1WOGA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
303
structure length
303
Chain Sequence
b'GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agmatinase
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 114
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1wogA00
2PHAA 4RHQA 3TH7A 4Q41A 1P8RA 4RHMA 3SL0A 2RLAA 4IE1A 4IE3A 4GSZA 1WOGA 4IU0A 3F80A 1HQGA 1HQHA 3TF3A 4Q3VA 3E6KA 4GWCA 1P8OA 3LHLA 4HXQA 1CEVA 1T4PA 1WOHA 4RLAA 3MFVA 3LP7A 2CEVA 4Q40A 1TBLA 4IXVA 4RHKA 1T5GA 4IU1A 3E8QA 2AEBA 3E9BA 4CEVA 1HQXA 1RLAA 2A0MA 4IXUA 4GWDA 3THHA 1T4TA 4IU5A 3NIOA 1T4SA 3THJA 3M1RA 1R1OA 4MYKA 2PLLA 1WOIA 3SJTA 3KV2A 1WVAA 4IU4A 4Q3RA 3GN0A 2ZAVA 3MJLA 1T4RA 4FCKA 1P8NA 1P8SA 3NIQA 4Q3SA 1ZPEA 1GQ7A 1P8QA 5HJAA 4GSMA 3E8ZA 3THEA 1P8MA 5CEVA 3SKKA 4MYLA 4Q3TA 1HQFA 4Q42A 3MFWA 1ZPGA 3E6VA 4HWWA 2PHOA 4HZEA 4RHIA 3SL1A 1GQ6A 2EF4A 2EIVA 3CEVA 4Q3RC 4MXRA 3PZLA 4MYNA 4I06A 3LP4A 3NIPA 1D3VA 1XFKA 1HQ5A 4Q3QA 4Q3PA 4DZ4A 4Q3UA 1PQ3A 1P8PA 1WVBA 4MYFA 4RHJA 3MMRA 2EF5A 4G3HA 5HJ9A 4RHLA 3RLAA 1TBJA 4IE2A 3DJ8A 4ITYA 1T5FA 3GMZA 1TBHA 5RLAA 4GSVA 4FCIA 1TA1A
chains in the Genus database with same CATH superfamily
3C10A 1C3PA 2PHAA 4RHQA 3TH7A 1P8RA 1VKGA 4RHMA 3SL0A 4Q41A 4QA4A 4ZUOA 1ZZ3A 2RLAA 4IE1A 4IE3A 4GSZA 1WOGA 5G11A 3Q9EA 4IU0A 5ICNB 1T64A 3MZ6A 2VQQA 3Q9BA 5D1DA 5EEIA 1ZZ0A 5LI3A 3F80A 1HQGA 1HQHA 3MZ3A 3TF3A 3MZ4A 4ZUNA 3Q9FA 4Q3VA 3E6KA 2GH6A 4GWCA 3F0RA 1P8OA 2V5WA 3LHLA 3SFHA 1T67A 4HXQA 3EZPA 1CEVA 2VQOA 1T4PA 1WOHA 3MENA 5DC8A 4CBYA 4QA1A 4RLAA 5G12A 5DC5A 5EFBD 3MFVA 5G13A 3LP7A 2CEVA 4Q40A 3EWFA 2VQWG 3Q9CA 3RQDA 1TBLA 4IXVA 4RHKA 1T5GA 2V5XA 3SJTA 4IU1A 3E8QA 4ZUQA 2AEBA 2VQJA 3F07A 3MZ7A 3E9BA 4ZURA 4CEVA 4QA5A 1HQXA 1RLAA 2A0MA 4IXUA 5EEKA 5EFKB 3EW8A 4GWDA 3THHA 1T4TA 4IU5A 3NIOA 5THSA 1C3RA 1T4SA 3C0YA 3THJA 1T69A 3M1RA 1R1OA 4MYKA 4RN2A 3ZNSA 4BZ9A 5BWZA 5EF8A 5D1CA 2PLLA 2VQVA 1WOIA 5G10A 3KV2A 1WVAA 4IU4A 4RN0A 4ZUPA 3MAXA 3F06A 4QA2A 4Q3RA 5IX0A 3GN0A 2ZAVA 3MJLA 5FCWA 4BZ5A 1T4RA 3EZTA 4FCKA 5DC6A 5G0JA 1P8NA 1P8SA 3NIQA 5EEFA 4Q3SA 1ZPEA 1GQ7A 1P8QA 5G0HA 5THVA 5HJAA 4GSMA 5G3WA 3E8ZA 3THEA 5EEMA 1P8MA 4QA3A 5G0XA 5CEVA 3SKKA 4MYLA 