1T4SA

Arginase-l-valine complex
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Inhibitor coordination interactions in the binuclear manganese cluster of arginase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 108
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1t4sA00
3F80A 4IE2A 4Q3RA 3E6VA 4Q3PA 4Q3UA 3THEA 2CEVA 1P8SA 4DZ4A 1P8QA 4HZEA 4RHQA 1CEVA 3MJLA 1T4SA 1XFKA 4IE1A 1HQXA 3SL1A 2EF5A 4HXQA 4RLAA 1GQ7A 3MFWA 2PLLA 3E8QA 4RHLA 3GMZA 1P8PA 3NIPA 4GWDA 4MYFA 1GQ6A 1TBJA 1WVAA 3LHLA 1T5FA 1R1OA 4Q41A 4IU0A 4Q3SA 4I06A 4RHKA 2PHOA 1RLAA 1WOHA 3MMRA 1HQ5A 1WVBA 2EIVA 3SL0A 3E8ZA 5RLAA 3THJA 1T4RA 3LP7A 5HJAA 1TBHA 1P8NA 4FCKA 4IU1A 3SJTA 4GSZA 3DJ8A 2RLAA 4IU4A 3TF3A 4MYKA 3PZLA 4CEVA 2A0MA 4Q3TA 2EF4A 3M1RA 4IXUA 3MFVA 1T4TA 3KV2A 4IXVA 3E9BA 2PHAA 3RLAA 4Q42A 5CEVA 4RHMA 3NIQA 2ZAVA 1T5GA 1T4PA 4GSVA 4HWWA 5HJ9A 1TA1A 3CEVA 4FCIA 4Q40A 3NIOA 3LP4A 4Q3RC 1P8RA 4RHJA 4RHIA 1ZPGA 2AEBA 4IU5A 1TBLA 4GWCA 4MYLA 1WOGA 1D3VA 3TH7A 3E6KA 1P8OA 1HQGA 4IE3A 1WOIA 4MYNA 3SKKA 1P8MA 4GSMA 4MXRA 1HQFA 4Q3QA 1HQHA 3THHA 3GN0A 4ITYA 4G3HA 1PQ3A 1ZPEA 4Q3VA
chains in the Genus database with same CATH superfamily
3F80A 4IE2A 5DC5A 3EZPA 4Q3RA 3E6VA 4Q3PA 3C0ZA 4Q3UA 3THEA 1ZZ0A 2CEVA 1P8SA 2VQVA 4DZ4A 1P8QA 4HZEA 4RHQA 1CEVA 3EWFA 3MJLA 5JI5A 5IX0A 1T4SA 1XFKA 4IE1A 5EFHA 5EFBD 1HQXA 3SL1A 3MZ6A 2EF5A 4HXQA 4RN0A 4RN2A 4RLAA 1GQ7A 4BKXB 4QA0A 3MFWA 4LXZA 5D1CA 2PLLA 2VQOA 3E8QA 4RHLA 2VQQA 3GMZA 1P8PA 3NIPA 3Q9FA 4GWDA 5EENA 5G0JA 3ZNRA 1C3RA 4QA1A 4MYFA 1GQ6A 5G1AA 3MZ7A 1TBJA 4LY1A 5EEKA 4BZ8A 1WVAA 5G12A 5A2SA 3LHLA 1T5FA 4CBTA 1R1OA 1ZZ3A 4Q41A 3Q9BA 3Q9EA 4IU0A 4Q3SA 3ZNSA 4I06A 4RHKA 2PHOA 1RLAA 5THTA 4ZUOA 1WOHA 2GH6A 3MMRA 5G0IA 1HQ5A 1WVBA 5IWGA 5THUA 2EIVA 5THVA 5EF7A 3SL0A 3E8ZA 5RLAA 3MENA 4BZ9A 3THJA 3F06A 1T4RA 2VCGA 3LP7A 3EW8A 5HJAA 1TBHA 1P8NA 1T64A 4FCKA 4IU1A 5G1CA 4GSZA 5EEFA 3SJTA 4ZUQA 5FUEA 5DC6A 5EFJD 3DJ8A 2RLAA 4IU4A 4QA3A 1C3PA 4ZUMA 3TF3A 4MYKA 3PZLA 5DC7A 4CEVA 2A0MA 5EFGA 4Q3TA 2EF4A 4QA6A 4QA2A 5EFNA 3M1RA 3C10A 4IXUA 3SFFA 3MFVA 4QA7A 1T4TA 3KV2A 4IXVA 5FCWA 3E9BA 4QA4A 4BZ5A 2PHAA 3Q9CA 5BWZA 5ICNB 3RLAA 4RN1A 4Q42A 5G11A 