIAALDAVLAGEADNAYSLSRPPGAHCLPDQAMGFCFFANIAVAIEAAKARHGVERVAVLDWDVHHGNGTQAIYYRRDDVLSISLHQDGCFPPGYSGAEDIGEDRGRGFNLNVPLLPGGGHDAYMQAMQRIVLPALERFRPQLIVVASGFDANAVDPLARMQLHSDSFRAMTAMVRDAAERHAGGRLVVVHEGGYSEAYVPFCGLAVIEELSGVRSAVRDPLRDFIELQQPNAAFRDFQRQRLEELAAQFGLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HDAH
publication title Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 139
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5g13A00
5EFHA 3MZ6A 5IX0A 3MZ4A 4QA7A 5ICNB 2VQOA 5EFJD 5G1AA 5G0JA 4ZUOA 3Q9FA 4BKXB 4ZUPA 5EENA 5G0XA 5G13A 5EF7A 5FCWA 5G0IA 2VQQA 4RN0A 3ZNRA 3C0YA 4LXZA 4CBYA 5EFKB 5JI5A 5G1BA 5BWZA 3MAXA 3MENA 3C0ZA 5DC7A 2VQVA 1ZZ1A 5THSA 1VKGA 4BZ6A 5A2SA 3F06A 2V5WA 1C3SA 2VCGA 1T67A 2VQMA 5EF8A 4ZUQA 3Q9EA 4ZUNA 5G12A 3Q9CA 5THVA 3EZPA 3Q9BA 4RN2A 1ZZ3A 2GH6A 3MZ3A 5G17A 1T69A 3C10A 5DC5A 5D1BA 3EWFA 5EEIA 1C3RA 5EEMA 5G3WA 3EW8A 5EEKA 5THTA 4RN1A 5LI3A 1C3PA 5EEFA 5G1CA 4QA5A 3ZNSA 3F0RA 3MZ7A 3F07A 5DC6A 2V5XA 4QA3A 5EFBD 4BZ9A 5IWGA 3SFFA 5THUA 5G0YA 5G0GA 3SFHA 1ZZ0A 5G10A 4QA0A 2VQJA 3EZTA 1T64A 5G0HA 5G11A 4A69A 5DC8A 4BZ5A 4QA6A 4CQFA 4QA2A 3RQDA 4BZ7A 4QA4A 4ZUMA 5EFNA 5FUEA 5D1DA 4QA1A 4ZURA 5D1CA 4CBTA 2VQWG 5EFGA 1W22A 4BZ8A 4LY1A
chains in the Genus database with same CATH superfamily
5EFHA 3MZ6A 5IX0A 3CEVA 3NIOA 3MZ4A 4RHQA 4QA7A 1ZPEA 2VQOA 5ICNB 5EFJD 3E8QA 3LP4A 5G1AA 4G3HA 4GSZA 4ZUOA 5G0JA 4RHLA 2EF5A 3Q9FA 4BKXB 2PHAA 1T4PA 4GSVA 4ZUPA 1R1OA 5EENA 5G0XA 5G13A 5EF7A 1T4RA 5FCWA 4IE1A 1P8RA 2VQQA 4RN0A 5G0IA 1WOHA 3C0YA 3ZNRA 4Q41A 4LXZA 4CBYA 3M1RA 4RHKA 5EFKB 4HWWA 5JI5A 5G1BA 4IXVA 1GQ6A 5BWZA 3MAXA 3MENA 3C0ZA 5DC7A 1HQ5A 1ZZ1A 2VQVA 3E9BA 1P8NA 5THSA 1VKGA 4BZ6A 4GSMA 5A2SA 4HZEA 4RLAA 3F06A 4IXUA 2V5WA 3THJA 1C3SA 1HQXA 1T5GA 1WOIA 1GQ7A 2VCGA 1T67A 2PLLA 2VQMA 5EF8A 4ZUQA 3Q9EA 4MYKA 4ZUNA 5G12A 4IU1A 3Q9CA 4Q3TA 1WOGA 3THHA 3GN0A 4IE3A 4IU5A 1T5FA 3EZPA 3Q9BA 4FCIA 5THVA 3SL0A 1PQ3A 4RN2A 5CEVA 2A0MA 1TBJA 3THEA 2GH6A 4IU4A 3MZ3A 4HXQA 5G17A 1T69A 4FCKA 3MFWA 4Q3RA 3C10A 5DC5A 3SL1A 5D1BA 3EWFA 5EEIA 4IE2A 1C3RA 4RHMA 4MXRA 4Q3QA 2AEBA 4Q3SA 5EEMA 5G3WA 1CEVA 3EW8A 5EEKA 4GWDA 5HJ9A 