2CEVA

Arginase from bacillus caldevelox, native structure at ph 8.5
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
298
structure length
298
Chain Sequence
KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ARGINASE)
publication title Crystal structures of Bacillus caldovelox arginase in complex with substrate and inhibitors reveal new insights into activation, inhibition and catalysis in the arginase superfamily.
pubmed doi rcsb
source organism Bacillus caldovelox
molecule tags Hydrolase
total genus 117
structure length 298
sequence length 298
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 2cevA00
3THEA 4IU4A 1T4PA 4Q3PA 4MYNA 4RHLA 4IE3A 1PQ3A 1HQFA 3LP4A 4Q40A 1WOIA 2PLLA 4MYLA 3MFVA 1ZPGA 3E6VA 3GN0A 3PZLA 1WVBA 3LHLA 4Q41A 1GQ7A 3F80A 4IU0A 1T4SA 1T5GA 3CEVA 4Q3VA 4IE1A 4GWDA 1HQ5A 4RHJA 1WOHA 1TBHA 3GMZA 1T4RA 1T4TA 3KV2A 1P8OA 3E6KA 3SL0A 3TH7A 2PHOA 4MXRA 1WVAA 4Q3TA 1HQHA 4GSMA 4Q3SA 4IU5A 2ZAVA 3TF3A 4RHIA 4MYKA 3E8QA 4MYFA 4FCKA 3MMRA 4G3HA 2PHAA 4I06A 1WOGA 3SKKA 4CEVA 3DJ8A 3NIPA 5HJAA 1TBJA 3MFWA 4HXQA 1R1OA 4Q3RA 4ITYA 3SJTA 1GQ6A 2CEVA 4HZEA 4RHKA 2RLAA 1RLAA 3M1RA 3MJLA 3NIQA 3SL1A 5HJ9A 4Q3UA 1P8SA 1XFKA 1T5FA 2AEBA 4GSVA 2EF4A 1HQGA 1P8PA 5CEVA 4FCIA 3LP7A 4DZ4A 5RLAA 1HQXA 1ZPEA 1TBLA 4Q3QA 4IU1A 3THJA 4GSZA 4RHQA 4IXVA 1P8MA 3THHA 1TA1A 3E9BA 4GWCA 1CEVA 1P8RA 4RLAA 4HWWA 4IE2A 4Q3RC 2EIVA 1P8NA 3NIOA 4IXUA 2A0MA 1D3VA 3E8ZA 4Q42A 3RLAA 2EF5A 1P8QA 4RHMA
chains in the Genus database with same CATH superfamily
4ZURA 3THEA 1C3PA 4IU4A 1T4PA 4Q3PA 4RN2A 4MYNA 4RHLA 5G0IA 3Q9BA 5EFHA 4A69A 3EZPA 4IE3A 4QA3A 5IWGA 1PQ3A 5THVA 4BZ8A 5A2SA 1HQFA 1W22A 3F07A 3LP4A 4Q40A 1WOIA 2PLLA 4MYLA 3MFVA 5EEFA 4CQFA 5EF8A 1ZPGA 3E6VA 3GN0A 3PZLA 1WVBA 2VCGA 3LHLA 1GQ7A 3F80A 4ZUOA 1C3RA 4IU0A 4Q41A 1T4SA 1T5GA 3CEVA 4Q3VA 4IE1A 3RQDA 4GWDA 3F0RA 1HQ5A 4RHJA 1WOHA 1TBHA 3GMZA 3C10A 1T4RA 4QA4A 1T4TA 3KV2A 4ZUMA 5G10A 4ZUNA 1P8OA 3E6KA 1T64A 5G0GA 3SL0A 3TH7A 5DC8A 2PHOA 4MXRA 1WVAA 3MZ7A 5G11A 4Q3TA 5BWZA 1HQHA 3MAXA 4GSMA 4IU5A 4Q3SA 5LI3A 2VQVA 5G1CA 2ZAVA 5EEMA 3TF3A 5ICNB 5EFBD 4ZUQA 5FUEA 1ZZ0A 4RHIA 5D1BA 4MYKA 4BZ9A 3E8QA 3EZTA 4MYFA 3Q9FA 2V5WA 3MMRA 4FCKA 4QA6A 4QA5A 4RN0A 4CBTA 4G3HA 2PHAA 5G13A 3EW8A 4QA2A 4I06A 