5LI3A

Crystal structure of hdac-like protein from p. aeruginosa in complex with a photo-switchable inhibitor.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
374
structure length
374
Chain Sequence
b'RRTAFFFDELCLWHAAGPHALTLPVGGWVQPPAAAGHAESPETKRRLKSLLDVSGLTARLQLRSAPPASDEDLLRVHPAHYLERFKALSDAGGGSLGQDAPIGPGSYEIARLSAGLAIAALDAVLAGEADNAYSLSRPPGHHCLPDQAMGFCFFANIAVAIEAAKARHGVERVAVLDWDVHHGNGTQAIYYRRDDVLSISLHQDGCFPPGYSGAEDIGEDRGRGFNLNVPLLPGGGHDAYMQAMQRIVLPALERFRPQLIVVASGFDANAVDPLARMQLHSDSFRAMTAMVRDAAERHAGGRLVVVHEGGYSEAYVPFCGLAVIEELSGVRSAVRDPLRDFIELQQPNAAFRDFQRQRLEELAAQFGLCPAQPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetoin utilization protein
publication title Toward Photopharmacological Antimicrobial Chemotherapy Using Photoswitchable Amidohydrolase Inhibitors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 138
structure length 374
sequence length 374
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5li3A00
5THVA 1ZZ1A 4LXZA 4RN2A 4ZURA 5LI3A 4BZ6A 3MZ4A 5G12A 5EFHA 5THTA 3Q9BA 3EZPA 5G0YA 2VCGA 4CBTA 3F07A 5DC7A 3MAXA 5G3WA 3C0YA 5G0XA 5G0HA 5ICNB 5EF7A 1W22A 5FUEA 1C3SA 5G1CA 2GH6A 5G0IA 5BWZA 3F0RA 5G17A 3Q9CA 5G11A 3SFFA 4QA2A 4LY1A 5A2SA 4ZUOA 3EWFA 5IWGA 3SFHA 4QA7A 5D1CA 4ZUNA 4ZUMA 5G0JA 3EW8A 5EFGA 5EFKB 1C3PA 5G1AA 3Q9FA 3EZTA 4RN1A 4RN0A 3C10A 4CQFA 5JI5A 2VQOA 4A69A 5D1BA 5DC5A 5IX0A 3MZ7A 5G10A 1T69A 1ZZ3A 5EF8A 1VKGA 5THUA 4CBYA 4QA5A 2VQVA 3ZNSA 5EEFA 5EEMA 5EEIA 5THSA 4BZ7A 4QA4A 5G0GA 2VQMA 5EFNA 5G13A 2VQWG 3RQDA 4ZUPA 3Q9EA 3MZ3A 5DC6A 2VQJA 4BZ5A 5DC8A 3F06A 4BZ9A 3ZNRA 3C0ZA 4BKXB 4BZ8A 1T64A 4QA1A 4ZUQA 5D1DA 1C3RA 1T67A 3MZ6A 2VQQA 5EFBD 3MENA 5EEKA 2V5WA 5EENA 2V5XA 4QA3A 4QA6A 5G1BA 1ZZ0A 5FCWA 5EFJD 4QA0A
chains in the Genus database with same CATH superfamily
3RQDA 4GSVA 5THVA 1ZZ1A 4GSMA 3KV2A 2PHAA 4LXZA 3GN0A 1WVBA 4DZ4A 4RN2A 1T4RA 4Q40A 1D3VA 1T4SA 1ZPEA 4IU5A 3RLAA 4ZURA 5LI3A 4BZ6A 3MZ4A 5G12A 5EFHA 5THTA 1WOHA 3Q9BA 1T5GA 3EZPA 1HQXA 5G0YA 3TF3A 2VCGA 1P8QA 4CBTA 1GQ7A 3F07A 1HQHA 5DC7A 1XFKA 1TBHA 3MAXA 5G3WA 3C0YA 1P8PA 2ZAVA 4MYFA 4RLAA 1HQGA 1WOGA 5G0XA 4MXRA 4IXVA 2EF4A 3MFVA 5G0HA 1T4TA 4ITYA 5ICNB 4IXUA 1W22A 5EF7A 5FUEA 1C3SA 1HQ5A 4G3HA 1HQFA 4RHIA 5G1CA 2GH6A 4Q42A 5G0IA 5BWZA 3NIOA 4IU0A 3F0RA 