3NIQA 5THTA 4RN1A 3TF3A 5LI3A 1C3PA 5EEFA 5G1CA 4QA5A 3RLAA 3ZNSA 2EF4A 3F0RA 4Q40A 3MZ7A 2PHOA 5EFGA 3MMRA 3F07A 3SJTA 1P8OA 3MJLA 1T4TA 1WVBA 4I06A 5DC6A 2V5XA 4QA3A 5EFBD 4BZ9A 1P8PA 3LHLA 5IWGA 3SFFA 1P8QA 5THUA 5G0YA 3E6KA 3F80A 1HQFA 3PZLA 4Q3PA 3NIPA 5G0GA 3SFHA 4RHIA 3LP7A 1ZZ0A 4GWCA 2EIVA 5G10A 4RHJA 1HQHA 4Q3VA 4ITYA 4QA0A 4CEVA 4Q3RC 2VQJA 3EZTA 1T64A 5HJAA 5G0HA 3MFVA 4DZ4A 5G11A 4A69A 1TA1A 3TH7A 1WVAA 5DC8A 3KV2A 4BZ5A 4MYLA 1P8MA 4IU0A 3SKKA 4Q42A 4QA6A 1TBHA 4CQFA 3E6VA 4QA2A 3RQDA 3DJ8A 4BZ7A 2ZAVA 4Q3UA 1ZPGA 4QA4A 4ZUMA 1XFKA 1TBLA 5EFNA 1RLAA 5FUEA 1P8SA 3E8ZA 1HQGA 3GMZA 5D1DA 4MYFA 4QA1A 4MYNA 4ZURA 2RLAA 5D1CA 1T4SA 4CBTA 1D3VA 2VQWG 1ZZ3A 5RLAA 1W22A 2CEVA 4BZ8A 4LY1A
chains in the Genus database with same CATH topology
5EFHA 3MZ6A 5IX0A 3MZ4A 4QA7A 5ICNB 2VQOA 5EFJD 5G1AA 5G0JA 4ZUOA 3Q9FA 4BKXB 4ZUPA 5EENA 5G0XA 5G13A 5EF7A 5FCWA 5G0IA 2VQQA 4RN0A 3ZNRA 3C0YA 4LXZA 4CBYA 5EFKB 5JI5A 5G1BA 5BWZA 3MAXA 3MENA 3C0ZA 5DC7A 2VQVA 1ZZ1A 5THSA 1VKGA 4BZ6A 5A2SA 3F06A 2V5WA 1C3SA 2VCGA 1T67A 2VQMA 5EF8A 4ZUQA 3Q9EA 4ZUNA 5G12A 3Q9CA 5THVA 3EZPA 3Q9BA 4RN2A 1ZZ3A 2GH6A 3MZ3A 5G17A 1T69A 3C10A 5DC5A 5D1BA 3EWFA 5EEIA 1C3RA 5EEMA 5G3WA 3EW8A 5EEKA 5THTA 4RN1A 5LI3A 1C3PA 5EEFA 5G1CA 4QA5A 3ZNSA 3F0RA 3MZ7A 3F07A 5DC6A 2V5XA 4QA3A 5EFBD 4BZ9A 5IWGA 3SFFA 5THUA 5G0YA 5G0GA 3SFHA 1ZZ0A 5G10A 4QA0A 2VQJA 3EZTA 1T64A 5G0HA 5G11A 4A69A 5DC8A 4BZ5A 4QA6A 4CQFA 4QA2A 3RQDA 4BZ7A 4QA4A 4ZUMA 5EFNA 5FUEA 5D1DA 4QA1A 4ZURA 5D1CA 4CBTA 2VQWG 5EFGA 1W22A 4BZ8A 4LY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EFH A;  3MZ6 A;  5IX0 A;  3MZ4 A;  4QA7 A;  5ICN B;  2VQO A;  5EFJ D;  5G1A A;  5G0J A;  4ZUO A;  3Q9F A;  4BKX B;  4ZUP A;  5EEN A;  5G0X A;  5G13 A;  5EF7 A;  5FCW A;  5G0I A;  2VQQ A;  4RN0 A;  3ZNR A;  3C0Y A;  4LXZ A;  4CBY A;  5EFK B;  5JI5 A;  5G1B A;  5BWZ A;  3MAX A;  3MEN A;  3C0Z A;  5DC7 A;  2VQV A;  1ZZ1 A;  5THS A;  1VKG A;  4BZ6 A;  5A2S A;  3F06 A;  2V5W A;  1C3S A;  2VCG A;  1T67 A;  2VQM A;  5EF8 A;  4ZUQ A;  3Q9E A;  4ZUN A;  5G12 A;  3Q9C A;  5THV A;  3EZP A;  3Q9B A;  4RN2 A;  1ZZ3 A;  2GH6 A;  3MZ3 A;  