3SFFA 1WOGA 1ZZ3A 3SKKA 4CEVA 3DJ8A 5G3WA 3NIPA 5EEKA 5G0YA 5HJAA 1TBJA 3MFWA 4RN1A 3Q9EA 4HXQA 1R1OA 4Q3RA 5G12A 4ITYA 3SJTA 5DC7A 5D1DA 1GQ6A 5G17A 5D1CA 2CEVA 5EFKB 4HZEA 4RHKA 2RLAA 2VQOA 4BKXB 1RLAA 3M1RA 3MJLA 5DC5A 2VQMA 3NIQA 5DC6A 4CBYA 5JI5A 3C0ZA 4QA7A 3SL1A 1ZZ1A 5HJ9A 3ZNSA 4Q3UA 1P8SA 1XFKA 1T67A 2VQWG 3MZ4A 1T5FA 2AEBA 4LXZA 2V5XA 2EF4A 3EWFA 4GSVA 1HQGA 5FCWA 5G0JA 1P8PA 5EENA 5CEVA 5G0XA 5G0HA 4FCIA 1VKGA 4BZ7A 3F06A 5EFGA 5G1AA 3LP7A 3MENA 2GH6A 4QA0A 4QA1A 4DZ4A 5RLAA 1HQXA 1ZPEA 1T69A 1TBLA 3MZ6A 4BZ6A 1C3SA 4ZUPA 4LY1A 2VQQA 4IU1A 4Q3QA 5THTA 3THJA 4GSZA 4RHQA 5EEIA 4IXVA 5IX0A 2VQJA 5EFNA 3ZNRA 1P8MA 3THHA 5THUA 5THSA 1TA1A 3E9BA 4GWCA 1CEVA 1P8RA 4RLAA 4BZ5A 4HWWA 3SFHA 5EFJD 5EF7A 4IE2A 4Q3RC 3C0YA 1P8NA 2EIVA 3NIOA 4IXUA 2A0MA 1D3VA 3MZ3A 3E8ZA 4Q42A 3RLAA 2EF5A 5G1BA 1P8QA 3Q9CA 4RHMA
chains in the Genus database with same CATH topology
3THEA 4IU4A 1T4PA 4Q3PA 4MYNA 4RHLA 4IE3A 1PQ3A 1HQFA 3LP4A 4Q40A 1WOIA 2PLLA 4MYLA 3MFVA 1ZPGA 3E6VA 3GN0A 3PZLA 1WVBA 3LHLA 4Q41A 1GQ7A 3F80A 4IU0A 1T4SA 1T5GA 3CEVA 4Q3VA 4IE1A 4GWDA 1HQ5A 4RHJA 1WOHA 1TBHA 3GMZA 1T4RA 1T4TA 3KV2A 1P8OA 3E6KA 3SL0A 3TH7A 2PHOA 4MXRA 1WVAA 4Q3TA 1HQHA 4GSMA 4Q3SA 4IU5A 2ZAVA 3TF3A 4RHIA 4MYKA 3E8QA 4MYFA 4FCKA 3MMRA 4G3HA 2PHAA 4I06A 1WOGA 3SKKA 4CEVA 3DJ8A 3NIPA 5HJAA 1TBJA 3MFWA 4HXQA 1R1OA 4Q3RA 4ITYA 3SJTA 1GQ6A 2CEVA 4HZEA 4RHKA 2RLAA 1RLAA 3M1RA 3MJLA 3NIQA 3SL1A 5HJ9A 4Q3UA 1P8SA 1XFKA 1T5FA 2AEBA 4GSVA 2EF4A 1HQGA 1P8PA 5CEVA 4FCIA 3LP7A 4DZ4A 5RLAA 1HQXA 1ZPEA 1TBLA 4Q3QA 4IU1A 3THJA 4GSZA 4RHQA 4IXVA 1P8MA 3THHA 1TA1A 3E9BA 4GWCA 1CEVA 1P8RA 4RLAA 4HWWA 4IE2A 4Q3RC 2EIVA 1P8NA 3NIOA 4IXUA 2A0MA 1D3VA 3E8ZA 4Q42A 3RLAA 2EF5A 1P8QA 4RHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THE A;  4IU4 A;  1T4P A;  4Q3P A;  4MYN A;  4RHL A;  4IE3 A;  1PQ3 A;  1HQF A;  3LP4 A;  4Q40 A;  1WOI A;  2PLL A;  4MYL A;  3MFV A;  1ZPG A;  3E6V A;  3GN0 A;  3PZL A;  1WVB A;  3LHL A;  4Q41 A;  1GQ7 A;  3F80 A;  4IU0 A;  1T4S A;  1T5G A;  3CEV A;  4Q3V A;  4IE1 A;  4GWD A;  1HQ5 A;  4RHJ A;  1WOH A;  1TBH A;  3GMZ A;  1T4R A;  1T4T A;  3KV2 A;  1P8O A;  3E6K A;  3SL0 A;  3TH7 A;  2PHO A;  4MXR A;  1WVA A;  4Q3T A;  1HQH A;  4GSM A;  4Q3S A;  4IU5 A;  2ZAV A;  