5LI3A

Crystal structure of hdac-like protein from p. aeruginosa in complex with a photo-switchable inhibitor.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
374
structure length
374
Chain Sequence
RRTAFFFDELCLWHAAGPHALTLPVGGWVQPPAAAGHAESPETKRRLKSLLDVSGLTARLQLRSAPPASDEDLLRVHPAHYLERFKALSDAGGGSLGQDAPIGPGSYEIARLSAGLAIAALDAVLAGEADNAYSLSRPPGHHCLPDQAMGFCFFANIAVAIEAAKARHGVERVAVLDWDVHHGNGTQAIYYRRDDVLSISLHQDGCFPPGYSGAEDIGEDRGRGFNLNVPLLPGGGHDAYMQAMQRIVLPALERFRPQLIVVASGFDANAVDPLARMQLHSDSFRAMTAMVRDAAERHAGGRLVVVHEGGYSEAYVPFCGLAVIEELSGVRSAVRDPLRDFIELQQPNAAFRDFQRQRLEELAAQFGLCPAQPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetoin utilization protein
publication title Toward Photopharmacological Antimicrobial Chemotherapy Using Photoswitchable Amidohydrolase Inhibitors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 138
structure length 374
sequence length 374
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5li3A00
5G0IA 4LXZA 4ZUPA 5IWGA 2VQQA 4ZUMA 5EENA 4BZ5A 5EEIA 2GH6A 4BZ9A 3Q9FA 3MZ6A 5ICNB 5EEKA 5FCWA 5THVA 4ZUNA 2VQMA 3MZ7A 4RN2A 4ZUOA 3Q9EA 3MAXA 5D1CA 3Q9CA 4QA4A 2V5XA 3EZPA 5DC8A 5G0YA 5BWZA 3RQDA 4ZUQA 5D1BA 5EEFA 2V5WA 4BZ6A 5DC5A 5G10A 5G11A 3F0RA 5DC6A 3MZ4A 4QA5A 5THUA 1VKGA 4QA2A 5EFHA 4A69A 5G0JA 3ZNSA 3Q9BA 5IX0A 1T69A 5DC7A 5FUEA 5EFGA 5EF7A 1C3PA 4LY1A 3ZNRA 4ZURA 4RN0A 5EF8A 5EFBD 5EFKB 5G17A 2VQWG 2VQVA 5A2SA 3EWFA 4CBYA 5G13A 3EW8A 3MENA 1ZZ0A 1T64A 4CQFA 4QA3A 3F06A 4BZ8A 5G1CA 5EFJD 5G3WA 3MZ3A 2VQOA 2VQJA 1C3RA 4QA7A 5D1DA 4CBTA 3F07A 4RN1A 4QA0A 5G12A 4QA6A 1W22A 4BKXB 5G0GA 1ZZ1A 5THSA 3SFHA 1C3SA 1ZZ3A 3EZTA 5EFNA 5THTA 5G0HA 3C10A 5JI5A 3SFFA 5LI3A 5EEMA 3C0YA 5G1AA 5G0XA 4QA1A 3C0ZA 4BZ7A 2VCGA 1T67A 5G1BA
chains in the Genus database with same CATH superfamily
5G0IA 4LXZA 4GSZA 4ZUPA 2EIVA 5IWGA 1TBJA 4MYFA 2VQQA 3SL1A 4GSMA 1HQ5A 4ZUMA 2EF4A 4Q3QA 5EENA 4Q3VA 1ZPGA 1T5GA 4Q3RC 4BZ5A 4FCIA 5EEIA 2GH6A 4HWWA 4RHLA 4IE1A 4BZ9A 1P8QA 3MZ6A 3Q9FA 4I06A 5ICNB 3RLAA 1P8RA 5EEKA 5FCWA 5THVA 4MXRA 4ZUNA 2VQMA 3MZ7A 4RN2A 4ZUOA 1T4SA 3Q9EA 3MAXA 3CEVA 3MMRA 5D1CA 3Q9CA 4QA4A 2V5XA 3EZPA 5DC8A 4HXQA 4GWCA 4RHMA 2EF5A 5G0YA 5BWZA 4IE2A 3RQDA 1CEVA 4ZUQA 5RLAA 3PZLA 5D1BA 5EEFA 3SKKA 2V5WA 2PHAA 4BZ6A 5DC5A 1P8PA 5G10A 4DZ4A 