4GWCA

Crystal structure of mn2+2,zn2+-human arginase i
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Structure and function of non-native metal clusters in human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2012-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4gwcA00
1ZPGA 3LP4A 3THJA 4Q3RC 1WVBA 2PHAA 3SL1A 3DJ8A 1TA1A 1HQGA 4IXUA 3E6KA 4FCKA 1T5GA 2ZAVA 2CEVA 4MYKA 4GWCA 3MFVA 4MYLA 1P8RA 4RHIA 4IE1A 4IU5A 3RLAA 2AEBA 3MMRA 3E9BA 3LHLA 3TF3A 2PHOA 4I06A 4GSVA 1P8SA 3E8ZA 4CEVA 4FCIA 3NIPA 4RHMA 3MFWA 1P8MA 3F80A 1P8PA 4RHJA 2RLAA 1CEVA 3LP7A 1TBLA 4Q3PA 4IXVA 3THEA 1T4TA 1TBJA 4IE2A 4Q40A 1D3VA 1WVAA 4IE3A 1WOHA 4IU1A 3PZLA 5HJAA 4HXQA 4IU0A 1TBHA 3NIQA 2A0MA 3NIOA 1T4RA 4Q3VA 4Q41A 1HQXA 3E6VA 1XFKA 4RHQA 4GSZA 4Q3SA 3TH7A 4Q3QA 2EF5A 4MYFA 1GQ7A 2PLLA 3M1RA 4RHKA 4Q3RA 4G3HA 1HQFA 1PQ3A 1R1OA 1ZPEA 4MYNA 3SKKA 1RLAA 3KV2A 5HJ9A 3THHA 4IU4A 2EIVA 4Q3TA 1WOIA 3GMZA 3GN0A 1HQHA 4Q42A 4DZ4A 1HQ5A 1WOGA 1P8OA 1P8NA 1GQ6A 4MXRA 4Q3UA 3SJTA 4RHLA 3SL0A 3CEVA 3MJLA 5CEVA 4ITYA 5RLAA 2EF4A 4GWDA 4RLAA 1T5FA 4HWWA 1T4PA 3E8QA 1P8QA 4HZEA 1T4SA 4GSMA
chains in the Genus database with same CATH superfamily
4CBTA 1ZPGA 3LP4A 5G0HA 3Q9EA 3THJA 5A2SA 4Q3RC 5G3WA 4A69A 1WVBA 2PHAA 2VQMA 3SL1A 3DJ8A 5JI5A 1TA1A 3Q9FA 4BZ6A 4QA4A 5G12A 5ICNB 1HQGA 4IXUA 3E6KA 4FCKA 1T5GA 2ZAVA 4RN0A 2CEVA 4MYKA 5IWGA 5THSA 4GWCA 3MFVA 4MYLA 4ZUOA 1P8RA 2GH6A 3F07A 4RHIA 5IX0A 2V5XA 4IE1A 3MZ3A 2AEBA 3F0RA 3MMRA 3E9BA 3LHLA 4IU5A 5EEKA 3RLAA 5EEIA 3TF3A 2PHOA 4I06A 4GSVA 1P8SA 3E8ZA 4CEVA 4FCIA 1C3PA 5G1AA 3Q9CA 3NIPA 5EEFA 4BZ8A 4ZUQA 4LXZA 4Q41A 2VQOA 4RHMA 3MFWA 3EWFA 1P8MA 4QA5A 3F80A 1P8PA 4CBYA 3ZNRA 4RHJA 4BKXB 2RLAA 5G0GA 1CEVA 4QA0A 3LP7A 5G10A 1TBLA 4Q3PA 3MZ7A 4IXVA 4QA1A 5EEMA 5THUA 5EFNA 3THEA 1T4TA 1TBJA 3MENA 4IE2A 4Q40A 1D3VA 1WVAA 4IE3A 1C3RA 1WOHA 3EZPA 4IU1A 3PZLA 5HJAA 4CQFA 4HXQA 3ZNSA 4BZ5A 4QA7A 5G0YA 3C0ZA 2V5WA 4IU0A 2VQVA 5G13A 3MZ6A 1TBHA 1ZZ3A 2A0MA 3MZ4A 3NIOA 3NIQA 4QA3A 1T4RA 1T64A 3F06A 1T69A 1HQXA 3E6VA 1XFKA 4Q3VA 4GSZA 4Q3SA 1VKGA 4RHQA 5DC7A 5EF8A 3MAXA 4RN2A 3TH7A 4Q3QA 3RQDA 2EF5A 4QA6A 5EFBD 5FUEA 4MYFA 1GQ7A 1C3SA 2PLLA 2VQWG 3M1RA 