3TF3 A;  4RHI A;  4MYK A;  3E8Q A;  4MYF A;  4FCK A;  3MMR A;  4G3H A;  2PHA A;  4I06 A;  1WOG A;  3SKK A;  4CEV A;  3DJ8 A;  3NIP A;  5HJA A;  1TBJ A;  3MFW A;  4HXQ A;  1R1O A;  4Q3R A;  4ITY A;  3SJT A;  1GQ6 A;  2CEV A;  4HZE A;  4RHK A;  2RLA A;  1RLA A;  3M1R A;  3MJL A;  3NIQ A;  3SL1 A;  5HJ9 A;  4Q3U A;  1P8S A;  1XFK A;  1T5F A;  2AEB A;  4GSV A;  2EF4 A;  1HQG A;  1P8P A;  5CEV A;  4FCI A;  3LP7 A;  4DZ4 A;  5RLA A;  1HQX A;  1ZPE A;  1TBL A;  4Q3Q A;  4IU1 A;  3THJ A;  4GSZ A;  4RHQ A;  4IXV A;  1P8M A;  3THH A;  1TA1 A;  3E9B A;  4GWC A;  1CEV A;  1P8R A;  4RLA A;  4HWW A;  4IE2 A;  4Q3R C;  2EIV A;  1P8N A;  3NIO A;  4IXU A;  2A0M A;  1D3V A;  3E8Z A;  4Q42 A;  3RLA A;  2EF5 A;  1P8Q A;  4RHM A; 
#chains in the Genus database with same CATH topology
 4ZUR A;  3THE A;  1C3P A;  4IU4 A;  1T4P A;  4Q3P A;  4RN2 A;  4MYN A;  4RHL A;  5G0I A;  3Q9B A;  5EFH A;  4A69 A;  3EZP A;  4IE3 A;  4QA3 A;  5IWG A;  1PQ3 A;  5THV A;  4BZ8 A;  5A2S A;  1HQF A;  1W22 A;  3F07 A;  3LP4 A;  4Q40 A;  1WOI A;  2PLL A;  4MYL A;  3MFV A;  5EEF A;  4CQF A;  5EF8 A;  1ZPG A;  3E6V A;  3GN0 A;  3PZL A;  1WVB A;  2VCG A;  3LHL A;  1GQ7 A;  3F80 A;  4ZUO A;  1C3R A;  4IU0 A;  4Q41 A;  1T4S A;  1T5G A;  3CEV A;  4Q3V A;  4IE1 A;  3RQD A;  4GWD A;  3F0R A;  1HQ5 A;  4RHJ A;  1WOH A;  1TBH A;  3GMZ A;  3C10 A;  1T4R A;  4QA4 A;  1T4T A;  3KV2 A;  4ZUM A;  5G10 A;  4ZUN A;  1P8O A;  3E6K A;  1T64 A;  5G0G A;  3SL0 A;  3TH7 A;  5DC8 A;  2PHO A;  4MXR A;  1WVA A;  3MZ7 A;  5G11 A;  4Q3T A;  5BWZ A;  1HQH A;  3MAX A;  4GSM A;  4IU5 A;  4Q3S A;  5LI3 A;  2VQV A;  5G1C A;  2ZAV A;  5EEM A;  3TF3 A;  5ICN B;  5EFB D;  4ZUQ A;  5FUE A;  1ZZ0 A;  4RHI A;  5D1B A;  4MYK A;  4BZ9 A;  3E8Q A;  3EZT A;  4MYF A;  3Q9F A;  2V5W A;  3MMR A;  4FCK A;  4QA6 A;  4QA5 A;  4RN0 A;  4CBT A;  4G3H A;  2PHA A;  5G13 A;  3EW8 A;  4QA2 A;  4I06 A;  3SFF A;  1WOG A;  1ZZ3 A;  3SKK A;  4CEV A;  3DJ8 A;  5G3W A;  3NIP A;  5EEK A;  5G0Y A;  5HJA A;  1TBJ A;  3MFW A;  4RN1 A;  3Q9E A;  4HXQ A;  1R1O A;  4Q3R A;  5G12 A;  4ITY A;  3SJT A;  5DC7 A;  5D1D A;  1GQ6 A;  5G17 A;  5D1C A;  2CEV A;  5EFK B;  4HZE A;  4RHK A;  2RLA A;  2VQO A;  4BKX B;  1RLA A;  3M1R A;  3MJL A;  5DC5 A;  2VQM A;  