4BZ8A

Crystal structure of schistosoma mansoni hdac8 complexed with j1038
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
426
structure length
393
Chain Sequence
b'SVGIVYGDQYRQLCCSSPKFGDRYALVMDLINAYKLIPELSRVPPLQWDSPSRMYEAVTAFHSTEYVDALKKLQMLHCEEKELTADDELLMDSFSLNYDCPGFPSVFDYSLAAVQGSLAAASALICRHCEVVINWGGGWHHAKRSEASGFCYLNDIVLAIHRLVSSTPTRVLYVDLDLHHGDGVEEAFWYSPRVVTFSVHHASPGFFPGTGTWNLPIFLNGAGRGRFSAFNLPLEEGINDLDWSNAIGPILDSLNIVIQPSYVVVQCGADCLATDPHRIFRLTNFYPNSLSGYLYAIKKILSWKVPTLILGGGGYNFPDTARLWTRVTALTIEEVKGKKMTISPEIPEHSYFSRYGPDFELDIDYFPDSIQKHHRRILEQLRNYADLNKLIYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE 8
publication title Structural Basis for the Inhibition of Histone Deacetylase 8 (Hdac8), a Key Epigenetic Player in the Blood Fluke Schistosoma Mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
total genus 144
structure length 393
sequence length 426
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 4bz8A00
5G17A 5D1BA 5THSA 3SFHA 4BKXB 4QA4A 5THUA 5EENA 4ZUOA 2VQWG 5G0JA 3ZNSA 5EFKB 2VQQA 3SFFA 5EFJD 3RQDA 4BZ7A 3MZ3A 5G3WA 5JI5A 2V5WA 3EW8A 3C0YA 5EEKA 4RN0A 4CBYA 4ZUNA 3EWFA 1VKGA 4LXZA 3Q9BA 5FCWA 5G1BA 5EFGA 5G13A 4QA0A 3ZNRA 2VQJA 5D1DA 5BWZA 3MZ6A 1ZZ3A 1W22A 1C3RA 5G12A 4ZUQA 5EF8A 3MZ4A 5A2SA 4BZ9A 4QA3A 3EZTA 5EFBD 5G11A 4CQFA 2VQOA 5EFHA 2VCGA 5DC5A 5FUEA 5G0YA 4ZUPA 2V5XA 4QA6A 4ZUMA 3Q9FA 5EFNA 4LY1A 4QA7A 5IWGA 4BZ6A 1T69A 5D1CA 1C3PA 3F06A 1ZZ1A 5IX0A 3Q9EA 3F0RA 5DC6A 1T64A 3EZPA 4QA2A 5G0GA 5EEFA 5G10A 4QA1A 3F07A 5THVA 4BZ5A 3C0ZA 1ZZ0A 3Q9CA 2GH6A 5EEIA 3MAXA 4RN2A 5LI3A 4A69A 5DC8A 5EEMA 5G1CA 4RN1A 4ZURA 3MZ7A 5G1AA 5G0IA 2VQMA 4CBTA 4QA5A 3C10A 5ICNB 3MENA 5EF7A 5G0XA 1C3SA 5G0HA 4BZ8A 5DC7A 5THTA 2VQVA 1T67A
chains in the Genus database with same CATH superfamily
5G17A 3SJTA 4IE2A 3GN0A 4IXUA 1P8RA 2EF4A 2EF5A 1P8QA 3NIPA 5D1BA 5THSA 1R1OA 3SFHA 1TBHA 4BKXB 1D3VA 4ITYA 4QA4A 5THUA 1WOGA 5EENA 1TBJA 2PLLA 3DJ8A 4ZUOA 4IU5A 2VQWG 5G0JA 3ZNSA 4GSZA 4Q41A 5EFKB 3THHA 4G3HA 2VQQA 4FCKA 3SFFA 5EFJD 3RQDA 3MMRA 4BZ7A 3MZ3A 3PZLA 5G3WA 5JI5A 4Q3RC 2V5WA 1ZPGA 1HQXA 3EW8A 3C0YA 4RHIA 4RN0A 5EEKA 4CBYA 4RHJA 4Q3RA 4ZUNA 3EWFA 1VKGA 4LXZA 3Q9BA 1TA1A 5FCWA 4GWDA 1T5FA 3F80A 3SL0A 5G1BA 1T5GA 5EFGA 5G13A 1GQ7A 4QA0A 4RHMA 3ZNRA 