4GSMA

Crystal structure of ni2+2-human arginase i
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
313
structure length
313
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Structure and function of non-native metal clusters in human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 112
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4gsmA00
1P8MA 4GWDA 3THHA 4Q3RC 1RLAA 1TA1A 3LP7A 4RHIA 4RLAA 4Q3QA 1P8OA 3CEVA 1WOHA 1ZPEA 3THEA 2PHOA 4RHLA 1TBJA 4GWCA 3NIQA 3E6KA 1HQGA 2EF4A 4HWWA 4IXVA 4HXQA 1CEVA 4IU4A 1T5GA 4Q3VA 1P8SA 4IU1A 4RHJA 3PZLA 3E9BA 3GN0A 3MMRA 4ITYA 4GSZA 3LP4A 4FCIA 3SL1A 3SL0A 1HQ5A 3E8QA 1PQ3A 2EIVA 2CEVA 4RHKA 3THJA 5RLAA 1T4SA 3KV2A 1XFKA 1R1OA 4MYNA 4IE1A 3SJTA 4CEVA 4Q3RA 3MFVA 4MYLA 5HJAA 3F80A 4IE3A 4GSVA 2PLLA 4Q3UA 1HQHA 1T5FA 1ZPGA 1P8RA 4I06A 1T4PA 3NIPA 3RLAA 3TF3A 1D3VA 5HJ9A 4Q3TA 4RHQA 4GSMA 4MYFA 1WVBA 1T4RA 3M1RA 3MFWA 3LHLA 4FCKA 1P8PA 2EF5A 1TBHA 2A0MA 4Q3SA 1GQ7A 1GQ6A 5CEVA 2PHAA 4DZ4A 4G3HA 1T4TA 3E6VA 1P8NA 4MYKA 1TBLA 4Q42A 1WVAA 2RLAA 4Q41A 4IXUA 1P8QA 4Q3PA 4IE2A 1HQXA 3MJLA 3E8ZA 2AEBA 3NIOA 4Q40A 4MXRA 3SKKA 4IU5A 1HQFA 1WOGA 4IU0A 2ZAVA 1WOIA 3TH7A 3GMZA 4HZEA 3DJ8A 4RHMA
chains in the Genus database with same CATH superfamily
1P8MA 4GWDA 3THHA 4BZ7A 4Q3RC 1RLAA 5FCWA 5D1BA 5D1CA 1TA1A 3LP7A 4RHIA 4RLAA 4BKXB 3Q9EA 4Q3QA 5THVA 1P8OA 1W22A 3CEVA 1WOHA 4BZ6A 4ZUOA 1ZPEA 5EEKA 5BWZA 3THEA 2PHOA 4RHLA 1TBJA 4GWCA 5EEIA 3EWFA 1T69A 3NIQA 3E6KA 1HQGA 2EF4A 4HWWA 4IXVA 5EF8A 4HXQA 1CEVA 4QA0A 4IU4A 1T5GA 4QA3A 3Q9CA 2VCGA 4Q3VA 1C3PA 1C3SA 1P8SA 5EFKB 3EZPA 4IU1A 4RHJA 3PZLA 1ZZ1A 3E9BA 3GN0A 3MMRA 4ITYA 4GSZA 3LP4A 2VQJA 3F06A 5G0HA 4FCIA 3SL1A 5G0IA 3SL0A 1HQ5A 3E8QA 5G0XA 2VQQA 1PQ3A 4QA4A 2EIVA 5EENA 1T64A 2CEVA 2VQVA 4RHKA 3THJA 4ZUMA 1T4SA 5RLAA 1ZZ3A 3KV2A 1VKGA 1R1OA 1XFKA 4MYNA 4IE1A 4ZUQA 5IX0A 3SJTA 5DC5A 4CEVA 4Q3RA 3MFVA 4LXZA 3C0YA 4MYLA 5HJAA 3F80A 5G0YA 4IE3A 4GSVA 2PLLA 5EFHA 5THUA 4Q3UA 1HQHA 1T5FA 5THTA 3MZ3A 1ZPGA 5EEFA 1P8RA 5G13A 4I06A 1T4PA 3Q9BA 5DC8A 3Q9FA 3NIPA 1T67A 3RLAA 5G11A 4RN0A 3MAXA 2VQMA 3TF3A 3MENA 1D3VA 5HJ9A 2GH6A 4Q3TA 4RHQA 4GSMA 4MYFA 5EFJD 4CQFA 1WVBA 5G12A 3RQDA 3C0ZA 1T4RA 5LI3A 