1WVBA 3E8QA 3NIPA 1P8SA 3LP4A 3THEA 5G11A 3F0RA 5DC6A 1PQ3A 3DJ8A 3E6KA 4Q3PA 1WOHA 3GMZA 2PLLA 4MYLA 2PHOA 4RLAA 3NIQA 1WOGA 3MZ4A 4Q42A 4FCKA 4IE3A 4Q3RA 4QA5A 1GQ6A 3E6VA 3NIOA 4RHIA 5THUA 2A0MA 1VKGA 1TBHA 4IU1A 4QA2A 3E8ZA 4Q3TA 5EFHA 1WVAA 4A69A 4IU0A 1HQGA 3M1RA 5G0JA 3ZNSA 1WOIA 3Q9BA 5IX0A 1T69A 5DC7A 3TF3A 5FUEA 1RLAA 5EFGA 1GQ7A 4Q40A 4HZEA 5EF7A 1C3PA 4LY1A 4G3HA 3ZNRA 3SJTA 1P8MA 4ZURA 1TBLA 4GSVA 4RN0A 5EF8A 5EFBD 5EFKB 5G17A 1P8OA 2VQWG 4CEVA 3MJLA 2VQVA 5CEVA 5A2SA 3EWFA 4CBYA 5G13A 3EW8A 3MENA 1ZZ0A 1T64A 4IU4A 4Q3UA 3E9BA 4CQFA 1HQHA 4QA3A 3F06A 3MFVA 1XFKA 5HJAA 4IU5A 3MFWA 4BZ8A 5G1CA 1R1OA 4RHQA 5EFJD 1TA1A 5G3WA 2CEVA 3MZ3A 2VQOA 3TH7A 1P8NA 2VQJA 1C3RA 4QA7A 5D1DA 4CBTA 1D3VA 3F07A 4IXVA 4RN1A 4QA0A 2ZAVA 3LP7A 4MYNA 4QA6A 1W22A 5G12A 2AEBA 3LHLA 4BKXB 1HQFA 1ZZ1A 5G0GA 3SL0A 3F80A 4RHJA 3THJA 4MYKA 5THSA 1C3SA 3KV2A 1ZZ3A 4ITYA 3EZTA 3SFHA 5EFNA 3THHA 4Q41A 5THTA 5G0HA 1T4PA 4Q3SA 3C10A 2RLAA 3GN0A 5JI5A 3SFFA 5LI3A 5EEMA 5HJ9A 3C0YA 1T4RA 4RHKA 5G1AA 5G0XA 1T5FA 4QA1A 4IXUA 3C0ZA 4BZ7A 4GWDA 2VCGA 1ZPEA 1T67A 5G1BA 1T4TA 1HQXA
chains in the Genus database with same CATH topology
5G0IA 4LXZA 4ZUPA 5IWGA 2VQQA 4ZUMA 5EENA 4BZ5A 5EEIA 2GH6A 4BZ9A 3Q9FA 3MZ6A 5ICNB 5EEKA 5FCWA 5THVA 4ZUNA 2VQMA 3MZ7A 4RN2A 4ZUOA 3Q9EA 3MAXA 5D1CA 3Q9CA 4QA4A 2V5XA 3EZPA 5DC8A 5G0YA 5BWZA 3RQDA 4ZUQA 5D1BA 5EEFA 2V5WA 4BZ6A 5DC5A 5G10A 5G11A 3F0RA 5DC6A 3MZ4A 4QA5A 5THUA 1VKGA 4QA2A 5EFHA 4A69A 5G0JA 3ZNSA 3Q9BA 5IX0A 1T69A 5DC7A 5FUEA 5EFGA 5EF7A 1C3PA 4LY1A 3ZNRA 4ZURA 4RN0A 5EF8A 5EFBD 5EFKB 5G17A 2VQWG 2VQVA 5A2SA 3EWFA 4CBYA 5G13A 3EW8A 3MENA 1ZZ0A 1T64A 4CQFA 4QA3A 3F06A 4BZ8A 5G1CA 5EFJD 5G3WA 3MZ3A 2VQOA 2VQJA 1C3RA 4QA7A 5D1DA 4CBTA 3F07A 4RN1A 4QA0A 5G12A 4QA6A 1W22A 4BKXB 5G0GA 1ZZ1A 5THSA 3SFHA 1C3SA 1ZZ3A 3EZTA 5EFNA 5THTA 5G0HA 3C10A 5JI5A 3SFFA 5LI3A 5EEMA 3C0YA 5G1AA 5G0XA 4QA1A 3C0ZA 4BZ7A 2VCGA 1T67A 5G1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G0I A;  4LXZ A;  4ZUP A;  5IWG A;  2VQQ A;  4ZUM A;  5EEN A;  4BZ5 A;  5EEI A;  2GH6 A;  4BZ9 A;  3Q9F A;  3MZ6 A;  5ICN B;  5EEK A;  5FCW A;  5THV A;  4ZUN A;  2VQM A;  3MZ7 A;  4RN2 A;  4ZUO A;  3Q9E A;  3MAX A;  5D1C A;  3Q9C A;  4QA4 A;  2V5X A;  3EZP A;  5DC8 A;  5G0Y A;  5BWZ A;  3RQD A;  4ZUQ A;  5D1B A;  5EEF A;  2V5W A;  4BZ6 A;  5DC5 A;  5G10 A;  5G11 A;  3F0R A;  5DC6 A;  3MZ4 A;  4QA5 A;  5THU A;  1VKG A;  4QA2 A;  5EFH A;  4A69 A;  5G0J A;  3ZNS A;  3Q9B A;  5IX0 A;  1T69 A;  5DC7 A;  5FUE A;  5EFG A;  5EF7 A;  1C3P A;  4LY1 A;  3ZNR A;  4ZUR A;  4RN0 A;  5EF8 A;  5EFB D;  5EFK B;  5G17 A;  2VQW G;  2VQV A;  5A2S A;  3EWF A;  4CBY A;  5G13 A;  3EW8 A;  3MEN A;  1ZZ0 A;  1T64 A;  4CQF A;  4QA3 A;  3F06 A;  4BZ8 A;  5G1C A;  5EFJ D;  5G3W A;  3MZ3 A;  2VQO A;  2VQJ A;  1C3R A;  4QA7 A;  5D1D A;  4CBT A;  3F07 A;  4RN1 A;  4QA0 A;  5G12 A;  4QA6 A;  1W22 A;  4BKX B;  5G0G A;  1ZZ1 A;  5THS A;  3SFH A;  1C3S A;  1ZZ3 A;  3EZT A;  5EFN A;  5THT A;  5G0H A;  3C10 A;  5JI5 A;  3SFF A;  5LI3 A;  5EEM A;  3C0Y A;  5G1A A;  5G0X A;  4QA1 A;  3C0Z A;  4BZ7 A;  2VCG A;  1T67 A;  5G1B A; 
#chains in the Genus database with same CATH topology
 5G0I A;  4LXZ A;  4GSZ A;  4ZUP A;  2EIV A;  5IWG A;  1TBJ A;  4MYF A;  2VQQ A;  3SL1 A;  4GSM A;  1HQ5 A;  4ZUM A;  2EF4 A;  4Q3Q A;  5EEN A;  4Q3V A;  1ZPG A;  1T5G A;  4Q3R C;  4BZ5 A;  4FCI A;  5EEI A;  2GH6 A;  4HWW A;  4RHL A;  4IE1 A;  4BZ9 A;  1P8Q A;  3MZ6 A;  3Q9F A;  4I06 A;  5ICN B;  3RLA A;  1P8R A;  5EEK A;  5FCW A;  5THV A;  4MXR A;  4ZUN A;  2VQM A;  3MZ7 A;  4RN2 A;  4ZUO A;  1T4S A;  3Q9E A;  3MAX A;  3CEV A;  3MMR A;  5D1C A;  3Q9C A;  4QA4 A;  2V5X A;  3EZP A;  5DC8 A;  4HXQ A;  4GWC A;  4RHM A;  2EF5 A;  5G0Y A;  5BWZ A;  4IE2 A;  3RQD A;  1CEV A;  4ZUQ A;  5RLA A;  3PZL A;  5D1B A;  5EEF A;  3SKK A;  2V5W A;  2PHA A;  4BZ6 A;  5DC5 A;  1P8P A;  5G10 A;  4DZ4 A;  1WVB A;  3E8Q A;  3NIP A;  1P8S A;  3LP4 A;  3THE A;  5G11 A;  3F0R A;  5DC6 A;  1PQ3 A;  3DJ8 A;  3E6K A;  4Q3P A;  1WOH A;  3GMZ A;  2PLL A;  4MYL A;  2PHO A;  4RLA A;  3NIQ A;  1WOG A;  3MZ4 A;  4Q42 A;  4FCK A;  4IE3 A;  4Q3R A;  4QA5 A;  1GQ6 A;  3E6V A;  3NIO A;  4RHI A;  5THU A;  2A0M A;  1VKG A;  1TBH A;  4IU1 A;  4QA2 A;  3E8Z A;  4Q3T A;  5EFH A;  1WVA A;  4A69 A;  4IU0 A;  1HQG A;  3M1R A;  5G0J A;  3ZNS A;  1WOI A;  3Q9B A;  5IX0 A;  1T69 A;  5DC7 A;  3TF3 A;  5FUE A;  1RLA A;  5EFG A;  1GQ7 A;  4Q40 A;  4HZE A;  5EF7 A;  1C3P A;  4LY1 A;  4G3H A;  3ZNR A;  3SJT A;  1P8M A;  4ZUR A;  1TBL A;  4GSV A;  