1T4SA

Arginase-l-valine complex
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
b'KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Inhibitor coordination interactions in the binuclear manganese cluster of arginase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 108
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1t4sA00
4RHQA 3E8ZA 1T4RA 4MYKA 1TA1A 3GN0A 3MFWA 4IE1A 2EF4A 1ZPEA 4G3HA 4Q3VA 5CEVA 3DJ8A 2AEBA 4RHKA 4Q3RC 3SKKA 3RLAA 3E6VA 3LP7A 5HJ9A 1RLAA 4HXQA 1P8NA 1PQ3A 4CEVA 3TH7A 1D3VA 4MYNA 3GMZA 4IU4A 3CEVA 4Q42A 4HWWA 3LP4A 2ZAVA 3THHA 1HQHA 3MMRA 4IE2A 3SL0A 2A0MA 4IXUA 4ITYA 3NIOA 4Q3QA 1HQ5A 4IU5A 3THJA 4GSMA 4Q41A 1WVAA 3F80A 3KV2A 1WOIA 1WOHA 4RHMA 3SJTA 1T4SA 1P8PA 3E8QA 1T5FA 2CEVA 4RHLA 1R1OA 3THEA 4IE3A 1P8MA 1P8RA 3TF3A 4MYFA 3SL1A 2PHOA 1P8OA 1HQFA 4DZ4A 4Q3TA 1XFKA 3MJLA 3MFVA 4I06A 1TBLA 4IXVA 4Q3UA 4GSVA 3NIPA 4FCKA 4RHJA 4FCIA 4RLAA 1CEVA 4Q3PA 2PLLA 3M1RA 5RLAA 2RLAA 4MXRA 1T4PA 4GWDA 3LHLA 2EIVA 1WVBA 3E6KA 1T4TA 1T5GA 1ZPGA 2EF5A 1WOGA 4MYLA 4Q3SA 1TBHA 4RHIA 5HJAA 3E9BA 4HZEA 3PZLA 1GQ7A 1TBJA 4IU0A 1HQXA 1P8QA 1GQ6A 4GWCA 4Q40A 1HQGA 1P8SA 2PHAA 4IU1A 4Q3RA 4GSZA 3NIQA
chains in the Genus database with same CATH superfamily
4RHQA 4QA3A 3E8ZA 5IX0A 3MZ4A 5G1CA 3Q9CA 1T4RA 4BZ9A 4MYKA 1TA1A 5G17A 3GN0A 3MFWA 4IE1A 4BZ8A 3MAXA 2EF4A 1ZPEA 3MZ7A 4G3HA 3MZ3A 4Q3VA 3F0RA 4CBYA 5EFGA 5THTA 5DC7A 3MZ6A 3DJ8A 2AEBA 4RHKA 5CEVA 4Q3RC 4ZUQA 3SKKA 4ZUOA 5ICNB 4BZ6A 3RLAA 3E6VA 3LP7A 4ZUNA 5HJ9A 5JI5A 1ZZ3A 1RLAA 4HXQA 1P8NA 1PQ3A 4CEVA 4BKXB 4RN1A 5DC5A 5G1BA 1D3VA 3TH7A 4MYNA 3EWFA 1ZZ0A 3GMZA 4IU4A 3CEVA 4Q42A 5D1BA 3C0ZA 5FUEA 4HWWA 1C3SA 5G12A 3LP4A 3ZNRA 2ZAVA 5EFHA 3THHA 1HQHA 3MMRA 3C0YA 2VQQA 2VQOA 2A0MA 4IE2A 4ITYA 4IXUA 3NIOA 4QA0A 5IWGA 4Q3QA 1HQ5A 4IU5A 5THUA 3RQDA 3THJA 4GSMA 4Q41A 1WVAA 3F80A 3KV2A 1WOIA 1WOHA 3EW8A 4RHMA 4QA4A 1C3RA 3SJTA 5G0IA 2VQMA 1T4SA 2VCGA 1ZZ1A 5EF7A 1P8PA 5THVA 5EEKA 3E8QA 5G0HA 1T5FA 2CEVA 2GH6A 1T64A 4ZURA 5LI3A 4RHLA 1R1OA 3THEA 4IE3A 1P8MA 4QA1A 1P8RA 3TF3A 4MYFA 3SL1A 3SFHA 2PHOA 1P8OA 1HQFA 4RN2A 4Q3TA 4DZ4A 4QA7A 4CQFA 5G3WA 1XFKA 3MJLA 3EZTA 3MFVA 4I06A 1TBLA 5A2SA 4IXVA 4Q3UA 4GSVA 3NIPA 