4Q3TA 5G0YA 5IWGA 4CQFA 1HQFA 4Q42A 3MFWA 1ZPGA 3E6VA 4HWWA 1ZZ1A 2PHOA 4HZEA 4QA7A 1GQ6A 4RHIA 5EFNA 5EENA 5G0IA 3SL1A 2EF4A 2EIVA 5D1BA 5EFGA 4BKXB 3CEVA 4ZUMA 4Q3RC 4QA6A 4MXRA 4A69A 3PZLA 4MYNA 4BZ7A 5EF7A 4I06A 3LP4A 5THTA 1W22A 5EFJD 3NIPA 5G1CA 4BZ6A 5G17A 5THUA 1D3VA 1XFKA 1HQ5A 2VQMA 4Q3QA 4Q3PA 5FUEA 4Q3UA 3SFFA 4DZ4A 1PQ3A 1P8PA 1WVBA 1C3SA 4MYFA 4RHJA 3MMRA 5DC7A 2EF5A 4G3HA 5HJ9A 5G1AA 2VCGA 4RHLA 3ZNRA 4BZ8A 3RLAA 1TBJA 4LXZA 4IE2A 4QA0A 4LY1A 3DJ8A 4ITYA 5G1BA 1T5FA 3GMZA 1TBHA 4RN1A 5RLAA 5JI5A 3C0ZA 5EFHA 5G0GA 4GSVA 4FCIA 5A2SA 4CBTA 1TA1A
chains in the Genus database with same CATH topology
2PHAA 4RHQA 3TH7A 4Q41A 1P8RA 4RHMA 3SL0A 2RLAA 4IE1A 4IE3A 4GSZA 1WOGA 4IU0A 3F80A 1HQGA 1HQHA 3TF3A 4Q3VA 3E6KA 4GWCA 1P8OA 3LHLA 4HXQA 1CEVA 1T4PA 1WOHA 4RLAA 3MFVA 3LP7A 2CEVA 4Q40A 1TBLA 4IXVA 4RHKA 1T5GA 4IU1A 3E8QA 2AEBA 3E9BA 4CEVA 1HQXA 1RLAA 2A0MA 4IXUA 4GWDA 3THHA 1T4TA 4IU5A 3NIOA 1T4SA 3THJA 3M1RA 1R1OA 4MYKA 2PLLA 1WOIA 3SJTA 3KV2A 1WVAA 4IU4A 4Q3RA 3GN0A 2ZAVA 3MJLA 1T4RA 4FCKA 1P8NA 1P8SA 3NIQA 4Q3SA 1ZPEA 1GQ7A 1P8QA 5HJAA 4GSMA 3E8ZA 3THEA 1P8MA 5CEVA 3SKKA 4MYLA 4Q3TA 1HQFA 4Q42A 3MFWA 1ZPGA 3E6VA 4HWWA 2PHOA 4HZEA 4RHIA 3SL1A 1GQ6A 2EF4A 2EIVA 3CEVA 4Q3RC 4MXRA 3PZLA 4MYNA 4I06A 3LP4A 3NIPA 1D3VA 1XFKA 1HQ5A 4Q3QA 4Q3PA 4DZ4A 4Q3UA 1PQ3A 1P8PA 1WVBA 4MYFA 4RHJA 3MMRA 2EF5A 4G3HA 5HJ9A 4RHLA 3RLAA 1TBJA 4IE2A 3DJ8A 4ITYA 1T5FA 3GMZA 1TBHA 5RLAA 4GSVA 4FCIA 1TA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHA A;  4RHQ A;  3TH7 A;  4Q41 A;  1P8R A;  4RHM A;  3SL0 A;  2RLA A;  4IE1 A;  4IE3 A;  4GSZ A;  1WOG A;  4IU0 A;  3F80 A;  1HQG A;  1HQH A;  3TF3 A;  4Q3V A;  3E6K A;  4GWC A;  1P8O A;  3LHL A;  4HXQ A;  1CEV A;  1T4P A;  1WOH A;  4RLA A;  3MFV A;  3LP7 A;  2CEV A;  4Q40 A;  1TBL A;  4IXV A;  4RHK A;  1T5G A;  4IU1 A;  3E8Q A;  2AEB A;  3E9B A;  4CEV A;  1HQX A;  1RLA A;  2A0M A;  4IXU A;  4GWD A;  3THH A;  1T4T A;  4IU5 A;  3NIO A;  1T4S A;  3THJ A;  3M1R A;  1R1O A;  4MYK A;  2PLL A;  1WOI A;  3SJT A;  3KV2 A;  1WVA A;  4IU4 A;  4Q3R A;  3GN0 A;  2ZAV A;  3MJL A;  1T4R A;  4FCK A;  1P8N A;  1P8S A;  3NIQ A;  4Q3S A;  1ZPE A;  