4RHMA 2VQWG 2VQMA 5CEVA 5G17A 3F07A 3NIQA 2ZAVA 1T5GA 5EF8A 3SFHA 1T4PA 4ZURA 4A69A 3MZ4A 4GSVA 3MZ3A 5D1BA 4HWWA 5EFKB 5HJ9A 1TA1A 3CEVA 4FCIA 2V5WA 3C0YA 3NIOA 3LP4A 4Q3RC 1P8RA 4Q40A 4RHJA 5G0HA 4RHIA 1ZPGA 2AEBA 4IU5A 1VKGA 1TBLA 5G13A 4GWCA 4MYLA 1WOGA 1D3VA 4ZUNA 5LI3A 3RQDA 3E6KA 3TH7A 1P8OA 1HQGA 5G0XA 5G0GA 5G3WA 4IE3A 1T69A 1WOIA 5G0YA 4MYNA 4BZ6A 5THSA 4ZUPA 3SKKA 1P8MA 2VQJA 4GSMA 4MXRA 1T67A 1HQFA 4CBYA 3F0RA 4Q3QA 1HQHA 1C3SA 1ZZ1A 2V5XA 4QA5A 3GN0A 3MAXA 5EEIA 5G1BA 5G10A 3THHA 1W22A 4BZ7A 4ITYA 4G3HA 3EZTA 1PQ3A 1ZPEA 5D1DA 5DC8A 4Q3VA 5EEMA 4CQFA
chains in the Genus database with same CATH topology
3F80A 4IE2A 4Q3RA 3E6VA 4Q3PA 4Q3UA 3THEA 2CEVA 1P8SA 4DZ4A 1P8QA 4HZEA 4RHQA 1CEVA 3MJLA 1T4SA 1XFKA 4IE1A 1HQXA 3SL1A 2EF5A 4HXQA 4RLAA 1GQ7A 3MFWA 2PLLA 3E8QA 4RHLA 3GMZA 1P8PA 3NIPA 4GWDA 4MYFA 1GQ6A 1TBJA 1WVAA 3LHLA 1T5FA 1R1OA 4Q41A 4IU0A 4Q3SA 4I06A 4RHKA 2PHOA 1RLAA 1WOHA 3MMRA 1HQ5A 1WVBA 2EIVA 3SL0A 3E8ZA 5RLAA 3THJA 1T4RA 3LP7A 5HJAA 1TBHA 1P8NA 4FCKA 4IU1A 3SJTA 4GSZA 3DJ8A 2RLAA 4IU4A 3TF3A 4MYKA 3PZLA 4CEVA 2A0MA 4Q3TA 2EF4A 3M1RA 4IXUA 3MFVA 1T4TA 3KV2A 4IXVA 3E9BA 2PHAA 3RLAA 4Q42A 5CEVA 4RHMA 3NIQA 2ZAVA 1T5GA 1T4PA 4GSVA 4HWWA 5HJ9A 1TA1A 3CEVA 4FCIA 4Q40A 3NIOA 3LP4A 4Q3RC 1P8RA 4RHJA 4RHIA 1ZPGA 2AEBA 4IU5A 1TBLA 4GWCA 4MYLA 1WOGA 1D3VA 3TH7A 3E6KA 1P8OA 1HQGA 4IE3A 1WOIA 4MYNA 3SKKA 1P8MA 4GSMA 4MXRA 1HQFA 4Q3QA 1HQHA 3THHA 3GN0A 4ITYA 4G3HA 1PQ3A 1ZPEA 4Q3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F80 A;  4IE2 A;  4Q3R A;  3E6V A;  4Q3P A;  4Q3U A;  3THE A;  2CEV A;  1P8S A;  4DZ4 A;  1P8Q A;  4HZE A;  4RHQ A;  1CEV A;  3MJL A;  1T4S A;  1XFK A;  4IE1 A;  1HQX A;  3SL1 A;  2EF5 A;  4HXQ A;  4RLA A;  1GQ7 A;  3MFW A;  2PLL A;  3E8Q A;  4RHL A;  3GMZ A;  1P8P A;  3NIP A;  4GWD A;  4MYF A;  1GQ6 A;  1TBJ A;  1WVA A;  3LHL A;  1T5F A;  1R1O A;  4Q41 A;  4IU0 A;  4Q3S A;  4I06 A;  4RHK A;  2PHO A;  1RLA A;  1WOH A;  3MMR A;  1HQ5 A;  1WVB A;  2EIV A;  3SL0 A;  3E8Z A;  5RLA A;  3THJ A;  1T4R A;  3LP7 A;  5HJA A;  1TBH A;  1P8N A;  4FCK A;  4IU1 A;  3SJT A;  4GSZ A;  3DJ8 A;  2RLA A;  4IU4 A;  3TF3 A;  4MYK A;  3PZL A;  4CEV A;  2A0M A;  4Q3T A;  2EF4 A;  3M1R A;  4IXU A;  3MFV A;  1T4T A;  3KV2 A;  4IXV A;  3E9B A;  2PHA A;  3RLA A;  4Q42 A;  5CEV A;  4RHM A;  3NIQ A;  2ZAV A;  1T5G A;  1T4P A;  4GSV A;  4HWW A;  5HJ9 A;  1TA1 A;  3CEV A;  4FCI A;  4Q40 A;  3NIO A;  3LP4 A;  4Q3R C;  1P8R A;  4RHJ A;  4RHI A;  1ZPG A;  2AEB A;  4IU5 A;  1TBL A;  4GWC A;  4MYL A;  1WOG A;  1D3V A;  3TH7 A;  3E6K A;  1P8O A;  1HQG A;  4IE3 A;  1WOI A;  4MYN A;  3SKK A;  1P8M A;  4GSM A;  4MXR A;  1HQF A;  4Q3Q A;  1HQH A;  3THH A;  3GN0 A;  4ITY A;  4G3H A;  1PQ3 A;  1ZPE A;  4Q3V A; 
#chains in the Genus database with same CATH topology
 3F80 A;  4IE2 A;  5DC5 A;  3EZP A;  4Q3R A;  3E6V A;  4Q3P A;  3C0Z A;  4Q3U A;  3THE A;  1ZZ0 A;  2CEV A;  1P8S A;  2VQV A;  4DZ4 A;  1P8Q A;  4HZE A;  4RHQ A;  1CEV A;  3EWF A;  3MJL A;  5JI5 A;  5IX0 A;  1T4S A;  1XFK A;  4IE1 A;  5EFH A;  5EFB D;  1HQX A;  3SL1 A;  3MZ6 A;  2EF5 A;  4HXQ A;  4RN0 A;  4RN2 A;  4RLA A;  1GQ7 A;  4BKX B;  4QA0 A;  3MFW A;  4LXZ A;  5D1C A;  2PLL A;  2VQO A;  3E8Q A;  4RHL A;  2VQQ A;  3GMZ A;  1P8P A;  3NIP A;  3Q9F A;  4GWD A;  5EEN A;  5G0J A;  3ZNR A;  1C3R A;  4QA1 A;  4MYF A;  1GQ6 A;  5G1A A;  3MZ7 A;  1TBJ A;  4LY1 A;  5EEK A;  4BZ8 A;  1WVA A;  5G12 A;  5A2S A;  3LHL A;  1T5F A;  4CBT A;  1R1O A;  1ZZ3 A;  4Q41 A;  3Q9B A;  3Q9E A;  4IU0 A;  4Q3S A;  3ZNS A;  4I06 A;  4RHK A;  2PHO A;  1RLA A;  5THT A;  4ZUO A;  1WOH A;  2GH6 A;  3MMR A;  5G0I A;  1HQ5 A;  1WVB A;  5IWG A;  5THU A;  2EIV A;  5THV A;  5EF7 A;  3SL0 A;  3E8Z A;  5RLA A;  3MEN A;  4BZ9 A;  3THJ A;  3F06 A;  1T4R A;  2VCG A;  3LP7 A;  3EW8 A;  5HJA A;  1TBH A;  1P8N A;  1T64 A;  4FCK A;  4IU1 A;  5G1C A;  4GSZ A;  5EEF A;  3SJT A;  4ZUQ A;  5FUE A;  5DC6 A;  5EFJ D;  3DJ8 A;  2RLA A;  4IU4 A;  4QA3 A;  1C3P A;  4ZUM A;  3TF3 A;  4MYK A;  3PZL A;  5DC7 A;  4CEV A;  2A0M A;  5EFG A;  4Q3T A;  2EF4 A;  4QA6 A;  4QA2 A;  5EFN A;  3M1R A;  3C10 A;  4IXU A;  3SFF A;  3MFV A;  4QA7 A;  1T4T A;  3KV2 A;  4IXV A;  5FCW A;  3E9B A;  4QA4 A;  4BZ5 A;  2PHA A;  3Q9C A;  5BWZ A;  5ICN B;  3RLA A;  4RN1 A;  4Q42 A;  5G11 A;  4RHM A;  2VQW G;  2VQM A;  5CEV A;  5G17 A;  3F07 