4QA5A 4LY1A 4FCKA 4RHJA 3MENA 4FCIA 5EFJD 4RLAA 4BZ7A 5EFKB 5G0GA 1CEVA 4Q3PA 2PLLA 5DC8A 3M1RA 1W22A 5EEMA 5RLAA 2RLAA 4MXRA 4QA2A 5EFNA 3Q9FA 5EEIA 5G10A 1VKGA 5G0JA 1T4PA 4LXZA 3F06A 2V5WA 5EFBD 3EZPA 4GWDA 3LHLA 5D1CA 5EEFA 2EIVA 2VQJA 1WVBA 3SL0A 5G13A 5EENA 3E6KA 4A69A 3SFFA 1T4TA 1T5GA 1ZPGA 2EF5A 1WOGA 4MYLA 5FCWA 5THSA 2VQVA 4RN0A 5D1DA 1C3PA 4Q3SA 1TBHA 3Q9EA 5G1AA 4RHIA 5HJAA 3E9BA 4HZEA 4QA6A 5G0XA 3Q9BA 5G11A 3PZLA 1GQ7A 5G0YA 4CBTA 1TBJA 4IU0A 5BWZA 1HQXA 1T69A 2V5XA 1P8QA 1GQ6A 4GWCA 5DC6A 4Q40A 1HQGA 3F07A 5EF8A 3C10A 1P8SA 3ZNSA 2VQWG 4BZ5A 1T67A 2PHAA 4IU1A 4ZUMA 4ZUPA 4Q3RA 4GSZA 3NIQA
chains in the Genus database with same CATH topology
4RHQA 3E8ZA 1T4RA 4MYKA 1TA1A 3GN0A 3MFWA 4IE1A 2EF4A 1ZPEA 4G3HA 4Q3VA 5CEVA 3DJ8A 2AEBA 4RHKA 4Q3RC 3SKKA 3RLAA 3E6VA 3LP7A 5HJ9A 1RLAA 4HXQA 1P8NA 1PQ3A 4CEVA 3TH7A 1D3VA 4MYNA 3GMZA 4IU4A 3CEVA 4Q42A 4HWWA 3LP4A 2ZAVA 3THHA 1HQHA 3MMRA 4IE2A 3SL0A 2A0MA 4IXUA 4ITYA 3NIOA 4Q3QA 1HQ5A 4IU5A 3THJA 4GSMA 4Q41A 1WVAA 3F80A 3KV2A 1WOIA 1WOHA 4RHMA 3SJTA 1T4SA 1P8PA 3E8QA 1T5FA 2CEVA 4RHLA 1R1OA 3THEA 4IE3A 1P8MA 1P8RA 3TF3A 4MYFA 3SL1A 2PHOA 1P8OA 1HQFA 4DZ4A 4Q3TA 1XFKA 3MJLA 3MFVA 4I06A 1TBLA 4IXVA 4Q3UA 4GSVA 3NIPA 4FCKA 4RHJA 4FCIA 4RLAA 1CEVA 4Q3PA 2PLLA 3M1RA 5RLAA 2RLAA 4MXRA 1T4PA 4GWDA 3LHLA 2EIVA 1WVBA 3E6KA 1T4TA 1T5GA 1ZPGA 2EF5A 1WOGA 4MYLA 4Q3SA 1TBHA 4RHIA 5HJAA 3E9BA 4HZEA 3PZLA 1GQ7A 1TBJA 4IU0A 1HQXA 1P8QA 1GQ6A 4GWCA 4Q40A 1HQGA 1P8SA 2PHAA 4IU1A 4Q3RA 4GSZA 3NIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHQ A;  3E8Z A;  1T4R A;  4MYK A;  1TA1 A;  3GN0 A;  3MFW A;  4IE1 A;  2EF4 A;  1ZPE A;  4G3H A;  4Q3V A;  5CEV A;  3DJ8 A;  2AEB A;  4RHK A;  4Q3R C;  3SKK A;  3RLA A;  3E6V A;  3LP7 A;  5HJ9 A;  1RLA A;  4HXQ A;  1P8N A;  1PQ3 A;  4CEV A;  3TH7 A;  1D3V A;  4MYN A;  3GMZ A;  4IU4 A;  3CEV A;  4Q42 A;  4HWW A;  3LP4 A;  2ZAV A;  3THH A;  1HQH A;  3MMR A;  4IE2 A;  3SL0 A;  2A0M A;  4IXU A;  4ITY A;  3NIO A;  4Q3Q A;  1HQ5 A;  4IU5 A;  3THJ A;  4GSM A;  4Q41 A;  1WVA A;  3F80 A;  3KV2 A;  1WOI A;  1WOH A;  4RHM A;  3SJT A;  1T4S A;  1P8P A;  3E8Q A;  1T5F A;  2CEV A;  4RHL A;  1R1O A;  3THE A;  4IE3 