3NIQ A;  5DC6 A;  4CBY A;  5JI5 A;  3C0Z A;  4QA7 A;  3SL1 A;  1ZZ1 A;  5HJ9 A;  3ZNS A;  4Q3U A;  1P8S A;  1XFK A;  1T67 A;  2VQW G;  3MZ4 A;  1T5F A;  2AEB A;  4LXZ A;  2V5X A;  2EF4 A;  3EWF A;  4GSV A;  1HQG A;  5FCW A;  5G0J A;  1P8P A;  5EEN A;  5CEV A;  5G0X A;  5G0H A;  4FCI A;  1VKG A;  4BZ7 A;  3F06 A;  5EFG A;  5G1A A;  3LP7 A;  3MEN A;  2GH6 A;  4QA0 A;  4QA1 A;  4DZ4 A;  5RLA A;  1HQX A;  1ZPE A;  1T69 A;  1TBL A;  3MZ6 A;  4BZ6 A;  1C3S A;  4ZUP A;  4LY1 A;  2VQQ A;  4IU1 A;  4Q3Q A;  5THT A;  3THJ A;  4GSZ A;  4RHQ A;  5EEI A;  4IXV A;  5IX0 A;  2VQJ A;  5EFN A;  3ZNR A;  1P8M A;  3THH A;  5THU A;  5THS A;  1TA1 A;  3E9B A;  4GWC A;  1CEV A;  1P8R A;  4RLA A;  4BZ5 A;  4HWW A;  3SFH A;  5EFJ D;  5EF7 A;  4IE2 A;  4Q3R C;  3C0Y A;  1P8N A;  2EIV A;  3NIO A;  4IXU A;  2A0M A;  1D3V A;  3MZ3 A;  3E8Z A;  4Q42 A;  3RLA A;  2EF5 A;  5G1B A;  1P8Q A;  3Q9C A;  4RHM A; 
#chains in the Genus database with same CATH homology
 3THE A;  4IU4 A;  1T4P A;  4Q3P A;  4MYN A;  4RHL A;  4IE3 A;  1PQ3 A;  1HQF A;  3LP4 A;  4Q40 A;  1WOI A;  2PLL A;  4MYL A;  3MFV A;  1ZPG A;  3E6V A;  3GN0 A;  3PZL A;  1WVB A;  3LHL A;  4Q41 A;  1GQ7 A;  3F80 A;  4IU0 A;  1T4S A;  1T5G A;  3CEV A;  4Q3V A;  4IE1 A;  4GWD A;  1HQ5 A;  4RHJ A;  1WOH A;  1TBH A;  3GMZ A;  1T4R A;  1T4T A;  3KV2 A;  1P8O A;  3E6K A;  3SL0 A;  3TH7 A;  2PHO A;  4MXR A;  1WVA A;  4Q3T A;  1HQH A;  4GSM A;  4Q3S A;  4IU5 A;  2ZAV A;  3TF3 A;  4RHI A;  4MYK A;  3E8Q A;  4MYF A;  4FCK A;  3MMR A;  4G3H A;  2PHA A;  4I06 A;  1WOG A;  3SKK A;  4CEV A;  3DJ8 A;  3NIP A;  5HJA A;  1TBJ A;  3MFW A;  4HXQ A;  1R1O A;  4Q3R A;  4ITY A;  3SJT A;  1GQ6 A;  2CEV A;  4HZE A;  4RHK A;  2RLA A;  1RLA A;  3M1R A;  3MJL A;  3NIQ A;  3SL1 A;  5HJ9 A;  4Q3U A;  1P8S A;  1XFK A;  1T5F A;  2AEB A;  4GSV A;  2EF4 A;  1HQG A;  1P8P A;  5CEV A;  4FCI A;  3LP7 A;  4DZ4 A;  5RLA A;  1HQX A;  1ZPE A;  1TBL A;  4Q3Q A;  4IU1 A;  3THJ A;  4GSZ A;  4RHQ A;  4IXV A;  1P8M A;  3THH A;  1TA1 A;  3E9B A;  4GWC A;  1CEV A;  1P8R A;  4RLA A;  4HWW A;  4IE2 A;  4Q3R C;  2EIV A;  1P8N A;  3NIO A;  4IXU A;  2A0M A;  1D3V A;  3E8Z A;  4Q42 A;  3RLA A;  2EF5 A;  1P8Q A;  4RHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...