4A69A

Structure of hdac3 bound to corepressor and inositol tetraphosphate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
369
structure length
369
Chain Sequence
b'AKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE 3,
publication title Structure of Hdac3 Bound to Co-Repressor and Inositol Tetraphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 137
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 4a69A00
5EEKA 3MZ7A 5DC6A 4A69A 4CBTA 5THTA 3EW8A 4LY1A 3EZPA 5FCWA 3SFHA 5A2SA 1ZZ0A 4ZUPA 4RN2A 4QA5A 5BWZA 5G0GA 5G0IA 2VQJA 2VQQA 4QA4A 5G10A 5EEFA 5G0HA 5EFGA 5EFBD 4QA7A 3EWFA 2VCGA 1C3PA 5FUEA 2VQMA 3SFFA 3MAXA 5G0XA 2V5WA 5LI3A 4BKXB 3MZ6A 5EF7A 4BZ5A 3Q9BA 4ZUOA 3C0ZA 2VQWG 5EFKB 3RQDA 5EFHA 2VQOA 1ZZ1A 4CQFA 4LXZA 3ZNSA 3ZNRA 4ZUMA 5EFNA 5G11A 5D1DA 2GH6A 3EZTA 5G3WA 5EENA 5D1BA 4RN1A 1T64A 5DC7A 3Q9CA 5DC8A 3MZ4A 4BZ6A 1C3SA 1VKGA 5G17A 5D1CA 5G0JA 3F07A 2V5XA 4ZURA 5DC5A 4BZ9A 5JI5A 5EEIA 4ZUNA 4RN0A 1W22A 5IWGA 5G1CA 5G1BA 5G13A 3MZ3A 4QA1A 5ICNB 1C3RA 5THUA 3MENA 3F06A 4QA0A 5G1AA 1T67A 5EF8A 5THSA 4CBYA 3F0RA 4QA3A 1T69A 5G0YA 4BZ7A 5EEMA 1ZZ3A 4QA2A 4ZUQA 5THVA 5G12A 5IX0A 5EFJD 4BZ8A 3Q9FA 2VQVA 3C0YA 3C10A 3Q9EA 4QA6A
chains in the Genus database with same CATH superfamily
2EIVA 3GMZA 2CEVA 1D3VA 4IE3A 5EEKA 3MZ7A 5DC6A 4IU0A 4A69A 4CBTA 2PLLA 1HQXA 4Q3SA 5THTA 3EW8A 4LY1A 2EF5A 3EZPA 5FCWA 3SL1A 2RLAA 3SFHA 1GQ7A 5A2SA 1ZZ0A 4ZUPA 4RN2A 4QA5A 5BWZA 4IU1A 5G0GA 5G0IA 4MYNA 3M1RA 2VQJA 2VQQA 4QA4A 3TH7A 4IXUA 5G10A 1ZPEA 5CEVA 5EEFA 4FCIA 4MYKA 5G0HA 4Q3PA 1GQ6A 5EFGA 5EFBD 4QA7A 1T4TA 5IWGA 3MFWA 3NIOA 1WVBA 3EWFA 2VCGA 4Q3TA 2EF4A 1HQFA 1P8NA 1C3PA 5FUEA 2VQMA 3SFFA 4HXQA 3MJLA 3LP4A 4IU5A 4I06A 4IE1A 1WOGA 3MAXA 5G0XA 3SKKA 2V5WA 5LI3A 4BKXB 3MMRA 1ZPGA 3MZ6A 4GSZA 3E8ZA 2PHAA 4CEVA 5EF7A 4BZ5A 3Q9BA 1P8PA 4ZUOA 4Q42A 3C0ZA 1P8OA 2VQWG 5EFKB 3RQDA 5EFHA 4MYFA 2VQOA 3KV2A 1ZZ1A 4GSMA 4CQFA 4LXZA 3F80A 3ZNSA 3ZNRA 1HQHA 4ZUMA 5EFNA 5G11A 3PZLA 4IXVA 5D1DA 4RHKA 4Q41A 4HZEA 3TF3A 2GH6A 4Q3VA 3EZTA 4Q3RC 1TA1A 5G3WA 4IU4A 1CEVA 5EENA 4FCKA 5D1BA 4GSVA 1T64A 4RN1A 5DC7A 3THEA 1HQ5A 3NIQA 3Q9CA 4Q3UA 