4RHKA 4Q3RA 4G3HA 4QA2A 1HQFA 5EENA 1PQ3A 5G1BA 1R1OA 3EZTA 1ZPEA 5G0IA 4ZUNA 5LI3A 4MYNA 4ZUMA 3C10A 3SKKA 4BZ7A 1RLAA 5DC5A 2VQQA 3KV2A 1W22A 5FCWA 5HJ9A 3THHA 4IU4A 2EIVA 5BWZA 5G0JA 4ZURA 4Q3TA 3SFHA 1WOIA 3EW8A 3GMZA 5D1CA 3GN0A 5DC8A 1HQHA 4Q42A 4DZ4A 1HQ5A 5EF7A 1WOGA 1P8OA 1P8NA 2VCGA 5D1BA 1GQ6A 4MXRA 1ZZ0A 4Q3UA 4BZ9A 5D1DA 4LY1A 3SJTA 4RHLA 3SL0A 3CEVA 3MJLA 5EFHA 4ZUPA 5G0XA 5CEVA 5DC6A 4ITYA 3C0YA 5G1CA 5RLAA 3SFFA 5EFJD 2EF4A 1ZZ1A 4GWDA 4RLAA 1T5FA 4HWWA 3Q9BA 1T4PA 5G17A 3E8QA 5EFGA 1T67A 1P8QA 5THVA 4RN1A 4HZEA 5G11A 1T4SA 5THTA 2VQJA 4GSMA 5EFKB
chains in the Genus database with same CATH topology
1ZPGA 3LP4A 3THJA 4Q3RC 1WVBA 2PHAA 3SL1A 3DJ8A 1TA1A 1HQGA 4IXUA 3E6KA 4FCKA 1T5GA 2ZAVA 2CEVA 4MYKA 4GWCA 3MFVA 4MYLA 1P8RA 4RHIA 4IE1A 4IU5A 3RLAA 2AEBA 3MMRA 3E9BA 3LHLA 3TF3A 2PHOA 4I06A 4GSVA 1P8SA 3E8ZA 4CEVA 4FCIA 3NIPA 4RHMA 3MFWA 1P8MA 3F80A 1P8PA 4RHJA 2RLAA 1CEVA 3LP7A 1TBLA 4Q3PA 4IXVA 3THEA 1T4TA 1TBJA 4IE2A 4Q40A 1D3VA 1WVAA 4IE3A 1WOHA 4IU1A 3PZLA 5HJAA 4HXQA 4IU0A 1TBHA 3NIQA 2A0MA 3NIOA 1T4RA 4Q3VA 4Q41A 1HQXA 3E6VA 1XFKA 4RHQA 4GSZA 4Q3SA 3TH7A 4Q3QA 2EF5A 4MYFA 1GQ7A 2PLLA 3M1RA 4RHKA 4Q3RA 4G3HA 1HQFA 1PQ3A 1R1OA 1ZPEA 4MYNA 3SKKA 1RLAA 3KV2A 5HJ9A 3THHA 4IU4A 2EIVA 4Q3TA 1WOIA 3GMZA 3GN0A 1HQHA 4Q42A 4DZ4A 1HQ5A 1WOGA 1P8OA 1P8NA 1GQ6A 4MXRA 4Q3UA 3SJTA 4RHLA 3SL0A 3CEVA 3MJLA 5CEVA 4ITYA 5RLAA 2EF4A 4GWDA 4RLAA 1T5FA 4HWWA 1T4PA 3E8QA 1P8QA 4HZEA 1T4SA 4GSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZPG A;  3LP4 A;  3THJ A;  4Q3R C;  1WVB A;  2PHA A;  3SL1 A;  3DJ8 A;  1TA1 A;  1HQG A;  4IXU A;  3E6K A;  4FCK A;  1T5G A;  2ZAV A;  2CEV A;  4MYK A;  4GWC A;  3MFV A;  4MYL A;  1P8R A;  4RHI A;  4IE1 A;  4IU5 A;  3RLA A;  2AEB A;  3MMR A;  3E9B A;  3LHL A;  3TF3 A;  2PHO A;  4I06 A;  4GSV A;  1P8S A;  3E8Z A;  4CEV A;  4FCI A;  3NIP A;  4RHM A;  3MFW A;  1P8M A;  3F80 A;  1P8P A;  4RHJ A;  2RLA A;  1CEV A;  3LP7 A;  1TBL A;  4Q3P A;  4IXV A;  3THE A;  1T4T A;  1TBJ A;  4IE2 A;  4Q40 A;  1D3V A;  1WVA A;  4IE3 A;  1WOH A;  4IU1 A;  3PZL A;  5HJA A;  4HXQ A;  4IU0 A;  1TBH A;  3NIQ A;  2A0M A;  3NIO A;  1T4R A;  4Q3V A;  4Q41 