A;  1P8M A;  1P8R A;  3TF3 A;  4MYF A;  3SL1 A;  2PHO A;  1P8O A;  1HQF A;  4DZ4 A;  4Q3T A;  1XFK A;  3MJL A;  3MFV A;  4I06 A;  1TBL A;  4IXV A;  4Q3U A;  4GSV A;  3NIP A;  4FCK A;  4RHJ A;  4FCI A;  4RLA A;  1CEV A;  4Q3P A;  2PLL A;  3M1R A;  5RLA A;  2RLA A;  4MXR A;  1T4P A;  4GWD A;  3LHL A;  2EIV A;  1WVB A;  3E6K A;  1T4T A;  1T5G A;  1ZPG A;  2EF5 A;  1WOG A;  4MYL A;  4Q3S A;  1TBH A;  4RHI A;  5HJA A;  3E9B A;  4HZE A;  3PZL A;  1GQ7 A;  1TBJ A;  4IU0 A;  1HQX A;  1P8Q A;  1GQ6 A;  4GWC A;  4Q40 A;  1HQG A;  1P8S A;  2PHA A;  4IU1 A;  4Q3R A;  4GSZ A;  3NIQ A; 
#chains in the Genus database with same CATH topology
 4RHQ A;  4QA3 A;  3E8Z A;  5IX0 A;  3MZ4 A;  5G1C A;  3Q9C A;  1T4R A;  4BZ9 A;  4MYK A;  1TA1 A;  5G17 A;  3GN0 A;  3MFW A;  4IE1 A;  4BZ8 A;  3MAX A;  2EF4 A;  1ZPE A;  3MZ7 A;  4G3H A;  3MZ3 A;  4Q3V A;  3F0R A;  4CBY A;  5EFG A;  5THT A;  5DC7 A;  3MZ6 A;  3DJ8 A;  2AEB A;  4RHK A;  5CEV A;  4Q3R C;  4ZUQ A;  3SKK A;  4ZUO A;  5ICN B;  4BZ6 A;  3RLA A;  3E6V A;  3LP7 A;  4ZUN A;  5HJ9 A;  5JI5 A;  1ZZ3 A;  1RLA A;  4HXQ A;  1P8N A;  1PQ3 A;  4CEV A;  4BKX B;  4RN1 A;  5DC5 A;  5G1B A;  1D3V A;  3TH7 A;  4MYN A;  3EWF A;  1ZZ0 A;  3GMZ A;  4IU4 A;  3CEV A;  4Q42 A;  5D1B A;  3C0Z A;  5FUE A;  4HWW A;  1C3S A;  5G12 A;  3LP4 A;  3ZNR A;  2ZAV A;  5EFH A;  3THH A;  1HQH A;  3MMR A;  3C0Y A;  2VQQ A;  2VQO A;  2A0M A;  4IE2 A;  4ITY A;  4IXU A;  3NIO A;  4QA0 A;  5IWG A;  4Q3Q A;  1HQ5 A;  4IU5 A;  5THU A;  3RQD A;  3THJ A;  4GSM A;  4Q41 A;  1WVA A;  3F80 A;  3KV2 A;  1WOI A;  1WOH A;  3EW8 A;  4RHM A;  4QA4 A;  1C3R A;  3SJT A;  5G0I A;  2VQM A;  1T4S A;  2VCG A;  1ZZ1 A;  5EF7 A;  1P8P A;  5THV A;  5EEK A;  3E8Q A;  5G0H A;  1T5F A;  2CEV A;  2GH6 A;  1T64 A;  4ZUR A;  5LI3 A;  4RHL A;  1R1O A;  3THE A;  4IE3 A;  1P8M A;  4QA1 A;  1P8R A;  3TF3 A;  4MYF A;  3SL1 A;  3SFH A;  2PHO A;  1P8O A;  1HQF A;  4RN2 A;  4Q3T A;  4DZ4 A;  4QA7 A;  4CQF A;  5G3W A;  1XFK A;  3MJL A;  3EZT A;  3MFV A;  4I06 A;  1TBL A;  5A2S A;  4IXV A;  4Q3U A;  4GSV A;  3NIP A;  4QA5 A;  4LY1 A;  4FCK A;  4RHJ A;  3MEN A;  4FCI A;  5EFJ D;  4RLA A;  4BZ7 A;  5EFK B;  5G0G A;  