1P8QA 5DC8A 3MZ4A 2A0MA 4BZ6A 1C3SA 1VKGA 1WOIA 2ZAVA 3THJA 5G17A 4GWDA 5D1CA 4ITYA 5G0JA 1RLAA 1T5GA 3F07A 2V5XA 4MXRA 4DZ4A 1TBJA 1R1OA 1TBHA 4ZURA 5DC5A 4BZ9A 5JI5A 3GN0A 5EEIA 5HJAA 3E6VA 4ZUNA 1TBLA 3NIPA 4RHJA 4RN0A 3RLAA 1W22A 4RHMA 3E8QA 4GWCA 1P8SA 4RHIA 3E9BA 3LHLA 3MZ3A 4HWWA 4QA1A 5G1CA 5G1BA 4IE2A 5G13A 5ICNB 1WOHA 1C3RA 1WVAA 4MYLA 3MENA 1P8RA 3F06A 5THUA 1T4RA 3MFVA 1HQGA 3LP7A 4QA0A 3SJTA 3THHA 3E6KA 5G1AA 4Q40A 1T4PA 1PQ3A 1T67A 4G3HA 4RHQA 4RLAA 5EF8A 5THSA 4CBYA 1XFKA 3DJ8A 4Q3QA 3F0RA 3CEVA 4QA3A 4Q3RA 1T69A 5G0YA 5HJ9A 1T4SA 4BZ7A 5EEMA 1ZZ3A 3SL0A 4QA2A 4ZUQA 5THVA 2PHOA 1T5FA 5G12A 5IX0A 4RHLA 2AEBA 5EFJD 3Q9FA 2VQVA 3C0YA 3C10A 5RLAA 4BZ8A 3Q9EA 4QA6A 1P8MA
chains in the Genus database with same CATH topology
5EEKA 3MZ7A 5DC6A 4A69A 4CBTA 5THTA 3EW8A 4LY1A 3EZPA 5FCWA 3SFHA 5A2SA 1ZZ0A 4ZUPA 4RN2A 4QA5A 5BWZA 5G0GA 5G0IA 2VQJA 2VQQA 4QA4A 5G10A 5EEFA 5G0HA 5EFGA 5EFBD 4QA7A 3EWFA 2VCGA 1C3PA 5FUEA 2VQMA 3SFFA 3MAXA 5G0XA 2V5WA 5LI3A 4BKXB 3MZ6A 5EF7A 4BZ5A 3Q9BA 4ZUOA 3C0ZA 2VQWG 5EFKB 3RQDA 5EFHA 2VQOA 1ZZ1A 4CQFA 4LXZA 3ZNSA 3ZNRA 4ZUMA 5EFNA 5G11A 5D1DA 2GH6A 3EZTA 5G3WA 5EENA 5D1BA 4RN1A 1T64A 5DC7A 3Q9CA 5DC8A 3MZ4A 4BZ6A 1C3SA 1VKGA 5G17A 5D1CA 5G0JA 3F07A 2V5XA 4ZURA 5DC5A 4BZ9A 5JI5A 5EEIA 4ZUNA 4RN0A 1W22A 5IWGA 5G1CA 5G1BA 5G13A 3MZ3A 4QA1A 5ICNB 1C3RA 5THUA 3MENA 3F06A 4QA0A 5G1AA 1T67A 5EF8A 5THSA 4CBYA 3F0RA 4QA3A 1T69A 5G0YA 4BZ7A 5EEMA 1ZZ3A 4QA2A 4ZUQA 5THVA 5G12A 5IX0A 5EFJD 4BZ8A 3Q9FA 2VQVA 3C0YA 3C10A 3Q9EA 4QA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EEK A;  3MZ7 A;  5DC6 A;  4A69 A;  4CBT A;  5THT A;  3EW8 A;  4LY1 A;  3EZP A;  5FCW A;  3SFH A;  5A2S A;  1ZZ0 A;  4ZUP A;  4RN2 A;  4QA5 A;  5BWZ A;  5G0G A;  5G0I A;  2VQJ A;  2VQQ A;  4QA4 A;  5G10 A;  5EEF A;  5G0H A;  5EFG A;  5EFB D;  4QA7 A;  3EWF A;  2VCG A;  1C3P A;  5FUE A;  2VQM A;  3SFF A;  3MAX A;  5G0X A;  2V5W A;  5LI3 A;  4BKX B;  3MZ6 A;  5EF7 A;  4BZ5 A;  3Q9B A;  4ZUO A;  3C0Z A;  2VQW G;  5EFK B;  3RQD A;  5EFH A;  2VQO A;  1ZZ1 A;  4CQF A;  4LXZ A;  3ZNS A;  3ZNR A;  4ZUM A;  5EFN A;  5G11 A;  5D1D A;  2GH6 