1GQ7 A;  1P8Q A;  5HJA A;  4GSM A;  3E8Z A;  3THE A;  1P8M A;  5CEV A;  3SKK A;  4MYL A;  4Q3T A;  1HQF A;  4Q42 A;  3MFW A;  1ZPG A;  3E6V A;  4HWW A;  2PHO A;  4HZE A;  4RHI A;  3SL1 A;  1GQ6 A;  2EF4 A;  2EIV A;  3CEV A;  4Q3R C;  4MXR A;  3PZL A;  4MYN A;  4I06 A;  3LP4 A;  3NIP A;  1D3V A;  1XFK A;  1HQ5 A;  4Q3Q A;  4Q3P A;  4DZ4 A;  4Q3U A;  1PQ3 A;  1P8P A;  1WVB A;  4MYF A;  4RHJ A;  3MMR A;  2EF5 A;  4G3H A;  5HJ9 A;  4RHL A;  3RLA A;  1TBJ A;  4IE2 A;  3DJ8 A;  4ITY A;  1T5F A;  3GMZ A;  1TBH A;  5RLA A;  4GSV A;  4FCI A;  1TA1 A; 
#chains in the Genus database with same CATH topology
 3C10 A;  1C3P A;  2PHA A;  4RHQ A;  3TH7 A;  1P8R A;  1VKG A;  4RHM A;  3SL0 A;  4Q41 A;  4QA4 A;  4ZUO A;  1ZZ3 A;  2RLA A;  4IE1 A;  4IE3 A;  4GSZ A;  1WOG A;  5G11 A;  3Q9E A;  4IU0 A;  5ICN B;  1T64 A;  3MZ6 A;  2VQQ A;  3Q9B A;  5D1D A;  5EEI A;  1ZZ0 A;  5LI3 A;  3F80 A;  1HQG A;  1HQH A;  3MZ3 A;  3TF3 A;  3MZ4 A;  4ZUN A;  3Q9F A;  4Q3V A;  3E6K A;  2GH6 A;  4GWC A;  3F0R A;  1P8O A;  2V5W A;  3LHL A;  3SFH A;  1T67 A;  4HXQ A;  3EZP A;  1CEV A;  2VQO A;  1T4P A;  1WOH A;  3MEN A;  5DC8 A;  4CBY A;  4QA1 A;  4RLA A;  5G12 A;  5DC5 A;  5EFB D;  3MFV A;  5G13 A;  3LP7 A;  2CEV A;  4Q40 A;  3EWF A;  2VQW G;  3Q9C A;  3RQD A;  1TBL A;  4IXV A;  4RHK A;  1T5G A;  2V5X A;  3SJT A;  4IU1 A;  3E8Q A;  4ZUQ A;  2AEB A;  2VQJ A;  3F07 A;  3MZ7 A;  3E9B A;  4ZUR A;  4CEV A;  4QA5 A;  1HQX A;  1RLA A;  2A0M A;  4IXU A;  5EEK A;  5EFK B;  3EW8 A;  4GWD A;  3THH A;  1T4T A;  4IU5 A;  3NIO A;  5THS A;  1C3R A;  1T4S A;  3C0Y A;  3THJ A;  1T69 A;  3M1R A;  1R1O A;  4MYK A;  4RN2 A;  3ZNS A;  4BZ9 A;  5BWZ A;  5EF8 A;  5D1C A;  2PLL A;  2VQV A;  1WOI A;  5G10 A;  3KV2 A;  1WVA A;  4IU4 A;  4RN0 A;  4ZUP A;  3MAX A;  3F06 A;  4QA2 A;  4Q3R A;  5IX0 A;  3GN0 A;  2ZAV A;  3MJL A;  5FCW A;  4BZ5 A;  1T4R A;  3EZT A;  4FCK A;  5DC6 A;  5G0J A;  1P8N A;  1P8S A;  3NIQ A;  5EEF A;  4Q3S A;  1ZPE A;  1GQ7 A;  1P8Q A;  5G0H A;  5THV A;  5HJA A;  4GSM A;  5G3W A;  3E8Z A;  3THE A;  5EEM A;  1P8M A;  4QA3 A;  5G0X A;  5CEV A;  3SKK A;  4MYL A;  4Q3T A;  5G0Y A;  5IWG A;  4CQF A;  1HQF