1CEV A;  4Q3P A;  2PLL A;  5DC8 A;  3M1R A;  1W22 A;  5EEM A;  5RLA A;  2RLA A;  4MXR A;  4QA2 A;  5EFN A;  3Q9F A;  5EEI A;  5G10 A;  1VKG A;  5G0J A;  1T4P A;  4LXZ A;  3F06 A;  2V5W A;  5EFB D;  3EZP A;  4GWD A;  3LHL A;  5D1C A;  5EEF A;  2EIV A;  2VQJ A;  1WVB A;  3SL0 A;  5G13 A;  5EEN A;  3E6K A;  4A69 A;  3SFF A;  1T4T A;  1T5G A;  1ZPG A;  2EF5 A;  1WOG A;  4MYL A;  5FCW A;  5THS A;  2VQV A;  4RN0 A;  5D1D A;  1C3P A;  4Q3S A;  1TBH A;  3Q9E A;  5G1A A;  4RHI A;  5HJA A;  3E9B A;  4HZE A;  4QA6 A;  5G0X A;  3Q9B A;  5G11 A;  3PZL A;  1GQ7 A;  5G0Y A;  4CBT A;  1TBJ A;  4IU0 A;  5BWZ A;  1HQX A;  1T69 A;  2V5X A;  1P8Q A;  1GQ6 A;  4GWC A;  5DC6 A;  4Q40 A;  1HQG A;  3F07 A;  5EF8 A;  3C10 A;  1P8S A;  3ZNS A;  2VQW G;  4BZ5 A;  1T67 A;  2PHA A;  4IU1 A;  4ZUM A;  4ZUP A;  4Q3R A;  4GSZ A;  3NIQ A; 
#chains in the Genus database with same CATH homology
 4RHQ A;  3E8Z A;  1T4R A;  4MYK A;  1TA1 A;  3GN0 A;  3MFW A;  4IE1 A;  2EF4 A;  1ZPE A;  4G3H A;  4Q3V A;  5CEV A;  3DJ8 A;  2AEB A;  4RHK A;  4Q3R C;  3SKK A;  3RLA A;  3E6V A;  3LP7 A;  5HJ9 A;  1RLA A;  4HXQ A;  1P8N A;  1PQ3 A;  4CEV A;  3TH7 A;  1D3V A;  4MYN A;  3GMZ A;  4IU4 A;  3CEV A;  4Q42 A;  4HWW A;  3LP4 A;  2ZAV A;  3THH A;  1HQH A;  3MMR A;  4IE2 A;  3SL0 A;  2A0M A;  4IXU A;  4ITY A;  3NIO A;  4Q3Q A;  1HQ5 A;  4IU5 A;  3THJ A;  4GSM A;  4Q41 A;  1WVA A;  3F80 A;  3KV2 A;  1WOI A;  1WOH A;  4RHM A;  3SJT A;  1T4S A;  1P8P A;  3E8Q A;  1T5F A;  2CEV A;  4RHL A;  1R1O A;  3THE A;  4IE3 A;  1P8M A;  1P8R A;  3TF3 A;  4MYF A;  3SL1 A;  2PHO A;  1P8O A;  1HQF A;  4DZ4 A;  4Q3T A;  1XFK A;  3MJL A;  3MFV A;  4I06 A;  1TBL A;  4IXV A;  4Q3U A;  4GSV A;  3NIP A;  4FCK A;  4RHJ A;  4FCI A;  4RLA A;  1CEV A;  4Q3P A;  2PLL A;  3M1R A;  5RLA A;  2RLA A;  4MXR A;  1T4P A;  4GWD A;  3LHL A;  2EIV A;  1WVB A;  3E6K A;  1T4T A;  1T5G A;  1ZPG A;  2EF5 A;  1WOG A;  4MYL A;  4Q3S A;  1TBH A;  4RHI A;  5HJA A;  3E9B A;  4HZE A;  3PZL A;  1GQ7 A;  1TBJ A;  4IU0 A;  1HQX A;  1P8Q A;  1GQ6 A;  4GWC A;  4Q40 A;  1HQG A;  1P8S A;  2PHA A;  4IU1 A;  4Q3R A;  4GSZ A;  3NIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...