3M1RA 2V5WA 2VQWG 3EW8A 3MFWA 5FUEA 1C3RA 3LHLA 3ZNRA 4FCKA 5G3WA 1P8PA 3MZ4A 5JI5A 2EF5A 4QA7A 4CBTA 4BZ5A 1TBHA 5EF7A 2A0MA 5IWGA 4ZUPA 4Q3SA 1GQ6A 1GQ7A 5CEVA 5G0GA 2PHAA 4DZ4A 5EFBD 4G3HA 1T4TA 5G1CA 3MZ7A 2V5XA 5G1AA 3E6VA 1P8NA 4MYKA 1TBLA 5THSA 4LY1A 4Q42A 1WVAA 2RLAA 3F0RA 3F07A 5G0JA 4Q41A 4IXUA 1P8QA 4Q3PA 5DC7A 4IE2A 1HQXA 3MJLA 5D1DA 4BZ9A 3E8ZA 2AEBA 2VQOA 3C10A 4QA2A 3NIOA 4RN1A 4ZUNA 4Q40A 4QA1A 4MXRA 5G10A 5G1BA 4BZ8A 4QA5A 3ZNSA 3SKKA 5EFGA 4QA6A 3EZTA 4IU5A 1HQFA 1WOGA 4RN2A 3SFHA 4IU0A 4A69A 5EFNA 4ZURA 2ZAVA 5A2SA 5ICNB 1ZZ0A 5G17A 1WOIA 3TH7A 3SFFA 5DC6A 5EEMA 3MZ6A 3GMZA 4HZEA 3DJ8A 4RHMA 4CBYA
chains in the Genus database with same CATH topology
1P8MA 4GWDA 3THHA 4Q3RC 1RLAA 1TA1A 3LP7A 4RHIA 4RLAA 4Q3QA 1P8OA 3CEVA 1WOHA 1ZPEA 3THEA 2PHOA 4RHLA 1TBJA 4GWCA 3NIQA 3E6KA 1HQGA 2EF4A 4HWWA 4IXVA 4HXQA 1CEVA 4IU4A 1T5GA 4Q3VA 1P8SA 4IU1A 4RHJA 3PZLA 3E9BA 3GN0A 3MMRA 4ITYA 4GSZA 3LP4A 4FCIA 3SL1A 3SL0A 1HQ5A 3E8QA 1PQ3A 2EIVA 2CEVA 4RHKA 3THJA 5RLAA 1T4SA 3KV2A 1XFKA 1R1OA 4MYNA 4IE1A 3SJTA 4CEVA 4Q3RA 3MFVA 4MYLA 5HJAA 3F80A 4IE3A 4GSVA 2PLLA 4Q3UA 1HQHA 1T5FA 1ZPGA 1P8RA 4I06A 1T4PA 3NIPA 3RLAA 3TF3A 1D3VA 5HJ9A 4Q3TA 4RHQA 4GSMA 4MYFA 1WVBA 1T4RA 3M1RA 3MFWA 3LHLA 4FCKA 1P8PA 2EF5A 1TBHA 2A0MA 4Q3SA 1GQ7A 1GQ6A 5CEVA 2PHAA 4DZ4A 4G3HA 1T4TA 3E6VA 1P8NA 4MYKA 1TBLA 4Q42A 1WVAA 2RLAA 4Q41A 4IXUA 1P8QA 4Q3PA 4IE2A 1HQXA 3MJLA 3E8ZA 2AEBA 3NIOA 4Q40A 4MXRA 3SKKA 4IU5A 1HQFA 1WOGA 4IU0A 2ZAVA 1WOIA 3TH7A 3GMZA 4HZEA 3DJ8A 4RHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8M A;  4GWD A;  3THH A;  4Q3R C;  1RLA A;  1TA1 A;  3LP7 A;  4RHI A;  4RLA A;  4Q3Q A;  1P8O A;  3CEV A;  1WOH A;  1ZPE A;  3THE A;  2PHO A;  4RHL A;  1TBJ A;  4GWC A;  3NIQ A;  3E6K A;  1HQG A;  2EF4 A;  4HWW A;  4IXV A;  4HXQ A;  1CEV A;  4IU4 A;  1T5G A;  4Q3V A;  1P8S A;  4IU1 A;  4RHJ A;  3PZL A;  3E9B A;  3GN0 A;  3MMR A;  4ITY A;  4GSZ A;  3LP4 A;  4FCI A;  3SL1 A;  3SL0 A;  1HQ5 A;  3E8Q A;  1PQ3 A;  2EIV A;  2CEV A;  4RHK A;  3THJ A;  5RLA A;  1T4S A;  3KV2 A;  1XFK A;  1R1O A;  4MYN A;  4IE1 A;  3SJT A;  4CEV A;  4Q3R A;  3MFV A;  4MYL A;  5HJA A;  3F80 A;  4IE3 A;  4GSV A;  2PLL