3THJA 4HWWA 2VQJA 5D1DA 2PHAA 5BWZA 4Q3PA 3E6VA 4RHQA 3MZ6A 4Q40A 1ZZ3A 4IU1A 1HQFA 3M1RA 1C3RA 1W22A 4HZEA 2ZAVA 5G12A 4I06A 4IU4A 4CEVA 4ZUQA 5EF8A 3RLAA 4IE1A 4DZ4A 3MZ4A 4Q3VA 5A2SA 4BZ9A 4QA3A 3EZTA 5EFBD 4IU0A 5G11A 4CQFA 2VQOA 5HJAA 1HQ5A 4GSMA 5EFHA 1T4RA 1P8NA 4Q42A 2VCGA 5DC5A 4MYFA 5FUEA 4MYKA 5G0YA 3THEA 2EIVA 1WOIA 4MYNA 4ZUPA 4GSVA 2V5XA 4QA6A 3MFWA 4IXVA 3MJLA 1P8SA 4ZUMA 3Q9FA 3LP7A 1PQ3A 4LY1A 5EFNA 4QA7A 4Q3SA 5IWGA 3CEVA 1P8OA 4BZ6A 1T69A 5D1CA 4MXRA 1C3PA 3F06A 1ZZ1A 3TF3A 4Q3UA 5IX0A 1P8PA 3Q9EA 3F0RA 1WOHA 1ZPEA 5DC6A 3LP4A 2A0MA 5CEVA 1T64A 4MYLA 4Q3TA 3EZPA 4HXQA 4QA2A 3SL1A 5G0GA 5EEFA 5G10A 3E9BA 1CEVA 1P8MA 3LHLA 4QA1A 3F07A 4Q3QA 5HJ9A 5RLAA 1T4PA 3KV2A 3NIQA 5THVA 4FCIA 3C0ZA 1WVAA 4GWCA 4BZ5A 1XFKA 1ZZ0A 3Q9CA 3MFVA 2GH6A 2RLAA 1WVBA 3MAXA 3NIOA 4IE3A 4RN2A 5EEIA 5LI3A 4A69A 1GQ6A 2PHOA 3SKKA 1TBLA 3E8QA 5DC8A 5EEMA 5G1CA 1RLAA 4RN1A 4ZURA 3MZ7A 5G1AA 5G0IA 2VQMA 3E6KA 3TH7A 4CBTA 4QA5A 3C10A 5ICNB 1HQHA 1T4TA 3MENA 5EF7A 5G0XA 1C3SA 2AEBA 2CEVA 4RHKA 4RLAA 1T4SA 5DC7A 5G0HA 2VQVA 5THTA 4BZ8A 1HQGA 4RHLA 1T67A 3E8ZA 3GMZA
chains in the Genus database with same CATH topology
5G17A 5D1BA 5THSA 3SFHA 4BKXB 4QA4A 5THUA 5EENA 4ZUOA 2VQWG 5G0JA 3ZNSA 5EFKB 2VQQA 3SFFA 5EFJD 3RQDA 4BZ7A 3MZ3A 5G3WA 5JI5A 2V5WA 3EW8A 3C0YA 5EEKA 4RN0A 4CBYA 4ZUNA 3EWFA 1VKGA 4LXZA 3Q9BA 5FCWA 5G1BA 5EFGA 5G13A 4QA0A 3ZNRA 2VQJA 5D1DA 5BWZA 3MZ6A 1ZZ3A 1W22A 1C3RA 5G12A 4ZUQA 5EF8A 3MZ4A 5A2SA 4BZ9A 4QA3A 3EZTA 5EFBD 5G11A 4CQFA 2VQOA 5EFHA 2VCGA 5DC5A 5FUEA 5G0YA 4ZUPA 2V5XA 4QA6A 4ZUMA 3Q9FA 5EFNA 4LY1A 4QA7A 5IWGA 4BZ6A 1T69A 5D1CA 1C3PA 3F06A 1ZZ1A 5IX0A 3Q9EA 3F0RA 5DC6A 1T64A 3EZPA 4QA2A 5G0GA 5EEFA 5G10A 4QA1A 3F07A 5THVA 4BZ5A 3C0ZA 1ZZ0A 3Q9CA 2GH6A 5EEIA 3MAXA 4RN2A 5LI3A 4A69A 5DC8A 5EEMA 5G1CA 4RN1A 4ZURA 3MZ7A 5G1AA 5G0IA 2VQMA 4CBTA 4QA5A 3C10A 5ICNB 3MENA 5EF7A 5G0XA 1C3SA 5G0HA 4BZ8A 5DC7A 5THTA 2VQVA 1T67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G17 A;  5D1B A;  5THS A;  3SFH A;  4BKX B;  4QA4 A;  5THU A;  5EEN A;  4ZUO A;  2VQW G;  5G0J A;  3ZNS A;  5EFK B;  2VQQ A;  3SFF A;  5EFJ D;  3RQD A;  4BZ7 A;  3MZ3 A;  5G3W A;  5JI5 A;  2V5W A;  3EW8 A;  3C0Y A;  5EEK A;  4RN0 A;  4CBY A;  4ZUN A;  3EWF A;  1VKG A;  4LXZ A;  3Q9B