A;  3NIQ A;  2ZAV A;  1T5G A;  5EF8 A;  3SFH A;  1T4P A;  4ZUR A;  4A69 A;  3MZ4 A;  4GSV A;  3MZ3 A;  5D1B A;  4HWW A;  5EFK B;  5HJ9 A;  1TA1 A;  3CEV A;  4FCI A;  2V5W A;  3C0Y A;  3NIO A;  3LP4 A;  4Q3R C;  1P8R A;  4Q40 A;  4RHJ A;  5G0H A;  4RHI A;  1ZPG A;  2AEB A;  4IU5 A;  1VKG A;  1TBL A;  5G13 A;  4GWC A;  4MYL A;  1WOG A;  1D3V A;  4ZUN A;  5LI3 A;  3RQD A;  3E6K A;  3TH7 A;  1P8O A;  1HQG A;  5G0X A;  5G0G A;  5G3W A;  4IE3 A;  1T69 A;  1WOI A;  5G0Y A;  4MYN A;  4BZ6 A;  5THS A;  4ZUP A;  3SKK A;  1P8M A;  2VQJ A;  4GSM A;  4MXR A;  1T67 A;  1HQF A;  4CBY A;  3F0R A;  4Q3Q A;  1HQH A;  1C3S A;  1ZZ1 A;  2V5X A;  4QA5 A;  3GN0 A;  3MAX A;  5EEI A;  5G1B A;  5G10 A;  3THH A;  1W22 A;  4BZ7 A;  4ITY A;  4G3H A;  3EZT A;  1PQ3 A;  1ZPE A;  5D1D A;  5DC8 A;  4Q3V A;  5EEM A;  4CQF A; 
#chains in the Genus database with same CATH homology
 3F80 A;  4IE2 A;  4Q3R A;  3E6V A;  4Q3P A;  4Q3U A;  3THE A;  2CEV A;  1P8S A;  4DZ4 A;  1P8Q A;  4HZE A;  4RHQ A;  1CEV A;  3MJL A;  1T4S A;  1XFK A;  4IE1 A;  1HQX A;  3SL1 A;  2EF5 A;  4HXQ A;  4RLA A;  1GQ7 A;  3MFW A;  2PLL A;  3E8Q A;  4RHL A;  3GMZ A;  1P8P A;  3NIP A;  4GWD A;  4MYF A;  1GQ6 A;  1TBJ A;  1WVA A;  3LHL A;  1T5F A;  1R1O A;  4Q41 A;  4IU0 A;  4Q3S A;  4I06 A;  4RHK A;  2PHO A;  1RLA A;  1WOH A;  3MMR A;  1HQ5 A;  1WVB A;  2EIV A;  3SL0 A;  3E8Z A;  5RLA A;  3THJ A;  1T4R A;  3LP7 A;  5HJA A;  1TBH A;  1P8N A;  4FCK A;  4IU1 A;  3SJT A;  4GSZ A;  3DJ8 A;  2RLA A;  4IU4 A;  3TF3 A;  4MYK A;  3PZL A;  4CEV A;  2A0M A;  4Q3T A;  2EF4 A;  3M1R A;  4IXU A;  3MFV A;  1T4T A;  3KV2 A;  4IXV A;  3E9B A;  2PHA A;  3RLA A;  4Q42 A;  5CEV A;  4RHM A;  3NIQ A;  2ZAV A;  1T5G A;  1T4P A;  4GSV A;  4HWW A;  5HJ9 A;  1TA1 A;  3CEV A;  4FCI A;  4Q40 A;  3NIO A;  3LP4 A;  4Q3R C;  1P8R A;  4RHJ A;  4RHI A;  1ZPG A;  2AEB A;  4IU5 A;  1TBL A;  4GWC A;  4MYL A;  1WOG A;  1D3V A;  3TH7 A;  3E6K A;  1P8O A;  1HQG A;  4IE3 A;  1WOI A;  4MYN A;  3SKK A;  1P8M A;  4GSM A;  4MXR A;  1HQF A;  4Q3Q A;  1HQH A;  3THH A;  3GN0 A;  4ITY A;  4G3H A;  1PQ3 A;  1ZPE A;  4Q3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...