4HZEA 5G17A 3Q9CA 5G11A 1CEVA 4HXQA 4QA2A 4LY1A 3SFFA 4ZUOA 5A2SA 3EWFA 5IWGA 3SFHA 2RLAA 4QA7A 5D1CA 4ZUNA 3E6KA 3LP7A 4IE1A 4I06A 4IU4A 4IE2A 3M1RA 4ZUMA 5G0JA 5HJAA 3LHLA 3EW8A 1TBJA 1C3PA 3E6VA 5EFGA 5EFKB 4IU1A 5G1AA 3Q9FA 4GSZA 4RHQA 3EZTA 3DJ8A 4Q3SA 4RN0A 3C10A 4RN1A 4CQFA 4FCKA 3MJLA 5HJ9A 5JI5A 2VQOA 4A69A 5D1BA 5DC5A 3TH7A 5IX0A 3MZ7A 5G10A 3E8QA 1P8NA 3THJA 1P8SA 1T69A 3MFWA 1ZZ3A 2CEVA 5EF8A 1VKGA 5THUA 4CBYA 1ZPGA 4RHMA 5RLAA 2EIVA 3NIPA 4QA5A 3THHA 2VQVA 4RHJA 3ZNSA 4Q41A 4HWWA 3SKKA 3SL1A 5EEFA 3LP4A 5EEMA 1P8RA 5EEIA 5THSA 4BZ7A 3GMZA 4QA4A 2AEBA 5G0GA 1WOIA 2VQMA 4MYNA 5EFNA 2VQWG 3MMRA 4Q3TA 4ZUPA 5G13A 3MZ3A 2VQJA 1WVAA 3Q9EA 4Q3RA 1RLAA 5DC6A 1TA1A 4BZ5A 5DC8A 3F06A 1PQ3A 4BZ9A 3ZNRA 3C0ZA 4Q3UA 4BKXB 4BZ8A 1T64A 4QA1A 4ZUQA 2EF5A 2PLLA 1P8MA 3THEA 3E8ZA 1R1OA 3NIQA 1C3RA 4GWDA 5D1DA 5CEVA 1GQ6A 1T4PA 1T67A 3MZ6A 1TBLA 4Q3QA 2VQQA 3F80A 5EFBD 3MENA 4RHLA 3SL0A 3E9BA 4CEVA 5EEKA 1P8OA 4Q3PA 1T5FA 2V5WA 5EENA 4Q3VA 3CEVA 2PHOA 2V5XA 4Q3RC 4QA3A 4QA6A 2A0MA 3PZLA 4IE3A 1ZZ0A 5G1BA 5FCWA 4MYKA 5EFJD 3SJTA 4MYLA 4RHKA 4GWCA 4QA0A 4FCIA
chains in the Genus database with same CATH topology
5THVA 1ZZ1A 4LXZA 4RN2A 4ZURA 5LI3A 4BZ6A 3MZ4A 5G12A 5EFHA 5THTA 3Q9BA 3EZPA 5G0YA 2VCGA 4CBTA 3F07A 5DC7A 3MAXA 5G3WA 3C0YA 5G0XA 5G0HA 5ICNB 5EF7A 1W22A 5FUEA 1C3SA 5G1CA 2GH6A 5G0IA 5BWZA 3F0RA 5G17A 3Q9CA 5G11A 3SFFA 4QA2A 4LY1A 5A2SA 4ZUOA 3EWFA 5IWGA 3SFHA 4QA7A 5D1CA 4ZUNA 4ZUMA 5G0JA 3EW8A 5EFGA 5EFKB 1C3PA 5G1AA 3Q9FA 3EZTA 4RN1A 4RN0A 3C10A 4CQFA 5JI5A 2VQOA 4A69A 5D1BA 5DC5A 5IX0A 3MZ7A 5G10A 1T69A 1ZZ3A 5EF8A 1VKGA 5THUA 4CBYA 4QA5A 2VQVA 3ZNSA 5EEFA 5EEMA 5EEIA 5THSA 4BZ7A 4QA4A 5G0GA 2VQMA 5EFNA 5G13A 2VQWG 3RQDA 4ZUPA 3Q9EA 3MZ3A 5DC6A 2VQJA 4BZ5A 5DC8A 3F06A 4BZ9A 3ZNRA 3C0ZA 4BKXB 4BZ8A 1T64A 4QA1A 4ZUQA 5D1DA 1C3RA 1T67A 3MZ6A 2VQQA 5EFBD 3MENA 5EEKA 2V5WA 5EENA 2V5XA 4QA3A 4QA6A 5G1BA 1ZZ0A 5FCWA 5EFJD 4QA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5THV A;  1ZZ1 A;  4LXZ A;  4RN2 A;  4ZUR A;  5LI3 A;  4BZ6 A;  3MZ4 A;  5G12 A;  5EFH A;  5THT A;  3Q9B A;  3EZP A;  5G0Y A;  2VCG A;  4CBT A;  3F07 A;  5DC7 A;  3MAX A;  5G3W A;  3C0Y A;  5G0X A;  5G0H A;  5ICN B;  5EF7 A;  1W22 A;  5FUE A;  1C3S A;  5G1C A;  2GH6 A;  5G0I A;  5BWZ A;  3F0R A;  5G17 A;  3Q9C A;  5G11 A;  3SFF A;  4QA2 A;  4LY1 A;  5A2S A;  4ZUO A;  3EWF A;  5IWG A;  3SFH A;  4QA7 A;  5D1C A;  4ZUN A;  4ZUM A;  5G0J A;  3EW8 A;  5EFG A;  5EFK B;  1C3P A;  5G1A A;  3Q9F A;  3EZT A;  4RN1 A;  4RN0 A;  3C10 A;  4CQF A;  5JI5 A;  2VQO A;  4A69 A;  5D1B A;  5DC5 A;  5IX0 A;  3MZ7 A;  5G10 A;  1T69 A;  1ZZ3 A;  5EF8 A;  1VKG A;  5THU A;  4CBY A;  4QA5 A;  2VQV A;  3ZNS A;  5EEF A;  5EEM A;  5EEI A;  5THS A;  4BZ7 A;  4QA4 A;  5G0G A;  2VQM A;  5EFN A;  5G13 A;  2VQW G;  3RQD A;  4ZUP A;  3Q9E A;  3MZ3 A;  5DC6 A;  2VQJ A;  4BZ5 A;  5DC8 A;  3F06 A;  4BZ9 A;  3ZNR A;  3C0Z A;  4BKX B;  4BZ8 A;  1T64 A;  4QA1 A;  4ZUQ A;  5D1D A;  1C3R A;  1T67 A;  3MZ6 A;  2VQQ A;  5EFB D;  3MEN A;  5EEK A;  2V5W A;  5EEN A;  2V5X A;  4QA3 A;  4QA6 A;  5G1B A;  1ZZ0 A;  5FCW A;  5EFJ D;  4QA0 A; 
#chains in the Genus database with same CATH topology
 3RQD A;  4GSV A;  5THV A;  1ZZ1 A;  4GSM A;  3KV2 A;  2PHA A;  4LXZ A;  3GN0 A;  1WVB A;  4DZ4 A;  4RN2 A;  1T4R A;  4Q40 A;  1D3V A;  1T4S A;  1ZPE A;  4IU5 A;  3RLA A;  4ZUR A;  5LI3 A;  4BZ6 A;  3MZ4 A;  5G12 A;  5EFH A;  5THT A;  1WOH A;  3Q9B A;  1T5G A;  3EZP A;  1HQX A;  5G0Y A;  3TF3 A;  2VCG A;  1P8Q A;  4CBT A;  1GQ7 A;  3F07 A;  1HQH A;  5DC7 A;  1XFK A;  1TBH A;  3MAX A;  5G3W A;  3C0Y A;  1P8P A;  2ZAV A;  4MYF A;  4RLA A;  1HQG A;  1WOG A;  5G0X A;  4MXR A;  4IXV A;  2EF4 A;  3MFV A;  5G0H A;  1T4T A;  4ITY A;  5ICN B;  4IXU A;  1W22 A;  5EF7 A;  5FUE A;  1C3S A;  1HQ5 A;  4G3H A;  1HQF A;  4RHI A;  5G1C A;  2GH6 A;  4Q42 A;  5G0I A;  5BWZ A;  3NIO A;  4IU0 A;  3F0R A;  4HZE A;  5G17 A;  3Q9C A;  5G11 A;  1CEV A;  4HXQ A;  4QA2 A;  4LY1 A;  3SFF A;  4ZUO A;  5A2S A;  3EWF A;  5IWG A;  3SFH A;  2RLA A;  4QA7 A;  5D1C A;  4ZUN A;  3E6K A;  3LP7 A;  4IE1 A;  4I06 A;  4IU4 A;  4IE2 A;  3M1R A;  4ZUM A;  5G0J A;  5HJA A;  3LHL A;  3EW8 A;  1TBJ A;  1C3P A;  3E6V A;  5EFG A;  5EFK B;  4IU1 A;  5G1A A;  3Q9F A;  4GSZ A;  4RHQ A;  3EZT A;  3DJ8 A;  4Q3S A;  4RN0 A;  3C10 A;  4RN1 A;  4CQF A;  4FCK A;  3MJL A;  5HJ9 A;  5JI5 A;  2VQO A;  4A69 A;  5D1B A;  5DC5 A;  3TH7 A;  5IX0 A;  3MZ7 A;  5G10 A;  3E8Q A;  1P8N A;  3THJ A;  1P8S A;  1T69 A;  3MFW A;  1ZZ3 A;  2CEV A;  5EF8 A;  1VKG A;  