A;  3EZT A;  5G3W A;  5EEN A;  5D1B A;  4RN1 A;  1T64 A;  5DC7 A;  3Q9C A;  5DC8 A;  3MZ4 A;  4BZ6 A;  1C3S A;  1VKG A;  5G17 A;  5D1C A;  5G0J A;  3F07 A;  2V5X A;  4ZUR A;  5DC5 A;  4BZ9 A;  5JI5 A;  5EEI A;  4ZUN A;  4RN0 A;  1W22 A;  5IWG A;  5G1C A;  5G1B A;  5G13 A;  3MZ3 A;  4QA1 A;  5ICN B;  1C3R A;  5THU A;  3MEN A;  3F06 A;  4QA0 A;  5G1A A;  1T67 A;  5EF8 A;  5THS A;  4CBY A;  3F0R A;  4QA3 A;  1T69 A;  5G0Y A;  4BZ7 A;  5EEM A;  1ZZ3 A;  4QA2 A;  4ZUQ A;  5THV A;  5G12 A;  5IX0 A;  5EFJ D;  4BZ8 A;  3Q9F A;  2VQV A;  3C0Y A;  3C10 A;  3Q9E A;  4QA6 A; 
#chains in the Genus database with same CATH topology
 2EIV A;  3GMZ A;  2CEV A;  1D3V A;  4IE3 A;  5EEK A;  3MZ7 A;  5DC6 A;  4IU0 A;  4A69 A;  4CBT A;  2PLL A;  1HQX A;  4Q3S A;  5THT A;  3EW8 A;  4LY1 A;  2EF5 A;  3EZP A;  5FCW A;  3SL1 A;  2RLA A;  3SFH A;  1GQ7 A;  5A2S A;  1ZZ0 A;  4ZUP A;  4RN2 A;  4QA5 A;  5BWZ A;  4IU1 A;  5G0G A;  5G0I A;  4MYN A;  3M1R A;  2VQJ A;  2VQQ A;  4QA4 A;  3TH7 A;  4IXU A;  5G10 A;  1ZPE A;  5CEV A;  5EEF A;  4FCI A;  4MYK A;  5G0H A;  4Q3P A;  1GQ6 A;  5EFG A;  5EFB D;  4QA7 A;  1T4T A;  5IWG A;  3MFW A;  3NIO A;  1WVB A;  3EWF A;  2VCG A;  4Q3T A;  2EF4 A;  1HQF A;  1P8N A;  1C3P A;  5FUE A;  2VQM A;  3SFF A;  4HXQ A;  3MJL A;  3LP4 A;  4IU5 A;  4I06 A;  4IE1 A;  1WOG A;  3MAX A;  5G0X A;  3SKK A;  2V5W A;  5LI3 A;  4BKX B;  3MMR A;  1ZPG A;  3MZ6 A;  4GSZ A;  3E8Z A;  2PHA A;  4CEV A;  5EF7 A;  4BZ5 A;  3Q9B A;  1P8P A;  4ZUO A;  4Q42 A;  3C0Z A;  1P8O A;  2VQW G;  5EFK B;  3RQD A;  5EFH A;  4MYF A;  2VQO A;  3KV2 A;  1ZZ1 A;  4GSM A;  4CQF A;  4LXZ A;  3F80 A;  3ZNS A;  3ZNR A;  1HQH A;  4ZUM A;  5EFN A;  5G11 A;  3PZL A;  4IXV A;  5D1D A;  4RHK A;  4Q41 A;  4HZE A;  3TF3 A;  2GH6 A;  4Q3V A;  3EZT A;  4Q3R C;  1TA1 A;  5G3W A;  4IU4 A;  1CEV A;  5EEN A;  4FCK A;  5D1B A;  4GSV A;  1T64 A;  4RN1 A;  5DC7 A;  3THE A;  1HQ5 A;  3NIQ A;  3Q9C A;  4Q3U A;  1P8Q A;  5DC8 A;  3MZ4 A;  2A0M A;  4BZ6 A;  1C3S A;  1VKG A;  1WOI A;  2ZAV A;  3THJ A;  5G17 A;  4GWD A;  5D1C A;  4ITY A;  5G0J A;  1RLA A;  1T5G A;  3F07 A;  2V5X A;  4MXR A;  