A;  4Q3U A;  1HQH A;  1T5F A;  1ZPG A;  1P8R A;  4I06 A;  1T4P A;  3NIP A;  3RLA A;  3TF3 A;  1D3V A;  5HJ9 A;  4Q3T A;  4RHQ A;  4GSM A;  4MYF A;  1WVB A;  1T4R A;  3M1R A;  3MFW A;  3LHL A;  4FCK A;  1P8P A;  2EF5 A;  1TBH A;  2A0M A;  4Q3S A;  1GQ7 A;  1GQ6 A;  5CEV A;  2PHA A;  4DZ4 A;  4G3H A;  1T4T A;  3E6V A;  1P8N A;  4MYK A;  1TBL A;  4Q42 A;  1WVA A;  2RLA A;  4Q41 A;  4IXU A;  1P8Q A;  4Q3P A;  4IE2 A;  1HQX A;  3MJL A;  3E8Z A;  2AEB A;  3NIO A;  4Q40 A;  4MXR A;  3SKK A;  4IU5 A;  1HQF A;  1WOG A;  4IU0 A;  2ZAV A;  1WOI A;  3TH7 A;  3GMZ A;  4HZE A;  3DJ8 A;  4RHM A; 
#chains in the Genus database with same CATH topology
 1P8M A;  4GWD A;  3THH A;  4BZ7 A;  4Q3R C;  1RLA A;  5FCW A;  5D1B A;  5D1C A;  1TA1 A;  3LP7 A;  4RHI A;  4RLA A;  4BKX B;  3Q9E A;  4Q3Q A;  5THV A;  1P8O A;  1W22 A;  3CEV A;  1WOH A;  4BZ6 A;  4ZUO A;  1ZPE A;  5EEK A;  5BWZ A;  3THE A;  2PHO A;  4RHL A;  1TBJ A;  4GWC A;  5EEI A;  3EWF A;  1T69 A;  3NIQ A;  3E6K A;  1HQG A;  2EF4 A;  4HWW A;  4IXV A;  5EF8 A;  4HXQ A;  1CEV A;  4QA0 A;  4IU4 A;  1T5G A;  4QA3 A;  3Q9C A;  2VCG A;  4Q3V A;  1C3P A;  1C3S A;  1P8S A;  5EFK B;  3EZP A;  4IU1 A;  4RHJ A;  3PZL A;  1ZZ1 A;  3E9B A;  3GN0 A;  3MMR A;  4ITY A;  4GSZ A;  3LP4 A;  2VQJ A;  3F06 A;  5G0H A;  4FCI A;  3SL1 A;  5G0I A;  3SL0 A;  1HQ5 A;  3E8Q A;  5G0X A;  2VQQ A;  1PQ3 A;  4QA4 A;  2EIV A;  5EEN A;  1T64 A;  2CEV A;  2VQV A;  4RHK A;  3THJ A;  4ZUM A;  1T4S A;  5RLA A;  1ZZ3 A;  3KV2 A;  1VKG A;  1R1O A;  1XFK A;  4MYN A;  4IE1 A;  4ZUQ A;  5IX0 A;  3SJT A;  5DC5 A;  4CEV A;  4Q3R A;  3MFV A;  4LXZ A;  3C0Y A;  4MYL A;  5HJA A;  3F80 A;  5G0Y A;  4IE3 A;  4GSV A;  2PLL A;  5EFH A;  5THU A;  4Q3U A;  1HQH A;  1T5F A;  5THT A;  3MZ3 A;  1ZPG A;  5EEF A;  1P8R A;  5G13 A;  4I06 A;  1T4P A;  3Q9B A;  5DC8 A;  3Q9F A;  3NIP A;  1T67 A;  3RLA A;  5G11 A;  4RN0 A;  3MAX A;  2VQM A;  3TF3 A;  3MEN A;  1D3V A;  5HJ9 A;  2GH6 A;  4Q3T A;  4RHQ A;  4GSM A;  4MYF A;  5EFJ D;  4CQF A;  1WVB A;  5G12 A;  3RQD A;  3C0Z A;  1T4R A;  5LI3 A;  3M1R A;  2V5W A;  2VQW G;  3EW8 A;  3MFW A;  5FUE A;  1C3R A;  3LHL A;  3ZNR A;  4FCK A;  5G3W A;  1P8P A;  3MZ4 