A;  4Q42 A;  3MFW A;  1ZPG A;  3E6V A;  4HWW A;  1ZZ1 A;  2PHO A;  4HZE A;  4QA7 A;  1GQ6 A;  4RHI A;  5EFN A;  5EEN A;  5G0I A;  3SL1 A;  2EF4 A;  2EIV A;  5D1B A;  5EFG A;  4BKX B;  3CEV A;  4ZUM A;  4Q3R C;  4QA6 A;  4MXR A;  4A69 A;  3PZL A;  4MYN A;  4BZ7 A;  5EF7 A;  4I06 A;  3LP4 A;  5THT A;  1W22 A;  5EFJ D;  3NIP A;  5G1C A;  4BZ6 A;  5G17 A;  5THU A;  1D3V A;  1XFK A;  1HQ5 A;  2VQM A;  4Q3Q A;  4Q3P A;  5FUE A;  4Q3U A;  3SFF A;  4DZ4 A;  1PQ3 A;  1P8P A;  1WVB A;  1C3S A;  4MYF A;  4RHJ A;  3MMR A;  5DC7 A;  2EF5 A;  4G3H A;  5HJ9 A;  5G1A A;  2VCG A;  4RHL A;  3ZNR A;  4BZ8 A;  3RLA A;  1TBJ A;  4LXZ A;  4IE2 A;  4QA0 A;  4LY1 A;  3DJ8 A;  4ITY A;  5G1B A;  1T5F A;  3GMZ A;  1TBH A;  4RN1 A;  5RLA A;  5JI5 A;  3C0Z A;  5EFH A;  5G0G A;  4GSV A;  4FCI A;  5A2S A;  4CBT A;  1TA1 A; 
#chains in the Genus database with same CATH homology
 2PHA A;  4RHQ A;  3TH7 A;  4Q41 A;  1P8R A;  4RHM A;  3SL0 A;  2RLA A;  4IE1 A;  4IE3 A;  4GSZ A;  1WOG A;  4IU0 A;  3F80 A;  1HQG A;  1HQH A;  3TF3 A;  4Q3V A;  3E6K A;  4GWC A;  1P8O A;  3LHL A;  4HXQ A;  1CEV A;  1T4P A;  1WOH A;  4RLA A;  3MFV A;  3LP7 A;  2CEV A;  4Q40 A;  1TBL A;  4IXV A;  4RHK A;  1T5G A;  4IU1 A;  3E8Q A;  2AEB A;  3E9B A;  4CEV A;  1HQX A;  1RLA A;  2A0M A;  4IXU A;  4GWD A;  3THH A;  1T4T A;  4IU5 A;  3NIO A;  1T4S A;  3THJ A;  3M1R A;  1R1O A;  4MYK A;  2PLL A;  1WOI A;  3SJT A;  3KV2 A;  1WVA A;  4IU4 A;  4Q3R A;  3GN0 A;  2ZAV A;  3MJL A;  1T4R A;  4FCK A;  1P8N A;  1P8S A;  3NIQ A;  4Q3S A;  1ZPE A;  1GQ7 A;  1P8Q A;  5HJA A;  4GSM A;  3E8Z A;  3THE A;  1P8M A;  5CEV A;  3SKK A;  4MYL A;  4Q3T A;  1HQF A;  4Q42 A;  3MFW A;  1ZPG A;  3E6V A;  4HWW A;  2PHO A;  4HZE A;  4RHI A;  3SL1 A;  1GQ6 A;  2EF4 A;  2EIV A;  3CEV A;  4Q3R C;  4MXR A;  3PZL A;  4MYN A;  4I06 A;  3LP4 A;  3NIP A;  1D3V A;  1XFK A;  1HQ5 A;  4Q3Q A;  4Q3P A;  4DZ4 A;  4Q3U A;  1PQ3 A;  1P8P A;  1WVB A;  4MYF A;  4RHJ A;  3MMR A;  2EF5 A;  4G3H A;  5HJ9 A;  4RHL A;  3RLA A;  1TBJ A;  4IE2 A;  3DJ8 A;  4ITY A;  1T5F A;  3GMZ A;  1TBH A;  5RLA A;  4GSV A;  4FCI A;  1TA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...