5G17 A;  1T69 A;  3C10 A;  5DC5 A;  5D1B A;  3EWF A;  5EEI A;  1C3R A;  5EEM A;  5G3W A;  3EW8 A;  5EEK A;  5THT A;  4RN1 A;  5LI3 A;  1C3P A;  5EEF A;  5G1C A;  4QA5 A;  3ZNS A;  3F0R A;  3MZ7 A;  3F07 A;  5DC6 A;  2V5X A;  4QA3 A;  5EFB D;  4BZ9 A;  5IWG A;  3SFF A;  5THU A;  5G0Y A;  5G0G A;  3SFH A;  1ZZ0 A;  5G10 A;  4QA0 A;  2VQJ A;  3EZT A;  1T64 A;  5G0H A;  5G11 A;  4A69 A;  5DC8 A;  4BZ5 A;  4QA6 A;  4CQF A;  4QA2 A;  3RQD A;  4BZ7 A;  4QA4 A;  4ZUM A;  5EFN A;  5FUE A;  5D1D A;  4QA1 A;  4ZUR A;  5D1C A;  4CBT A;  2VQW G;  5EFG A;  1W22 A;  4BZ8 A;  4LY1 A; 
#chains in the Genus database with same CATH topology
 5EFH A;  3MZ6 A;  5IX0 A;  3CEV A;  3NIO A;  3MZ4 A;  4RHQ A;  4QA7 A;  1ZPE A;  2VQO A;  5ICN B;  5EFJ D;  3E8Q A;  3LP4 A;  5G1A A;  4G3H A;  4GSZ A;  4ZUO A;  5G0J A;  4RHL A;  2EF5 A;  3Q9F A;  4BKX B;  2PHA A;  1T4P A;  4GSV A;  4ZUP A;  1R1O A;  5EEN A;  5G0X A;  5G13 A;  5EF7 A;  1T4R A;  5FCW A;  4IE1 A;  1P8R A;  2VQQ A;  4RN0 A;  5G0I A;  1WOH A;  3C0Y A;  3ZNR A;  4Q41 A;  4LXZ A;  4CBY A;  3M1R A;  4RHK A;  5EFK B;  4HWW A;  5JI5 A;  5G1B A;  4IXV A;  1GQ6 A;  5BWZ A;  3MAX A;  3MEN A;  3C0Z A;  5DC7 A;  1HQ5 A;  1ZZ1 A;  2VQV A;  3E9B A;  1P8N A;  5THS A;  1VKG A;  4BZ6 A;  4GSM A;  5A2S A;  4HZE A;  4RLA A;  3F06 A;  4IXU A;  2V5W A;  3THJ A;  1C3S A;  1HQX A;  1T5G A;  1WOI A;  1GQ7 A;  2VCG A;  1T67 A;  2PLL A;  2VQM A;  5EF8 A;  4ZUQ A;  3Q9E A;  4MYK A;  4ZUN A;  5G12 A;  4IU1 A;  3Q9C A;  4Q3T A;  1WOG A;  3THH A;  3GN0 A;  4IE3 A;  4IU5 A;  1T5F A;  3EZP A;  3Q9B A;  4FCI A;  5THV A;  3SL0 A;  1PQ3 A;  4RN2 A;  5CEV A;  2A0M A;  1TBJ A;  3THE A;  2GH6 A;  4IU4 A;  3MZ3 A;  4HXQ A;  5G17 A;  1T69 A;  4FCK A;  3MFW A;  4Q3R A;  3C10 A;  5DC5 A;  3SL1 A;  5D1B A;  3EWF A;  5EEI A;  4IE2 A;  1C3R A;  4RHM A;  4MXR A;  4Q3Q A;  2AEB A;  4Q3S A;  5EEM A;  5G3W A;  1CEV A;  3EW8 A;  5EEK A;  4GWD A;  5HJ9 A;  3NIQ A;  5THT A;  4RN1 A;  3TF3 A;  5LI3 A;  1C3P A;  5EEF A;  5G1C A;  4QA5 A;  3RLA A;  3ZNS A;  2EF4 A;  3F0R A;  4Q40 A;  3MZ7 A;  2PHO A;  5EFG A;  3MMR A;  3F07 A;  3SJT A;  1P8O A;  3MJL