A;  5JI5 A;  2EF5 A;  4QA7 A;  4CBT A;  4BZ5 A;  1TBH A;  5EF7 A;  2A0M A;  5IWG A;  4ZUP A;  4Q3S A;  1GQ6 A;  1GQ7 A;  5CEV A;  5G0G A;  2PHA A;  4DZ4 A;  5EFB D;  4G3H A;  1T4T A;  5G1C A;  3MZ7 A;  2V5X A;  5G1A A;  3E6V A;  1P8N A;  4MYK A;  1TBL A;  5THS A;  4LY1 A;  4Q42 A;  1WVA A;  2RLA A;  3F0R A;  3F07 A;  5G0J A;  4Q41 A;  4IXU A;  1P8Q A;  4Q3P A;  5DC7 A;  4IE2 A;  1HQX A;  3MJL A;  5D1D A;  4BZ9 A;  3E8Z A;  2AEB A;  2VQO A;  3C10 A;  4QA2 A;  3NIO A;  4RN1 A;  4ZUN A;  4Q40 A;  4QA1 A;  4MXR A;  5G10 A;  5G1B A;  4BZ8 A;  4QA5 A;  3ZNS A;  3SKK A;  5EFG A;  4QA6 A;  3EZT A;  4IU5 A;  1HQF A;  1WOG A;  4RN2 A;  3SFH A;  4IU0 A;  4A69 A;  5EFN A;  4ZUR A;  2ZAV A;  5A2S A;  5ICN B;  1ZZ0 A;  5G17 A;  1WOI A;  3TH7 A;  3SFF A;  5DC6 A;  5EEM A;  3MZ6 A;  3GMZ A;  4HZE A;  3DJ8 A;  4RHM A;  4CBY A; 
#chains in the Genus database with same CATH homology
 1P8M A;  4GWD A;  3THH A;  4Q3R C;  1RLA A;  1TA1 A;  3LP7 A;  4RHI A;  4RLA A;  4Q3Q A;  1P8O A;  3CEV A;  1WOH A;  1ZPE A;  3THE A;  2PHO A;  4RHL A;  1TBJ A;  4GWC A;  3NIQ A;  3E6K A;  1HQG A;  2EF4 A;  4HWW A;  4IXV A;  4HXQ A;  1CEV A;  4IU4 A;  1T5G A;  4Q3V A;  1P8S A;  4IU1 A;  4RHJ A;  3PZL A;  3E9B A;  3GN0 A;  3MMR A;  4ITY A;  4GSZ A;  3LP4 A;  4FCI A;  3SL1 A;  3SL0 A;  1HQ5 A;  3E8Q A;  1PQ3 A;  2EIV A;  2CEV A;  4RHK A;  3THJ A;  5RLA A;  1T4S A;  3KV2 A;  1XFK A;  1R1O A;  4MYN A;  4IE1 A;  3SJT A;  4CEV A;  4Q3R A;  3MFV A;  4MYL A;  5HJA A;  3F80 A;  4IE3 A;  4GSV A;  2PLL A;  4Q3U A;  1HQH A;  1T5F A;  1ZPG A;  1P8R A;  4I06 A;  1T4P A;  3NIP A;  3RLA A;  3TF3 A;  1D3V A;  5HJ9 A;  4Q3T A;  4RHQ A;  4GSM A;  4MYF A;  1WVB A;  1T4R A;  3M1R A;  3MFW A;  3LHL A;  4FCK A;  1P8P A;  2EF5 A;  1TBH A;  2A0M A;  4Q3S A;  1GQ7 A;  1GQ6 A;  5CEV A;  2PHA A;  4DZ4 A;  4G3H A;  1T4T A;  3E6V A;  1P8N A;  4MYK A;  1TBL A;  4Q42 A;  1WVA A;  2RLA A;  4Q41 A;  4IXU A;  1P8Q A;  4Q3P A;  4IE2 A;  1HQX A;  3MJL A;  3E8Z A;  2AEB A;  3NIO A;  4Q40 A;  4MXR A;  3SKK A;  4IU5 A;  1HQF A;  1WOG A;  4IU0 A;  2ZAV A;  1WOI A;  3TH7 A;  3GMZ A;  4HZE A;  3DJ8 A;  4RHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...