4RN0 A;  5EF8 A;  5EFB D;  5EFK B;  5G17 A;  1P8O A;  2VQW G;  4CEV A;  3MJL A;  2VQV A;  5CEV A;  5A2S A;  3EWF A;  4CBY A;  5G13 A;  3EW8 A;  3MEN A;  1ZZ0 A;  1T64 A;  4IU4 A;  4Q3U A;  3E9B A;  4CQF A;  1HQH A;  4QA3 A;  3F06 A;  3MFV A;  1XFK A;  5HJA A;  4IU5 A;  3MFW A;  4BZ8 A;  5G1C A;  1R1O A;  4RHQ A;  5EFJ D;  1TA1 A;  5G3W A;  2CEV A;  3MZ3 A;  2VQO A;  3TH7 A;  1P8N A;  2VQJ A;  1C3R A;  4QA7 A;  5D1D A;  4CBT A;  1D3V A;  3F07 A;  4IXV A;  4RN1 A;  4QA0 A;  2ZAV A;  3LP7 A;  4MYN A;  4QA6 A;  1W22 A;  5G12 A;  2AEB A;  3LHL A;  4BKX B;  1HQF A;  1ZZ1 A;  5G0G A;  3SL0 A;  3F80 A;  4RHJ A;  3THJ A;  4MYK A;  5THS A;  1C3S A;  3KV2 A;  1ZZ3 A;  4ITY A;  3EZT A;  3SFH A;  5EFN A;  3THH A;  4Q41 A;  5THT A;  5G0H A;  1T4P A;  4Q3S A;  3C10 A;  2RLA A;  3GN0 A;  5JI5 A;  3SFF A;  5LI3 A;  5EEM A;  5HJ9 A;  3C0Y A;  1T4R A;  4RHK A;  5G1A A;  5G0X A;  1T5F A;  4QA1 A;  4IXU A;  3C0Z A;  4BZ7 A;  4GWD A;  2VCG A;  1ZPE A;  1T67 A;  5G1B A;  1T4T A;  1HQX A; 
#chains in the Genus database with same CATH homology
 5G0I A;  4LXZ A;  4ZUP A;  5IWG A;  2VQQ A;  4ZUM A;  5EEN A;  4BZ5 A;  5EEI A;  2GH6 A;  4BZ9 A;  3Q9F A;  3MZ6 A;  5ICN B;  5EEK A;  5FCW A;  5THV A;  4ZUN A;  2VQM A;  3MZ7 A;  4RN2 A;  4ZUO A;  3Q9E A;  3MAX A;  5D1C A;  3Q9C A;  4QA4 A;  2V5X A;  3EZP A;  5DC8 A;  5G0Y A;  5BWZ A;  3RQD A;  4ZUQ A;  5D1B A;  5EEF A;  2V5W A;  4BZ6 A;  5DC5 A;  5G10 A;  5G11 A;  3F0R A;  5DC6 A;  3MZ4 A;  4QA5 A;  5THU A;  1VKG A;  4QA2 A;  5EFH A;  4A69 A;  5G0J A;  3ZNS A;  3Q9B A;  5IX0 A;  1T69 A;  5DC7 A;  5FUE A;  5EFG A;  5EF7 A;  1C3P A;  4LY1 A;  3ZNR A;  4ZUR A;  4RN0 A;  5EF8 A;  5EFB D;  5EFK B;  5G17 A;  2VQW G;  2VQV A;  5A2S A;  3EWF A;  4CBY A;  5G13 A;  3EW8 A;  3MEN A;  1ZZ0 A;  1T64 A;  4CQF A;  4QA3 A;  3F06 A;  4BZ8 A;  5G1C A;  5EFJ D;  5G3W A;  3MZ3 A;  2VQO A;  2VQJ A;  1C3R A;  4QA7 A;  5D1D A;  4CBT A;  3F07 A;  4RN1 A;  4QA0 A;  5G12 A;  4QA6 A;  1W22 A;  4BKX B;  5G0G A;  1ZZ1 A;  5THS A;  3SFH A;  1C3S A;  1ZZ3 A;  3EZT A;  5EFN A;  5THT A;  5G0H A;  3C10 A;  5JI5 A;  3SFF A;  5LI3 A;  5EEM A;  3C0Y A;  5G1A A;  5G0X A;  4QA1 A;  3C0Z A;  4BZ7 A;  2VCG A;  1T67 A;  5G1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...