A;  1T4T A;  1WVB A;  4I06 A;  5DC6 A;  2V5X A;  4QA3 A;  5EFB D;  4BZ9 A;  1P8P A;  3LHL A;  5IWG A;  3SFF A;  1P8Q A;  5THU A;  5G0Y A;  3E6K A;  3F80 A;  1HQF A;  3PZL A;  4Q3P A;  3NIP A;  5G0G A;  3SFH A;  4RHI A;  3LP7 A;  1ZZ0 A;  4GWC A;  2EIV A;  5G10 A;  4RHJ A;  1HQH A;  4Q3V A;  4ITY A;  4QA0 A;  4CEV A;  4Q3R C;  2VQJ A;  3EZT A;  1T64 A;  5HJA A;  5G0H A;  3MFV A;  4DZ4 A;  5G11 A;  4A69 A;  1TA1 A;  3TH7 A;  1WVA A;  5DC8 A;  3KV2 A;  4BZ5 A;  4MYL A;  1P8M A;  4IU0 A;  3SKK A;  4Q42 A;  4QA6 A;  1TBH A;  4CQF A;  3E6V A;  4QA2 A;  3RQD A;  3DJ8 A;  4BZ7 A;  2ZAV A;  4Q3U A;  1ZPG A;  4QA4 A;  4ZUM A;  1XFK A;  1TBL A;  5EFN A;  1RLA A;  5FUE A;  1P8S A;  3E8Z A;  1HQG A;  3GMZ A;  5D1D A;  4MYF A;  4QA1 A;  4MYN A;  4ZUR A;  2RLA A;  5D1C A;  1T4S A;  4CBT A;  1D3V A;  2VQW G;  1ZZ3 A;  5RLA A;  1W22 A;  2CEV A;  4BZ8 A;  4LY1 A; 
#chains in the Genus database with same CATH homology
 5EFH A;  3MZ6 A;  5IX0 A;  3MZ4 A;  4QA7 A;  5ICN B;  2VQO A;  5EFJ D;  5G1A A;  5G0J A;  4ZUO A;  3Q9F A;  4BKX B;  4ZUP A;  5EEN A;  5G0X A;  5G13 A;  5EF7 A;  5FCW A;  5G0I A;  2VQQ A;  4RN0 A;  3ZNR A;  3C0Y A;  4LXZ A;  4CBY A;  5EFK B;  5JI5 A;  5G1B A;  5BWZ A;  3MAX A;  3MEN A;  3C0Z A;  5DC7 A;  2VQV A;  1ZZ1 A;  5THS A;  1VKG A;  4BZ6 A;  5A2S A;  3F06 A;  2V5W A;  1C3S A;  2VCG A;  1T67 A;  2VQM A;  5EF8 A;  4ZUQ A;  3Q9E A;  4ZUN A;  5G12 A;  3Q9C A;  5THV A;  3EZP A;  3Q9B A;  4RN2 A;  1ZZ3 A;  2GH6 A;  3MZ3 A;  5G17 A;  1T69 A;  3C10 A;  5DC5 A;  5D1B A;  3EWF A;  5EEI A;  1C3R A;  5EEM A;  5G3W A;  3EW8 A;  5EEK A;  5THT A;  4RN1 A;  5LI3 A;  1C3P A;  5EEF A;  5G1C A;  4QA5 A;  3ZNS A;  3F0R A;  3MZ7 A;  3F07 A;  5DC6 A;  2V5X A;  4QA3 A;  5EFB D;  4BZ9 A;  5IWG A;  3SFF A;  5THU A;  5G0Y A;  5G0G A;  3SFH A;  1ZZ0 A;  5G10 A;  4QA0 A;  2VQJ A;  3EZT A;  1T64 A;  5G0H A;  5G11 A;  4A69 A;  5DC8 A;  4BZ5 A;  4QA6 A;  4CQF A;  4QA2 A;  3RQD A;  4BZ7 A;  4QA4 A;  4ZUM A;  5EFN A;  5FUE A;  5D1D A;  4QA1 A;  4ZUR A;  5D1C A;  4CBT A;  2VQW G;  5EFG A;  1W22 A;  4BZ8 A;  4LY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...