A;  1HQX A;  3E6V A;  1XFK A;  4RHQ A;  4GSZ A;  4Q3S A;  3TH7 A;  4Q3Q A;  2EF5 A;  4MYF A;  1GQ7 A;  2PLL A;  3M1R A;  4RHK A;  4Q3R A;  4G3H A;  1HQF A;  1PQ3 A;  1R1O A;  1ZPE A;  4MYN A;  3SKK A;  1RLA A;  3KV2 A;  5HJ9 A;  3THH A;  4IU4 A;  2EIV A;  4Q3T A;  1WOI A;  3GMZ A;  3GN0 A;  1HQH A;  4Q42 A;  4DZ4 A;  1HQ5 A;  1WOG A;  1P8O A;  1P8N A;  1GQ6 A;  4MXR A;  4Q3U A;  3SJT A;  4RHL A;  3SL0 A;  3CEV A;  3MJL A;  5CEV A;  4ITY A;  5RLA A;  2EF4 A;  4GWD A;  4RLA A;  1T5F A;  4HWW A;  1T4P A;  3E8Q A;  1P8Q A;  4HZE A;  1T4S A;  4GSM A; 
#chains in the Genus database with same CATH topology
 4CBT A;  1ZPG A;  3LP4 A;  5G0H A;  3Q9E A;  3THJ A;  5A2S A;  4Q3R C;  5G3W A;  4A69 A;  1WVB A;  2PHA A;  2VQM A;  3SL1 A;  3DJ8 A;  5JI5 A;  1TA1 A;  3Q9F A;  4BZ6 A;  4QA4 A;  5G12 A;  5ICN B;  1HQG A;  4IXU A;  3E6K A;  4FCK A;  1T5G A;  2ZAV A;  4RN0 A;  2CEV A;  4MYK A;  5IWG A;  5THS A;  4GWC A;  3MFV A;  4MYL A;  4ZUO A;  1P8R A;  2GH6 A;  3F07 A;  4RHI A;  5IX0 A;  2V5X A;  4IE1 A;  3MZ3 A;  2AEB A;  3F0R A;  3MMR A;  3E9B A;  3LHL A;  4IU5 A;  5EEK A;  3RLA A;  5EEI A;  3TF3 A;  2PHO A;  4I06 A;  4GSV A;  1P8S A;  3E8Z A;  4CEV A;  4FCI A;  1C3P A;  5G1A A;  3Q9C A;  3NIP A;  5EEF A;  4BZ8 A;  4ZUQ A;  4LXZ A;  4Q41 A;  2VQO A;  4RHM A;  3MFW A;  3EWF A;  1P8M A;  4QA5 A;  3F80 A;  1P8P A;  4CBY A;  3ZNR A;  4RHJ A;  4BKX B;  2RLA A;  5G0G A;  1CEV A;  4QA0 A;  3LP7 A;  5G10 A;  1TBL A;  4Q3P A;  3MZ7 A;  4IXV A;  4QA1 A;  5EEM A;  5THU A;  5EFN A;  3THE A;  1T4T A;  1TBJ A;  3MEN A;  4IE2 A;  4Q40 A;  1D3V A;  1WVA A;  4IE3 A;  1C3R A;  1WOH A;  3EZP A;  4IU1 A;  3PZL A;  5HJA A;  4CQF A;  4HXQ A;  3ZNS A;  4BZ5 A;  4QA7 A;  5G0Y A;  3C0Z A;  2V5W A;  4IU0 A;  2VQV A;  5G13 A;  3MZ6 A;  1TBH A;  1ZZ3 A;  2A0M A;  3MZ4 A;  3NIO A;  3NIQ A;  4QA3 A;  1T4R A;  1T64 A;  3F06 A;  1T69 A;  1HQX A;  3E6V A;  1XFK A;  4Q3V A;  4GSZ A;  4Q3S A;  1VKG A;  4RHQ A;  5DC7 A;  5EF8 A;  3MAX A;  4RN2 A;  3TH7 A;  4Q3Q A;  3RQD A;  2EF5 A;  4QA6 A;  5EFB D;  5FUE A;  4MYF A;  1GQ7 A;  1C3S A;  2PLL A;  2VQW G;  3M1R A;  4RHK A;  4Q3R A;  4G3H A;  4QA2 A;  1HQF A;  5EEN