4DZ4 A;  1TBJ A;  1R1O A;  1TBH A;  4ZUR A;  5DC5 A;  4BZ9 A;  5JI5 A;  3GN0 A;  5EEI A;  5HJA A;  3E6V A;  4ZUN A;  1TBL A;  3NIP A;  4RHJ A;  4RN0 A;  3RLA A;  1W22 A;  4RHM A;  3E8Q A;  4GWC A;  1P8S A;  4RHI A;  3E9B A;  3LHL A;  3MZ3 A;  4HWW A;  4QA1 A;  5G1C A;  5G1B A;  4IE2 A;  5G13 A;  5ICN B;  1WOH A;  1C3R A;  1WVA A;  4MYL A;  3MEN A;  1P8R A;  3F06 A;  5THU A;  1T4R A;  3MFV A;  1HQG A;  3LP7 A;  4QA0 A;  3SJT A;  3THH A;  3E6K A;  5G1A A;  4Q40 A;  1T4P A;  1PQ3 A;  1T67 A;  4G3H A;  4RHQ A;  4RLA A;  5EF8 A;  5THS A;  4CBY A;  1XFK A;  3DJ8 A;  4Q3Q A;  3F0R A;  3CEV A;  4QA3 A;  4Q3R A;  1T69 A;  5G0Y A;  5HJ9 A;  1T4S A;  4BZ7 A;  5EEM A;  1ZZ3 A;  3SL0 A;  4QA2 A;  4ZUQ A;  5THV A;  2PHO A;  1T5F A;  5G12 A;  5IX0 A;  4RHL A;  2AEB A;  5EFJ D;  3Q9F A;  2VQV A;  3C0Y A;  3C10 A;  5RLA A;  4BZ8 A;  3Q9E A;  4QA6 A;  1P8M A; 
#chains in the Genus database with same CATH homology
 5EEK A;  3MZ7 A;  5DC6 A;  4A69 A;  4CBT A;  5THT A;  3EW8 A;  4LY1 A;  3EZP A;  5FCW A;  3SFH A;  5A2S A;  1ZZ0 A;  4ZUP A;  4RN2 A;  4QA5 A;  5BWZ A;  5G0G A;  5G0I A;  2VQJ A;  2VQQ A;  4QA4 A;  5G10 A;  5EEF A;  5G0H A;  5EFG A;  5EFB D;  4QA7 A;  3EWF A;  2VCG A;  1C3P A;  5FUE A;  2VQM A;  3SFF A;  3MAX A;  5G0X A;  2V5W A;  5LI3 A;  4BKX B;  3MZ6 A;  5EF7 A;  4BZ5 A;  3Q9B A;  4ZUO A;  3C0Z A;  2VQW G;  5EFK B;  3RQD A;  5EFH A;  2VQO A;  1ZZ1 A;  4CQF A;  4LXZ A;  3ZNS A;  3ZNR A;  4ZUM A;  5EFN A;  5G11 A;  5D1D A;  2GH6 A;  3EZT A;  5G3W A;  5EEN A;  5D1B A;  4RN1 A;  1T64 A;  5DC7 A;  3Q9C A;  5DC8 A;  3MZ4 A;  4BZ6 A;  1C3S A;  1VKG A;  5G17 A;  5D1C A;  5G0J A;  3F07 A;  2V5X A;  4ZUR A;  5DC5 A;  4BZ9 A;  5JI5 A;  5EEI A;  4ZUN A;  4RN0 A;  1W22 A;  5IWG A;  5G1C A;  5G1B A;  5G13 A;  3MZ3 A;  4QA1 A;  5ICN B;  1C3R A;  5THU A;  3MEN A;  3F06 A;  4QA0 A;  5G1A A;  1T67 A;  5EF8 A;  5THS A;  4CBY A;  3F0R A;  4QA3 A;  1T69 A;  5G0Y A;  4BZ7 A;  5EEM A;  1ZZ3 A;  4QA2 A;  4ZUQ A;  5THV A;  5G12 A;  5IX0 A;  5EFJ D;  4BZ8 A;  3Q9F A;  2VQV A;  3C0Y A;  3C10 A;  3Q9E A;  4QA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...