5THU A;  4CBY A;  1ZPG A;  4RHM A;  5RLA A;  2EIV A;  3NIP A;  4QA5 A;  3THH A;  2VQV A;  4RHJ A;  3ZNS A;  4Q41 A;  4HWW A;  3SKK A;  3SL1 A;  5EEF A;  3LP4 A;  5EEM A;  1P8R A;  5EEI A;  5THS A;  4BZ7 A;  3GMZ A;  4QA4 A;  2AEB A;  5G0G A;  1WOI A;  2VQM A;  4MYN A;  5EFN A;  2VQW G;  3MMR A;  4Q3T A;  4ZUP A;  5G13 A;  3MZ3 A;  2VQJ A;  1WVA A;  3Q9E A;  4Q3R A;  1RLA A;  5DC6 A;  1TA1 A;  4BZ5 A;  5DC8 A;  3F06 A;  1PQ3 A;  4BZ9 A;  3ZNR A;  3C0Z A;  4Q3U A;  4BKX B;  4BZ8 A;  1T64 A;  4QA1 A;  4ZUQ A;  2EF5 A;  2PLL A;  1P8M A;  3THE A;  3E8Z A;  1R1O A;  3NIQ A;  1C3R A;  4GWD A;  5D1D A;  5CEV A;  1GQ6 A;  1T4P A;  1T67 A;  3MZ6 A;  1TBL A;  4Q3Q A;  2VQQ A;  3F80 A;  5EFB D;  3MEN A;  4RHL A;  3SL0 A;  3E9B A;  4CEV A;  5EEK A;  1P8O A;  4Q3P A;  1T5F A;  2V5W A;  5EEN A;  4Q3V A;  3CEV A;  2PHO A;  2V5X A;  4Q3R C;  4QA3 A;  4QA6 A;  2A0M A;  3PZL A;  4IE3 A;  1ZZ0 A;  5G1B A;  5FCW A;  4MYK A;  5EFJ D;  3SJT A;  4MYL A;  4RHK A;  4GWC A;  4QA0 A;  4FCI A; 
#chains in the Genus database with same CATH homology
 5THV A;  1ZZ1 A;  4LXZ A;  4RN2 A;  4ZUR A;  5LI3 A;  4BZ6 A;  3MZ4 A;  5G12 A;  5EFH A;  5THT A;  3Q9B A;  3EZP A;  5G0Y A;  2VCG A;  4CBT A;  3F07 A;  5DC7 A;  3MAX A;  5G3W A;  3C0Y A;  5G0X A;  5G0H A;  5ICN B;  5EF7 A;  1W22 A;  5FUE A;  1C3S A;  5G1C A;  2GH6 A;  5G0I A;  5BWZ A;  3F0R A;  5G17 A;  3Q9C A;  5G11 A;  3SFF A;  4QA2 A;  4LY1 A;  5A2S A;  4ZUO A;  3EWF A;  5IWG A;  3SFH A;  4QA7 A;  5D1C A;  4ZUN A;  4ZUM A;  5G0J A;  3EW8 A;  5EFG A;  5EFK B;  1C3P A;  5G1A A;  3Q9F A;  3EZT A;  4RN1 A;  4RN0 A;  3C10 A;  4CQF A;  5JI5 A;  2VQO A;  4A69 A;  5D1B A;  5DC5 A;  5IX0 A;  3MZ7 A;  5G10 A;  1T69 A;  1ZZ3 A;  5EF8 A;  1VKG A;  5THU A;  4CBY A;  4QA5 A;  2VQV A;  3ZNS A;  5EEF A;  5EEM A;  5EEI A;  5THS A;  4BZ7 A;  4QA4 A;  5G0G A;  2VQM A;  5EFN A;  5G13 A;  2VQW G;  3RQD A;  4ZUP A;  3Q9E A;  3MZ3 A;  5DC6 A;  2VQJ A;  4BZ5 A;  5DC8 A;  3F06 A;  4BZ9 A;  3ZNR A;  3C0Z A;  4BKX B;  4BZ8 A;  1T64 A;  4QA1 A;  4ZUQ A;  5D1D A;  1C3R A;  1T67 A;  3MZ6 A;  2VQQ A;  5EFB D;  3MEN A;  5EEK A;  2V5W A;  5EEN A;  2V5X A;  4QA3 A;  4QA6 A;  5G1B A;  1ZZ0 A;  5FCW A;  5EFJ D;  4QA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...