A;  1PQ3 A;  5G1B A;  1R1O A;  3EZT A;  1ZPE A;  5G0I A;  4ZUN A;  5LI3 A;  4MYN A;  4ZUM A;  3C10 A;  3SKK A;  4BZ7 A;  1RLA A;  5DC5 A;  2VQQ A;  3KV2 A;  1W22 A;  5FCW A;  5HJ9 A;  3THH A;  4IU4 A;  2EIV A;  5BWZ A;  5G0J A;  4ZUR A;  4Q3T A;  3SFH A;  1WOI A;  3EW8 A;  3GMZ A;  5D1C A;  3GN0 A;  5DC8 A;  1HQH A;  4Q42 A;  4DZ4 A;  1HQ5 A;  5EF7 A;  1WOG A;  1P8O A;  1P8N A;  2VCG A;  5D1B A;  1GQ6 A;  4MXR A;  1ZZ0 A;  4Q3U A;  4BZ9 A;  5D1D A;  4LY1 A;  3SJT A;  4RHL A;  3SL0 A;  3CEV A;  3MJL A;  5EFH A;  4ZUP A;  5G0X A;  5CEV A;  5DC6 A;  4ITY A;  3C0Y A;  5G1C A;  5RLA A;  3SFF A;  5EFJ D;  2EF4 A;  1ZZ1 A;  4GWD A;  4RLA A;  1T5F A;  4HWW A;  3Q9B A;  1T4P A;  5G17 A;  3E8Q A;  5EFG A;  1T67 A;  1P8Q A;  5THV A;  4RN1 A;  4HZE A;  5G11 A;  1T4S A;  5THT A;  2VQJ A;  4GSM A;  5EFK B; 
#chains in the Genus database with same CATH homology
 1ZPG A;  3LP4 A;  3THJ A;  4Q3R C;  1WVB A;  2PHA A;  3SL1 A;  3DJ8 A;  1TA1 A;  1HQG A;  4IXU A;  3E6K A;  4FCK A;  1T5G A;  2ZAV A;  2CEV A;  4MYK A;  4GWC A;  3MFV A;  4MYL A;  1P8R A;  4RHI A;  4IE1 A;  4IU5 A;  3RLA A;  2AEB A;  3MMR A;  3E9B A;  3LHL A;  3TF3 A;  2PHO A;  4I06 A;  4GSV A;  1P8S A;  3E8Z A;  4CEV A;  4FCI A;  3NIP A;  4RHM A;  3MFW A;  1P8M A;  3F80 A;  1P8P A;  4RHJ A;  2RLA A;  1CEV A;  3LP7 A;  1TBL A;  4Q3P A;  4IXV A;  3THE A;  1T4T A;  1TBJ A;  4IE2 A;  4Q40 A;  1D3V A;  1WVA A;  4IE3 A;  1WOH A;  4IU1 A;  3PZL A;  5HJA A;  4HXQ A;  4IU0 A;  1TBH A;  3NIQ A;  2A0M A;  3NIO A;  1T4R A;  4Q3V A;  4Q41 A;  1HQX A;  3E6V A;  1XFK A;  4RHQ A;  4GSZ A;  4Q3S A;  3TH7 A;  4Q3Q A;  2EF5 A;  4MYF A;  1GQ7 A;  2PLL A;  3M1R A;  4RHK A;  4Q3R A;  4G3H A;  1HQF A;  1PQ3 A;  1R1O A;  1ZPE A;  4MYN A;  3SKK A;  1RLA A;  3KV2 A;  5HJ9 A;  3THH A;  4IU4 A;  2EIV A;  4Q3T A;  1WOI A;  3GMZ A;  3GN0 A;  1HQH A;  4Q42 A;  4DZ4 A;  1HQ5 A;  1WOG A;  1P8O A;  1P8N A;  1GQ6 A;  4MXR A;  4Q3U A;  3SJT A;  4RHL A;  3SL0 A;  3CEV A;  3MJL A;  5CEV A;  4ITY A;  5RLA A;  2EF4 A;  4GWD A;  4RLA A;  1T5F A;  4HWW A;  1T4P A;  3E8Q A;  1P8Q A;  4HZE A;  1T4S A;  4GSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...