A;  5FCW A;  5G1B A;  5EFG A;  5G13 A;  4QA0 A;  3ZNR A;  2VQJ A;  5D1D A;  5BWZ A;  3MZ6 A;  1ZZ3 A;  1W22 A;  1C3R A;  5G12 A;  4ZUQ A;  5EF8 A;  3MZ4 A;  5A2S A;  4BZ9 A;  4QA3 A;  3EZT A;  5EFB D;  5G11 A;  4CQF A;  2VQO A;  5EFH A;  2VCG A;  5DC5 A;  5FUE A;  5G0Y A;  4ZUP A;  2V5X A;  4QA6 A;  4ZUM A;  3Q9F A;  5EFN A;  4LY1 A;  4QA7 A;  5IWG A;  4BZ6 A;  1T69 A;  5D1C A;  1C3P A;  3F06 A;  1ZZ1 A;  5IX0 A;  3Q9E A;  3F0R A;  5DC6 A;  1T64 A;  3EZP A;  4QA2 A;  5G0G A;  5EEF A;  5G10 A;  4QA1 A;  3F07 A;  5THV A;  4BZ5 A;  3C0Z A;  1ZZ0 A;  3Q9C A;  2GH6 A;  5EEI A;  3MAX A;  4RN2 A;  5LI3 A;  4A69 A;  5DC8 A;  5EEM A;  5G1C A;  4RN1 A;  4ZUR A;  3MZ7 A;  5G1A A;  5G0I A;  2VQM A;  4CBT A;  4QA5 A;  3C10 A;  5ICN B;  3MEN A;  5EF7 A;  5G0X A;  1C3S A;  5G0H A;  4BZ8 A;  5DC7 A;  5THT A;  2VQV A;  1T67 A; 
#chains in the Genus database with same CATH topology
 5G17 A;  3SJT A;  4IE2 A;  3GN0 A;  4IXU A;  1P8R A;  2EF4 A;  2EF5 A;  1P8Q A;  3NIP A;  5D1B A;  5THS A;  1R1O A;  3SFH A;  1TBH A;  4BKX B;  1D3V A;  4ITY A;  4QA4 A;  5THU A;  1WOG A;  5EEN A;  1TBJ A;  2PLL A;  3DJ8 A;  4ZUO A;  4IU5 A;  2VQW G;  5G0J A;  3ZNS A;  4GSZ A;  4Q41 A;  5EFK B;  3THH A;  4G3H A;  2VQQ A;  4FCK A;  3SFF A;  5EFJ D;  3RQD A;  3MMR A;  4BZ7 A;  3MZ3 A;  3PZL A;  5G3W A;  5JI5 A;  4Q3R C;  2V5W A;  1ZPG A;  1HQX A;  3EW8 A;  3C0Y A;  4RHI A;  4RN0 A;  5EEK A;  4CBY A;  4RHJ A;  4Q3R A;  4ZUN A;  3EWF A;  1VKG A;  4LXZ A;  3Q9B A;  1TA1 A;  5FCW A;  4GWD A;  1T5F A;  3F80 A;  3SL0 A;  5G1B A;  1T5G A;  5EFG A;  5G13 A;  1GQ7 A;  4QA0 A;  4RHM A;  3ZNR A;  3THJ A;  4HWW A;  2VQJ A;  5D1D A;  2PHA A;  5BWZ A;  4Q3P A;  3E6V A;  4RHQ A;  3MZ6 A;  4Q40 A;  1ZZ3 A;  4IU1 A;  1HQF A;  3M1R A;  1C3R A;  1W22 A;  4HZE A;  2ZAV A;  5G12 A;  4I06 A;  4IU4 A;  4CEV A;  4ZUQ A;  5EF8 A;  3RLA A;  4IE1 A;  4DZ4 A;  3MZ4 A;  4Q3V A;  5A2S A;  4BZ9 A;  4QA3 A;  3EZT A;  5EFB D;  4IU0 A;  5G11 A;  4CQF A;  2VQO A;  5HJA A;  1HQ5 A;  4GSM A;  5EFH A;  1T4R A;  1P8N A;  4Q42 A;  2VCG A;  5DC5 A;  4MYF A;  5FUE A;  4MYK A;  5G0Y A;  3THE A;  2EIV A;  1WOI A;  4MYN A;  4ZUP A;  4GSV A;  2V5X A;  4QA6 A;  3MFW A;  4IXV A;  3MJL A;  1P8S A;  4ZUM A;  3Q9F A;  3LP7 A;  1PQ3 A;  4LY1 A;  5EFN A;  4QA7 A;  4Q3S A;  5IWG A;  3CEV A;  1P8O A;  4BZ6 A;  1T69 A;  5D1C A;  4MXR A;  1C3P A;  3F06 A;  1ZZ1 A;  3TF3 A;  4Q3U A;  5IX0 A;  1P8P A;  3Q9E A;  3F0R A;  1WOH A;  1ZPE A;  5DC6 A;  3LP4 A;  2A0M A;  5CEV A;  1T64 A;  4MYL A;  4Q3T A;  3EZP A;  4HXQ A;  4QA2 A;  3SL1 A;  5G0G A;  5EEF A;  5G10 A;  3E9B A;  1CEV A;  1P8M A;  3LHL A;  4QA1 A;  3F07 A;  4Q3Q A;  5HJ9 A;  5RLA A;  1T4P A;  3KV2 A;  3NIQ A;  5THV A;  4FCI A;  3C0Z A;  1WVA A;  4GWC A;  4BZ5 A;  1XFK A;  1ZZ0 A;  3Q9C A;  3MFV A;  2GH6 A;  2RLA A;  1WVB A;  3MAX A;  3NIO A;  4IE3 A;  4RN2 A;  5EEI A;  5LI3 A;  4A69 A;  1GQ6 A;  2PHO A;  3SKK A;  1TBL A;  3E8Q A;  5DC8 A;  5EEM A;  5G1C A;  1RLA A;  4RN1 A;  4ZUR A;  3MZ7 A;  5G1A A;  5G0I A;  2VQM A;  3E6K A;  3TH7 A;  4CBT A;  4QA5 A;  3C10 A;  5ICN B;  1HQH A;  1T4T A;  3MEN A;  5EF7 A;  5G0X A;  1C3S A;  2AEB A;  2CEV A;  4RHK A;  4RLA A;  1T4S A;  5DC7 A;  5G0H A;  2VQV A;  5THT A;  4BZ8 A;  1HQG A;  4RHL A;  1T67 A;  3E8Z A;  3GMZ A; 
#chains in the Genus database with same CATH homology
 5G17 A;  5D1B A;  5THS A;  3SFH A;  4BKX B;  4QA4 A;  5THU A;  5EEN A;  4ZUO A;  2VQW G;  5G0J A;  3ZNS A;  5EFK B;  2VQQ A;  3SFF A;  5EFJ D;  3RQD A;  4BZ7 A;  3MZ3 A;  5G3W A;  5JI5 A;  2V5W A;  3EW8 A;  3C0Y A;  5EEK A;  4RN0 A;  4CBY A;  4ZUN A;  3EWF A;  1VKG A;  4LXZ A;  3Q9B A;  5FCW A;  5G1B A;  5EFG A;  5G13 A;  4QA0 A;  3ZNR A;  2VQJ A;  5D1D A;  5BWZ A;  3MZ6 A;  1ZZ3 A;  1W22 A;  1C3R A;  5G12 A;  4ZUQ A;  5EF8 A;  3MZ4 A;  5A2S A;  4BZ9 A;  4QA3 A;  3EZT A;  5EFB D;  5G11 A;  4CQF A;  2VQO A;  5EFH A;  2VCG A;  5DC5 A;  5FUE A;  5G0Y A;  4ZUP A;  2V5X A;  4QA6 A;  4ZUM A;  3Q9F A;  5EFN A;  4LY1 A;  4QA7 A;  5IWG A;  4BZ6 A;  1T69 A;  5D1C A;  1C3P A;  3F06 A;  1ZZ1 A;  5IX0 A;  3Q9E A;  3F0R A;  5DC6 A;  1T64 A;  3EZP A;  4QA2 A;  5G0G A;  5EEF A;  5G10 A;  4QA1 A;  3F07 A;  5THV A;  4BZ5 A;  3C0Z A;  1ZZ0 A;  3Q9C A;  2GH6 A;  5EEI A;  3MAX A;  4RN2 A;  5LI3 A;  4A69 A;  5DC8 A;  5EEM A;  5G1C A;  4RN1 A;  4ZUR A;  3MZ7 A;  5G1A A;  5G0I A;  2VQM A;  4CBT A;  4QA5 A;  3C10 A;  5ICN B;  3MEN A;  5EF7 A;  5G0X A;  1C3S A;  5G0H A;  4BZ8 A;  5DC7 A;  5THT A;  2VQV A;  1T67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...